F383547

General Info

Members Datasets Scaffolds Average Seq Length
280 133 560 174

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100272670|Ga0068856_1002726702
Length 193
Sequence VKSKDSPAAGPSAGQGSAQAPGRSIDRLLAAAIVLLAGALVWVVAGTMDVHVTNAGDQAPDFKIVGDDGRTYTRSDFGGKLLVLNFWASWCAPCVQEVPSLEAFQHMLGPQGVVVLGVSIDTSQKRYEQFLRRFRVDFPTARDPEANISSNYGTFQIPETYLIDSTGKVREKIISNQNWVDPQFLDRVKTMLR

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.14
Rhizosphere 89.29
Stem 0
Stem Tuber 0
Unclassified 13.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100272670 3300005614 Bacteria 1708
2 Ga0070658_10156485 3300005327 Bacteria 1911
3 Ga0070683_100727326 3300005329 Unclassified 951
4 Ga0070683_101353168 3300005329 Bacteria 684
5 Ga0070666_10037454 3300005335 Bacteria 3224
6 Ga0070680_100267245 3300005336 Unclassified 1448
7 Ga0068868_100012362 3300005338 Bacteria 6237
8 Ga0068868_100882575 3300005338 Bacteria 812
9 Ga0070660_100019824 3300005339 Bacteria 4934
10 Ga0070660_100069979 3300005339 Bacteria 2737
11 Ga0070660_101077685 3300005339 Unclassified 680
12 Ga0070661_100134645 3300005344 Bacteria 1858
13 Ga0070671_100106934 3300005355 Bacteria 2349
14 Ga0070671_100187892 3300005355 Bacteria 1751
15 Ga0070673_100115829 3300005364 Bacteria 2229
16 Ga0070673_100405834 3300005364 Bacteria 1219
17 Ga0070688_100525229 3300005365 Bacteria 896
18 Ga0070667_100031487 3300005367 Bacteria 4422
19 Ga0070667_100171017 3300005367 Bacteria 1918
20 Ga0070709_10470063 3300005434 Bacteria 950
21 Ga0070714_100047986 3300005435 Bacteria 3630
22 Ga0070713_100390005 3300005436 Bacteria 1299
23 Ga0070678_100842027 3300005456 Bacteria 835
24 Ga0070678_101045981 3300005456 Bacteria 752
25 Ga0070681_10021924 3300005458 Bacteria 6408
26 Ga0070681_10237238 3300005458 Unclassified 1737
27 Ga0070681_10319933 3300005458 Bacteria 1461
28 Ga0070681_10364411 3300005458 Unclassified 1355
29 Ga0070679_100074718 3300005530 Bacteria 3380
30 Ga0070684_100014672 3300005535 Bacteria 6355
31 Ga0070684_101068562 3300005535 Unclassified 758
32 Ga0070684_101182533 3300005535 Bacteria 719
33 Ga0068853_100143156 3300005539 Bacteria 2147
34 Ga0068853_100260614 3300005539 Bacteria 1594
35 Ga0068853_101044556 3300005539 Bacteria 787
36 Ga0070686_101078962 3300005544 Unclassified 662
37 Ga0070693_100303964 3300005547 Unclassified 1076
38 Ga0070665_100047439 3300005548 Bacteria 4311
39 Ga0068855_100045016 3300005563 Bacteria 5220
40 Ga0068855_100087408 3300005563 Bacteria 3603
41 Ga0068855_100158803 3300005563 Bacteria 2567
42 Ga0068855_100456654 3300005563 Bacteria 1393
43 Ga0070664_100130865 3300005564 Bacteria 2204
44 Ga0068857_100189595 3300005577 Unclassified 1872
45 Ga0068854_101140958 3300005578 Bacteria 696
46 Ga0068856_100028574 3300005614 Bacteria 5446
47 Ga0068856_100191587 3300005614 Bacteria 2058
48 Ga0068856_100361212 3300005614 Unclassified 1471
49 Ga0068856_100688223 3300005614 Unclassified 1043
50 Ga0068852_100066966 3300005616 Bacteria 3139
51 Ga0068852_100258503 3300005616 Bacteria 1671
52 Ga0068852_100311349 3300005616 Bacteria 1527
53 Ga0068859_100120542 3300005617 Bacteria 2690
54 Ga0068859_100226061 3300005617 Bacteria 1959
55 Ga0068864_100696926 3300005618 Unclassified 992
56 Ga0068866_10154413 3300005718 Unclassified 1333
57 Ga0068866_10607579 3300005718 Bacteria 739
58 Ga0068863_100024863 3300005841 Bacteria 5713
59 Ga0068863_100672164 3300005841 Bacteria 1028
60 Ga0068858_100041441 3300005842 Bacteria 4268
