F383343

General Info

Members Datasets Scaffolds Average Seq Length
279 188 276 157

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_478836_c1|nmdc:mga00v17_478836_c1_135_668
Length 177
Sequence MRHCPFVLGTIQPGEGEMTVKAEAAPTSDRELVLTRVIDAPRAKLFKAWTDPGLLKQWFAPRPYTTPVAELDVRPGGANLVVMRDPQGNDHPNRGVYLEVVENERLVFTDAYTKAWEPSGKPFMTVILTFEDEGGKTRYTARVRHWTVADREAHEKMGFHGGWGLCTDQLAALVAKL

Samples

Sample ID Description Type Environment
1 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
2 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
3 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
106 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
107 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
128 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
184 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
185 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
186 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
187 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.54
Nodule 0
Rhizoplane 14.7
Rhizosphere 70.61
Stem 0
Stem Tuber 0
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000639 3300003215 Bacteria 21405
2 Ga0070658_10380313 3300005327 Bacteria 1211
3 Ga0070658_10511405 3300005327 Bacteria 1038
4 Ga0070676_10554605 3300005328 Bacteria 823
5 Ga0070670_100031315 3300005331 Bacteria 4580
6 Ga0070666_10240084 3300005335 Bacteria 1281
7 Ga0070680_100653315 3300005336 Bacteria 904
8 Ga0068868_101046069 3300005338 Bacteria 749
9 Ga0070687_100324825 3300005343 Bacteria 984
10 Ga0070668_100122605 3300005347 Bacteria 2079
11 Ga0070669_100470257 3300005353 Bacteria 1039
12 Ga0070674_100270965 3300005356 Bacteria 1342
13 Ga0070673_101219800 3300005364 Bacteria 705
14 Ga0070714_101006289 3300005435 Bacteria 811
15 Ga0070713_100248496 3300005436 Bacteria 1622
16 Ga0070713_100263580 3300005436 Bacteria 1575
17 Ga0070711_100105068 3300005439 Bacteria 2062
18 Ga0070708_100420506 3300005445 Bacteria 1260
19 Ga0070681_10062585 3300005458 Bacteria 3694
20 Ga0068867_100073057 3300005459 Bacteria 2568
21 Ga0070706_101955576 3300005467 Bacteria 531
22 Ga0070698_100006503 3300005471 Bacteria 12674
23 Ga0070699_100024906 3300005518 Bacteria 5159
24 Ga0070679_100166772 3300005530 Bacteria 2175
25 Ga0070679_101131198 3300005530 Bacteria 728
26 Ga0070684_100079797 3300005535 Bacteria 2894
27 Ga0070697_100043088 3300005536 Bacteria 3654
28 Ga0070672_100331265 3300005543 Bacteria 1295
29 Ga0070665_101182160 3300005548 Bacteria 776
30 Ga0068857_101471761 3300005577 Bacteria 663
31 Ga0068852_100271381 3300005616 Bacteria 1632
32 Ga0068870_10527649 3300005840 Bacteria 791
33 Ga0068862_100627826 3300005844 Bacteria 1034
34 Ga0081455_10001191 3300005937 Bacteria 32585
35 Ga0081455_10005174 3300005937 Bacteria 14360
36 Ga0081455_10143290 3300005937 Bacteria 1853
37 Ga0081540_1156162 3300005983 Bacteria 892
38 Ga0081539_10001888 3300005985 Bacteria 32580
39 Ga0070717_10024658 3300006028 Bacteria 4779
40 Ga0070717_10255257 3300006028 Bacteria 1550
41 Ga0070717_11348849 3300006028 Bacteria 648
42 Ga0075365_10010222 3300006038 Bacteria 5453
43 Ga0075365_10117509 3300006038 Bacteria 1832
44 Ga0075365_10247239 3300006038 Bacteria 1253
45 Ga0075365_10259105 3300006038 Bacteria 1223
46 Ga0075365_10332453 3300006038 Bacteria 1070