61 Ga0068858_100059594 3300005842 Bacteria 3528
62 Ga0068858_100522428 3300005842 Unclassified 1148
63 Ga0068860_100073073 3300005843 Bacteria 3260
64 Ga0070717_10864004 3300006028 Bacteria 823
65 Ga0070717_10989561 3300006028 Bacteria 766
66 Ga0070717_11240623 3300006028 Bacteria 678
67 Ga0070716_100053080 3300006173 Bacteria 2310
68 Ga0070716_100090460 3300006173 Bacteria 1851
69 Ga0097621_100023137 3300006237 Bacteria 4833
70 Ga0097621_100259662 3300006237 Bacteria 1523
71 Ga0068871_100237410 3300006358 Bacteria 1584
72 Ga0068871_100922809 3300006358 Bacteria 810
73 Ga0075433_10509141 3300006852 Bacteria 1059
74 Ga0097620_100120544 3300006931 Bacteria 2690
75 Ga0097620_100226074 3300006931 Bacteria 1959
76 Ga0099794_10300184 3300007265 Bacteria 832
77 Ga0105240_10014172 3300009093 Bacteria 10889
78 Ga0105240_10165040 3300009093 Unclassified 2627
79 Ga0105240_10349908 3300009093 Bacteria 1677
80 Ga0105240_10392671 3300009093 Bacteria 1564
81 Ga0105240_10470955 3300009093 Bacteria 1402
82 Ga0105240_10637534 3300009093 Bacteria 1169
83 Ga0105245_10003461 3300009098 Bacteria 14140
84 Ga0114129_10370023 3300009147 Bacteria 1894
85 Ga0105243_10099178 3300009148 Unclassified 2414
86 Ga0105243_11078218 3300009148 Bacteria 810
87 Ga0105241_10019699 3300009174 Bacteria 4979
88 Ga0105241_10041662 3300009174 Bacteria 3470
89 Ga0105241_10043028 3300009174 Unclassified 3419
90 Ga0105241_10177396 3300009174 Bacteria 1765
91 Ga0105241_10240633 3300009174 Bacteria 1530
92 Ga0105241_10813889 3300009174 Bacteria 861
93 Ga0105242_10635545 3300009176 Bacteria 1036
94 Ga0105248_10009590 3300009177 Bacteria 10656
95 Ga0105248_10304113 3300009177 Unclassified 1796
96 Ga0105248_10368287 3300009177 Bacteria 1618
97 Ga0105248_10373215 3300009177 Bacteria 1606
98 Ga0105248_11117877 3300009177 Bacteria 891
99 Ga0105237_10063073 3300009545 Bacteria 3704
100 Ga0105237_10310375 3300009545 Bacteria 1580
101 Ga0105237_10347242 3300009545 Bacteria 1488
102 Ga0105237_10905483 3300009545 Bacteria 889
103 Ga0105238_10015210 3300009551 Bacteria 7790
104 Ga0105238_10026231 3300009551 Bacteria 5938
105 Ga0105238_10084579 3300009551 Bacteria 3162
106 Ga0105238_10131122 3300009551 Bacteria 2485
107 Ga0105238_10449683 3300009551 Bacteria 1285
108 Ga0105249_10447194 3300009553 Bacteria 1330
109 Ga0105239_10006983 3300010375 Bacteria 13009
110 Ga0105239_10023348 3300010375 Bacteria 6812
111 Ga0105239_10043548 3300010375 Bacteria 4921
112 Ga0105239_10179758 3300010375 Bacteria 2367
113 Ga0105239_10755902 3300010375 Bacteria 1113
114 Ga0105239_11203905 3300010375 Unclassified 873
115 Ga0105246_10077950 3300011119 Bacteria 2352
116 Ga0105246_10740001 3300011119 Bacteria 866
117 Ga0157371_10093752 3300013102 Bacteria 2127
118 Ga0157370_10003336 3300013104 Bacteria 18912
119 Ga0157370_10114770 3300013104 Unclassified 2516
120 Ga0157369_10002641 3300013105 Bacteria 21400
121 Ga0157369_10082182 3300013105 Bacteria 3447
122 Ga0157369_10138208 3300013105 Bacteria 2579
123 Ga0157369_10171579 3300013105 Bacteria 2285
124 Ga0157369_10554068 3300013105 Bacteria 1188
125 Ga0157374_10040341 3300013296 Bacteria 4298
126 Ga0157374_10079156 3300013296 Bacteria 3114
127 Ga0157374_10165708 3300013296 Bacteria 2153
128 Ga0157374_10216084 3300013296 Unclassified 1881
129 Ga0157374_10487876 3300013296 Bacteria 1236
130 Ga0157378_10193924 3300013297 Bacteria 1918
131 Ga0157378_10607731 3300013297 Bacteria 1105
132 Ga0163162_10004099 3300013306 Bacteria 13987
133 Ga0157372_10359877 3300013307 Bacteria 1695
134 Ga0157372_10661650 3300013307 Bacteria 1216
135 Ga0157372_10703479 3300013307 Bacteria 1176
136 Ga0157372_10838857 3300013307 Unclassified 1067
137 Ga0157372_12056684 3300013307 Bacteria 656
138 Ga0157375_10556240 3300013308 Bacteria 1309
139 Ga0163163_10074224 3300014325 Bacteria 3393
140 Ga0163163_10097963 3300014325 Bacteria 2953
141 Ga0163163_10306154 3300014325 Bacteria 1641
142 Ga0163163_10992315 3300014325 Bacteria 903
143 Ga0163163_11717269 3300014325 Unclassified 688
144 Ga0157380_10937244 3300014326 Bacteria 895
145 Ga0157379_10069965 3300014968 Bacteria 3139
146 Ga0157379_10520934 3300014968 Bacteria 1104
147 Ga0157376_10187483 3300014969 Bacteria 1895
148 Ga0157376_10244202 3300014969 Bacteria 1674
149 Ga0213873_10080369 3300021358 Bacteria 912
150 Ga0213872_10000310 3300021361 Bacteria 41619
151 Ga0213874_10045795 3300021377 Bacteria 1325
152 Ga0213876_10000901 3300021384 Bacteria 19804
153 Ga0213876_10131523 3300021384 Bacteria 1330
154 Ga0213875_10000008 3300021388 Bacteria 533344
155 Ga0213875_10042845 3300021388 Bacteria 2126
156 Ga0207680_10473580 3300025903 Unclassified 890
157 Ga0207699_10383175 3300025906 Bacteria 998
158 Ga0207705_10282587 3300025909 Bacteria 1271
159 Ga0207654_10020582 3300025911 Bacteria 3499
160 Ga0207654_10034658 3300025911 Unclassified 2806
161 Ga0207707_10016802 3300025912 Bacteria 6376
162 Ga0207695_10019265 3300025913 Bacteria 7858
163 Ga0207695_10083807 3300025913 Bacteria 3220
164 Ga0207695_10086371 3300025913 Bacteria 3164
165 Ga0207695_10178457 3300025913 Unclassified 2045
166 Ga0207695_10408293 3300025913 Bacteria 1242
167 Ga0207695_10415535 3300025913 Bacteria 1229
168 Ga0207671_10087996 3300025914 Bacteria 2336
169 Ga0207671_10369832 3300025914 Bacteria 1138
170 Ga0207671_10707098 3300025914 Unclassified 801
171 Ga0207671_11086027 3300025914 Bacteria 629
172 Ga0207693_10749876 3300025915 Bacteria 754
173 Ga0207660_10079405 3300025917 Bacteria 2407
174 Ga0207660_10264732 3300025917 Unclassified 1360
175 Ga0207657_10001958 3300025919 Bacteria 22216
176 Ga0207657_10149438 3300025919 Bacteria 1904
177 Ga0207657_10762837 3300025919 Unclassified 749
178 Ga0207649_10106929 3300025920 Bacteria 1862
179 Ga0207652_10066613 3300025921 Bacteria 3122
180 Ga0207694_10012947 3300025924 Bacteria 6282
181 Ga0207694_10115277 3300025924 Bacteria 2140
182 Ga0207694_10167685 3300025924 Bacteria 1776
183 Ga0207687_10532135 3300025927 Unclassified 984
184 Ga0207700_10666367 3300025928 Bacteria 928
185 Ga0207664_10063534 3300025929 Unclassified 2951
186 Ga0207644_10153595 3300025931 Bacteria 1783
187 Ga0207644_10207757 3300025931 Bacteria 1547
188 Ga0207709_10178619 3300025935 Bacteria 1497
189 Ga0207670_10342920 3300025936 Bacteria 1181
190 Ga0207711_10349240 3300025941 Bacteria 1369
191 Ga0207711_11070001 3300025941 Bacteria 747
192 Ga0207661_10289940 3300025944 Bacteria 1465
193 Ga0207661_10542470 3300025944 Bacteria 1065
194 Ga0207679_10171665 3300025945 Unclassified 1786
195 Ga0207679_10187922 3300025945 Bacteria 1715
196 Ga0207667_10025358 3300025949 Bacteria 6491
197 Ga0207667_10117680 3300025949 Bacteria 2739
198 Ga0207667_10436503 3300025949 Bacteria 1331
199 Ga0207651_10042246 3300025960 Bacteria 3033
200 Ga0207651_10395833 3300025960 Bacteria 1174
201 Ga0207640_10532080 3300025981 Unclassified 984