47 Ga0075365_10353758 3300006038 Bacteria 1035
48 Ga0075365_10501502 3300006038 Bacteria 858
49 Ga0075368_10241294 3300006042 Bacteria 771
50 Ga0075364_10526083 3300006051 Bacteria 808
51 Ga0075364_10849992 3300006051 Bacteria 622
52 Ga0070716_100512362 3300006173 Bacteria 887
53 Ga0070716_100965074 3300006173 Bacteria 672
54 Ga0070712_100466222 3300006175 Bacteria 1054
55 Ga0075362_10039492 3300006177 Bacteria 2075
56 Ga0075367_10012025 3300006178 Bacteria 4598
57 Ga0075369_10271230 3300006186 Bacteria 789
58 Ga0075428_100027289 3300006844 Bacteria 6320
59 Ga0075428_100046857 3300006844 Bacteria 4748
60 Ga0075428_101606264 3300006844 Bacteria 680
61 Ga0075431_100069966 3300006847 Bacteria 3620
62 Ga0075431_100070852 3300006847 Bacteria 3597
63 Ga0075434_100027279 3300006871 Bacteria 5606
64 Ga0075434_100351569 3300006871 Bacteria 1495
65 Ga0075434_100808200 3300006871 Bacteria 954
66 Ga0075434_102000880 3300006871 Bacteria 585
67 Ga0075436_100036628 3300006914 Bacteria 3386
68 Ga0075435_100006325 3300007076 Bacteria 8364
69 Ga0075435_100224267 3300007076 Bacteria 1596
70 Ga0099794_10100627 3300007265 Bacteria 1442
71 Ga0111539_10011801 3300009094 Bacteria 10954
72 Ga0111539_10045082 3300009094 Bacteria 5280
73 Ga0111539_10670373 3300009094 Bacteria 1208
74 Ga0105247_10183184 3300009101 Bacteria 1399
75 Ga0114129_10004610 3300009147 Bacteria 19457
76 Ga0114129_10592457 3300009147 Bacteria 1437
77 Ga0114129_10844041 3300009147 Bacteria 1165
78 Ga0105243_10802308 3300009148 Bacteria 928
79 Ga0105242_11922739 3300009176 Bacteria 632
80 Ga0105237_11081066 3300009545 Bacteria 809
81 Ga0105249_12052909 3300009553 Bacteria 644
82 Ga0105239_10628623 3300010375 Bacteria 1225
83 Ga0105246_10269375 3300011119 Bacteria 1361
84 Ga0105246_10603481 3300011119 Bacteria 949
85 Ga0157370_10021447 3300013104 Bacteria 6437
86 Ga0157378_11304122 3300013297 Bacteria 767
87 Ga0163162_10214696 3300013306 Bacteria 2054
88 Ga0163162_11621772 3300013306 Bacteria 738
89 Ga0163162_12099098 3300013306 Bacteria 648
90 Ga0157375_11202491 3300013308 Bacteria 889
91 Ga0163163_10016858 3300014325 Bacteria 6801
92 Ga0163163_10500557 3300014325 Bacteria 1277
93 Ga0163163_11064568 3300014325 Bacteria 872
94 Ga0157380_11530220 3300014326 Bacteria 721
95 Ga0157377_10418458 3300014745 Bacteria 917
96 Ga0157379_10198927 3300014968 Unclassified 1812
97 Ga0157376_10475701 3300014969 Bacteria 1223
98 Ga0213871_10201497 3300021441 Bacteria 621
99 Ga0209233_1028623 3300025261 Bacteria 1335
100 Ga0209758_1000088 3300025297 Bacteria 251547
101 Ga0207642_10353400 3300025899 Bacteria 868
102 Ga0207688_10089103 3300025901 Bacteria 1770
103 Ga0207645_10327100 3300025907 Bacteria 1023
104 Ga0207645_10601905 3300025907 Bacteria 746
105 Ga0207643_10684583 3300025908 Bacteria 662
106 Ga0207705_10225447 3300025909 Unclassified 1424
107 Ga0207684_10175893 3300025910 Bacteria 1845
108 Ga0207684_10573887 3300025910 Bacteria 964
109 Ga0207671_10649608 3300025914 Bacteria 840
110 Ga0207693_10133078 3300025915 Bacteria 1954
111 Ga0207693_10447408 3300025915 Bacteria 1009
112 Ga0207663_10103361 3300025916 Bacteria 1919
113 Ga0207652_10158484 3300025921 Bacteria 2028
114 Ga0207652_10656544 3300025921 Bacteria 938
115 Ga0207646_10635141 3300025922 Bacteria 957
116 Ga0207650_10075355 3300025925 Bacteria 2546