202 Ga0207640_11231300 3300025981 Bacteria 666
203 Ga0207658_10079008 3300025986 Bacteria 2515
204 Ga0207677_10014287 3300026023 Bacteria 4632
205 Ga0207703_10159280 3300026035 Bacteria 1976
206 Ga0207703_10494992 3300026035 Unclassified 1147
207 Ga0207703_10993149 3300026035 Unclassified 805
208 Ga0207639_10113799 3300026041 Bacteria 2210
209 Ga0207639_10317838 3300026041 Bacteria 1382
210 Ga0207639_10457597 3300026041 Bacteria 1159
211 Ga0207639_10826226 3300026041 Bacteria 864
212 Ga0207678_10138867 3300026067 Bacteria 2074
213 Ga0207702_10028619 3300026078 Bacteria 4632
214 Ga0207702_10053520 3300026078 Bacteria 3417
215 Ga0207702_10067653 3300026078 Bacteria 3066
216 Ga0207702_10553920 3300026078 Unclassified 1125
217 Ga0207641_10043202 3300026088 Bacteria 3784
218 Ga0207641_10442511 3300026088 Bacteria 1255
219 Ga0207648_10017257 3300026089 Bacteria 6577
220 Ga0207676_10014401 3300026095 Bacteria 5690
221 Ga0207674_10020034 3300026116 Bacteria 7235
222 Ga0207674_10217542 3300026116 Unclassified 1859
223 Ga0207683_10584900 3300026121 Bacteria 1033
224 Ga0207698_10041268 3300026142 Bacteria 3437
225 Ga0207698_10060933 3300026142 Bacteria 2937
226 Ga0268266_10090290 3300028379 Bacteria 2685
227 Ga0268266_10137201 3300028379 Unclassified 2192
228 Ga0268266_10173640 3300028379 Bacteria 1957
229 Ga0268264_10024593 3300028381 Bacteria 4917
230 Ga0265331_10047357 3300031250 Bacteria 2069
231 Ga0265316_10424939 3300031344 Bacteria 955
232 Ga0265314_10002520 3300031711 Bacteria 18664
233 Ga0373928_0057394 3300035084 Bacteria 934
234 Ga0373945_0320126 3300035116 Bacteria 667
235 Ga0373927_0000695 3300035695 Bacteria 25717
236 Ga0373927_0001104 3300035695 Bacteria 20517
237 Ga0373947_0000323 3300035725 Bacteria 27109
238 Ga0373925_0000282 3300037068 Bacteria 53199
239 Ga0373925_0398683 3300037068 Bacteria 1122
240 Ga0373925_0702753 3300037068 Bacteria 834
241 Ga0436364_0063756 3300037853 Bacteria 11859
242 Ga0436364_0160297 3300037853 Bacteria 1818
243 Ga0436364_0258928 3300037853 Bacteria 974
244 Ga0436364_0292674 3300037853 Bacteria 1228
245 Ga0436364_0364416 3300037853 Bacteria 84577
246 Ga0436364_0385117 3300037853 Bacteria 2055
247 Ga0436364_0534005 3300037853 Bacteria 974
248 Ga0436364_1167050 3300037853 Bacteria 3481
249 Ga0436364_1415525 3300037853 Bacteria 425173
250 Ga0436364_1423935 3300037853 Bacteria 12497
251 Ga0436365_0030499 3300039437 Bacteria 2747
252 Ga0436365_0697408 3300039437 Bacteria 1054
253 Ga0436365_1071890 3300039437 Bacteria 1961
254 Ga0436365_1310524 3300039437 Bacteria 1489
255 Ga0436365_1622668 3300039437 Bacteria 4441
256 Ga0436363_0186534 3300039450 Bacteria 815
257 Ga0436363_0287500 3300039450 Bacteria 11257
258 Ga0436363_0761526 3300039450 Bacteria 965
259 Ga0436363_1473951 3300039450 Bacteria 1647
260 Ga0436362_0244189 3300039453 Bacteria 2951
261 Ga0436362_0697991 3300039453 Bacteria 3727
262 Ga0436362_0921089 3300039453 Bacteria 652
263 Ga0436362_1146520 3300039453 Bacteria 1164
264 Ga0436362_1239599 3300039453 Bacteria 1057
265 Ga0451576_0270591 3300045051 Bacteria 1776
266 Ga0451576_0822812 3300045051 Bacteria 975
267 Ga0466967_0093384 3300045976 Bacteria 2738
268 Ga0495662_0117145 3300046476 Bacteria 1306
269 Ga0495594_0034439 3300046499 Bacteria 2755
270 Ga0495594_0161750 3300046499 Bacteria 1273
271 Ga0495633_0206044 3300046558 Bacteria 902
272 Ga0495624_0169612 3300046690 Bacteria 1331
273 Ga0496104_0332664 3300048907 Bacteria 1432
274 Ga0496104_0531787 3300048907 Bacteria 1087
275 Ga0496112_0033677 3300048915 Bacteria 4981
276 Ga0496112_1059322 3300048915 Bacteria 730
277 Ga0496113_0460239 3300048916 Bacteria 1022
278 Ga0496115_0045724 3300048918 Bacteria 3496
279 nmdc:mga06r32_20926_c1 3300050510 Bacteria 6031
280 nmdc:mga0rr50_938735_c1 3300050513 Bacteria 737
281 Ga0068856_100272670
282 Ga0070658_10156485
283 Ga0070683_100727326
284 Ga0070683_101353168
285 Ga0070666_10037454
286 Ga0070680_100267245
287 Ga0068868_100012362
288 Ga0068868_100882575
289 Ga0070660_100019824
290 Ga0070660_100069979
291 Ga0070660_101077685
292 Ga0070661_100134645
293 Ga0070671_100106934
294 Ga0070671_100187892
295 Ga0070673_100115829
296 Ga0070673_100405834
297 Ga0070688_100525229
298 Ga0070667_100031487
299 Ga0070667_100171017
300 Ga0070709_10470063
301 Ga0070714_100047986
302 Ga0070713_100390005
303 Ga0070678_100842027
304 Ga0070678_101045981
305 Ga0070681_10021924
306 Ga0070681_10237238
307 Ga0070681_10319933
308 Ga0070681_10364411
309 Ga0070679_100074718
310 Ga0070684_100014672
311 Ga0070684_101068562
312 Ga0070684_101182533
313 Ga0068853_100143156
314 Ga0068853_100260614
315 Ga0068853_101044556
316 Ga0070686_101078962
317 Ga0070693_100303964
318 Ga0070665_100047439
319 Ga0068855_100045016
320 Ga0068855_100087408
321 Ga0068855_100158803
322 Ga0068855_100456654
323 Ga0070664_100130865
324 Ga0068857_100189595
325 Ga0068854_101140958
326 Ga0068856_100028574
327 Ga0068856_100191587
328 Ga0068856_100361212
329 Ga0068856_100688223
330 Ga0068852_100066966
331 Ga0068852_100258503
332 Ga0068852_100311349
333 Ga0068859_100120542
334 Ga0068859_100226061
335 Ga0068864_100696926
336 Ga0068866_10154413
337 Ga0068866_10607579
338 Ga0068863_100024863
339 Ga0068863_100672164
340 Ga0068858_100041441
341 Ga0068858_100059594
342 Ga0068858_100522428
343 Ga0068860_100073073
344 Ga0070717_10864004
345 Ga0070717_10989561
346 Ga0070717_11240623
347 Ga0070716_100053080
348 Ga0070716_100090460
349 Ga0097621_100023137
350 Ga0097621_100259662
351 Ga0068871_100237410
352 Ga0068871_100922809
353 Ga0075433_10509141
354 Ga0097620_100120544
355 Ga0097620_100226074
356 Ga0099794_10300184
357 Ga0105240_10014172
358 Ga0105240_10165040
359 Ga0105240_10349908
360 Ga0105240_10392671
361 Ga0105240_10470955
362 Ga0105240_10637534
363 Ga0105245_10003461
364 Ga0114129_10370023
365 Ga0105243_10099178
366 Ga0105243_11078218
367 Ga0105241_10019699
368 Ga0105241_10041662
369 Ga0105241_10043028
370 Ga0105241_10177396
371 Ga0105241_10240633
372 Ga0105241_10813889
373 Ga0105242_10635545
374 Ga0105248_10009590
375 Ga0105248_10304113
376 Ga0105248_10368287
377 Ga0105248_10373215
378 Ga0105248_11117877
379 Ga0105237_10063073
380 Ga0105237_10310375
381 Ga0105237_10347242
382 Ga0105237_10905483
383 Ga0105238_10015210
384 Ga0105238_10026231
385 Ga0105238_10084579
386 Ga0105238_10131122
387 Ga0105238_10449683
388 Ga0105249_10447194
389 Ga0105239_10006983
390 Ga0105239_10023348
391 Ga0105239_10043548
392 Ga0105239_10179758
393 Ga0105239_10755902
394 Ga0105239_11203905
395 Ga0105246_10077950
396 Ga0105246_10740001
397 Ga0157371_10093752
398 Ga0157370_10003336
399 Ga0157370_10114770
400 Ga0157369_10002641
401 Ga0157369_10082182
402 Ga0157369_10138208
403 Ga0157369_10171579
404 Ga0157369_10554068
405 Ga0157374_10040341
406 Ga0157374_10079156
407 Ga0157374_10165708
408 Ga0157374_10216084
409 Ga0157374_10487876
410 Ga0157378_10193924
411 Ga0157378_10607731
412 Ga0163162_10004099
413 Ga0157372_10359877
414 Ga0157372_10661650
415 Ga0157372_10703479
416 Ga0157372_10838857
417 Ga0157372_12056684
418 Ga0157375_10556240
419 Ga0163163_10074224
420 Ga0163163_10097963
421 Ga0163163_10306154
422 Ga0163163_10992315
423 Ga0163163_11717269
424 Ga0157380_10937244
425 Ga0157379_10069965
426 Ga0157379_10520934
427 Ga0157376_10187483
428 Ga0157376_10244202
429 Ga0213873_10080369
430 Ga0213872_10000310
431 Ga0213874_10045795
432 Ga0213876_10000901
433 Ga0213876_10131523
434 Ga0213875_10000008
435 Ga0213875_10042845
436 Ga0207680_10473580
437 Ga0207699_10383175
438 Ga0207705_10282587
439 Ga0207654_10020582
440 Ga0207654_10034658
441 Ga0207707_10016802
442 Ga0207695_10019265
443 Ga0207695_10083807
444 Ga0207695_10086371
445 Ga0207695_10178457
446 Ga0207695_10408293
447 Ga0207695_10415535
448 Ga0207671_10087996
449 Ga0207671_10369832
450 Ga0207671_10707098
451 Ga0207671_11086027
452 Ga0207693_10749876
453 Ga0207660_10079405
454 Ga0207660_10264732
455 Ga0207657_10001958
456 Ga0207657_10149438
457 Ga0207657_10762837
458 Ga0207649_10106929
459 Ga0207652_10066613
460 Ga0207694_10012947
461 Ga0207694_10115277
462 Ga0207694_10167685
463 Ga0207687_10532135
464 Ga0207700_10666367
465 Ga0207664_10063534
466 Ga0207644_10153595
467 Ga0207644_10207757
468 Ga0207709_10178619
469 Ga0207670_10342920
470 Ga0207711_10349240
471 Ga0207711_11070001
472 Ga0207661_10289940
473 Ga0207661_10542470
474 Ga0207679_10171665
475 Ga0207679_10187922
476 Ga0207667_10025358
477 Ga0207667_10117680
478 Ga0207667_10436503
479 Ga0207651_10042246
480 Ga0207651_10395833
481 Ga0207640_10532080
482 Ga0207640_11231300
483 Ga0207658_10079008
484 Ga0207677_10014287
485 Ga0207703_10159280
486 Ga0207703_10494992
487 Ga0207703_10993149
488 Ga0207639_10113799
489 Ga0207639_10317838
490 Ga0207639_10457597
491 Ga0207639_10826226
492 Ga0207678_10138867
493 Ga0207702_10028619
494 Ga0207702_10053520
495 Ga0207702_10067653
496 Ga0207702_10553920
497 Ga0207641_10043202
498 Ga0207641_10442511
499 Ga0207648_10017257
500 Ga0207676_10014401
501 Ga0207674_10020034
502 Ga0207674_10217542
503 Ga0207683_10584900
504 Ga0207698_10041268
505 Ga0207698_10060933
506 Ga0268266_10090290
507 Ga0268266_10137201
508 Ga0268266_10173640
509 Ga0268264_10024593
510 Ga0265331_10047357
511 Ga0265316_10424939
512 Ga0265314_10002520
513 Ga0373928_0057394
514 Ga0373945_0320126
515 Ga0373927_0000695
516 Ga0373927_0001104
517 Ga0373947_0000323
518 Ga0373925_0000282
519 Ga0373925_0398683
520 Ga0373925_0702753
521 Ga0436364_0063756
522 Ga0436364_0160297
523 Ga0436364_0258928
524 Ga0436364_0292674
525 Ga0436364_0364416
526 Ga0436364_0385117
527 Ga0436364_0534005
528 Ga0436364_1167050
529 Ga0436364_1415525
530 Ga0436364_1423935
531 Ga0436365_0030499
532 Ga0436365_0697408
533 Ga0436365_1071890
534 Ga0436365_1310524
535 Ga0436365_1622668
536 Ga0436363_0186534
537 Ga0436363_0287500
538 Ga0436363_0761526
539 Ga0436363_1473951
540 Ga0436362_0244189
541 Ga0436362_0697991
542 Ga0436362_0921089
543 Ga0436362_1146520
544 Ga0436362_1239599
545 Ga0451576_0270591
546 Ga0451576_0822812
547 Ga0466967_0093384
548 Ga0495662_0117145
549 Ga0495594_0034439
550 Ga0495594_0161750
551 Ga0495633_0206044
552 Ga0495624_0169612
553 Ga0496104_0332664
554 Ga0496104_0531787
555 Ga0496112_0033677
556 Ga0496112_1059322
557 Ga0496113_0460239
558 Ga0496115_0045724
559 nmdc:mga06r32_20926_c1
560 nmdc:mga0rr50_938735_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

55

172

0.98

PF13905

Thioredoxin_8

Thioredoxin-like

78

169

0.98

PF08534

Redoxin

Redoxin

54

187

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kcm-assembly1.cif.gz_A the crystal structure of thioredoxin protein from geobacter metallireducens 0.9189 35 171
4txo-assembly2.cif.gz_A crystal structure of the mixed disulfide complex of thioredoxin-like tlpas(c110s) and copper chaperone scois(c74s) 0.9175 39 172
3gl3-assembly1.cif.gz_A crystal structure of a putative thiol:disulfide interchange protein dsbe from chlorobium tepidum 0.9093 34 172
3kcm-assembly1.cif.gz_A the crystal structure of thioredoxin protein from geobacter metallireducens 0.9003 35 171
3c73-assembly1.cif.gz_A structure of cehc variant resa 0.8983 38 172
ID Description Score Start End Superfamily
3gl3B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8927 34 172 3.40.30.10
3hdcA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.889 43 173 3.40.30.10
4txvC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8889 32 172 3.40.30.10
3kcmB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8878 35 173 3.40.30.10
af_Q8IFW4_1_119_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8828 59 172 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V7WXN5-F1-model_v4 Thioredoxin domain-containing protein 0.9503 36 172 GO:0016209
GO:0016491
AF-A0A2V7ABY9-F1-model_v4 Alkyl hydroperoxide reductase 0.9476 37 172 GO:0016209
GO:0016491
AF-A0A444J9A3-F1-model_v4 Peroxiredoxin 0.9369 34 172 GO:0016209
GO:0016491
AF-A0A7Y4TWY2-F1-model_v4 TlpA family protein disulfide reductase 0.9353 37 173 GO:0016491
GO:0017004
GO:0030313
AF-A0A832XCN2-F1-model_v4 TlpA family protein disulfide reductase 0.9326 38 173 GO:0004601
GO:0006979

Map