117 Ga0207700_10057367 3300025928 Bacteria 2936
118 Ga0207700_10362212 3300025928 Bacteria 1264
119 Ga0207669_10163606 3300025937 Bacteria 1575
120 Ga0207665_10320171 3300025939 Bacteria 1163
121 Ga0207691_11473548 3300025940 Bacteria 557
122 Ga0207651_10743248 3300025960 Bacteria 867
123 Ga0207668_10214366 3300025972 Bacteria 1542
124 Ga0207640_10302016 3300025981 Bacteria 1267
125 Ga0207658_11227167 3300025986 Bacteria 686
126 Ga0207678_10860281 3300026067 Bacteria 801
127 Ga0207708_10839042 3300026075 Bacteria 793
128 Ga0207698_10764739 3300026142 Bacteria 966
129 Ga0209813_10205781 3300027866 Bacteria 730
130 Ga0268266_10038586 3300028379 Bacteria 4066
131 Ga0268266_10446007 3300028379 Bacteria 1230
132 Ga0265338_10016112 3300028800 Bacteria 8155
133 Ga0265327_10003165 3300031251 Bacteria 16121
134 Ga0265327_10015928 3300031251 Bacteria 4813
135 Ga0265327_10021453 3300031251 Bacteria 3897
136 Ga0307509_10000044 3300031507 Bacteria 176718
137 Ga0307408_100652383 3300031548 Bacteria 941
138 Ga0265314_10033530 3300031711 Bacteria 3763
139 Ga0307416_100921232 3300032002 Bacteria 975
140 Ga0307510_10455331 3300033180 Bacteria 720
141 Ga0373959_0197552 3300034820 Bacteria 530
142 Ga0373952_0152056 3300035092 Bacteria 650
143 Ga0373945_0263366 3300035116 Bacteria 731
144 Ga0373953_0167559 3300035117 Bacteria 945
145 Ga0373954_0078502 3300035118 Bacteria 1575
146 Ga0373955_0024589 3300035172 Bacteria 3082
147 Ga0373924_0021577 3300035410 Bacteria 2512
148 Ga0373931_0433581 3300035691 Bacteria 838
149 Ga0373935_0039389 3300035692 Bacteria 2964
150 Ga0373935_0283027 3300035692 Bacteria 1168
151 Ga0373927_0020606 3300035695 Bacteria 4323
152 Ga0373947_0352717 3300035725 Bacteria 987
153 Ga0373937_0002711 3300036401 Bacteria 14779
154 Ga0373937_0362265 3300036401 Bacteria 1374
155 Ga0373937_0371479 3300036401 Bacteria 1356
156 Ga0373937_1226781 3300036401 Bacteria 698
157 Ga0373925_0010407 3300037068 Bacteria 6748
158 Ga0373925_0252374 3300037068 Bacteria 1415
159 Ga0436364_0087799 3300037853 Bacteria 760
160 Ga0436360_0055257 3300039438 Bacteria 916
161 Ga0436360_1060031 3300039438 Bacteria 3437
162 Ga0436363_0346351 3300039450 Bacteria 3602
163 Ga0436362_0327735 3300039453 Bacteria 1039
164 Ga0451577_0112272 3300042876 Bacteria 2439
165 Ga0495582_0272275 3300046473 Bacteria 972
166 Ga0495605_0377423 3300046474 Bacteria 592
167 Ga0495639_0270078 3300046475 Bacteria 844
168 Ga0495594_0652266 3300046499 Bacteria 596
169 Ga0495620_0138075 3300046515 Bacteria 954
170 Ga0495654_0009433 3300046530 Bacteria 5348
171 Ga0495640_0292016 3300046533 Bacteria 1014
172 Ga0495586_0114189 3300046535 Bacteria 1505
173 Ga0495668_0465267 3300046616 Bacteria 696
174 Ga0495599_0765820 3300046678 Bacteria 553
175 Ga0495647_0056953 3300046681 Bacteria 1533
176 Ga0495658_0014842 3300046683 Bacteria 3987
177 Ga0495613_0376759 3300046689 Bacteria 971
178 Ga0495589_0027381 3300046794 Bacteria 2882
179 Ga0495581_0246680 3300047315 Bacteria 1044
180 Ga0495674_0181205 3300047319 Bacteria 1754
181 Ga0495674_0220855 3300047319 Bacteria 1566
182 Ga0495680_0551804 3300047322 Bacteria 776
183 Ga0495602_0486624 3300048088 Bacteria 865
184 Ga0496101_0173382 3300048904 Bacteria 1658
185 Ga0496101_0324434 3300048904 Bacteria 1208
186 Ga0496101_0425604 3300048904 Bacteria 1047
187 Ga0496102_0012421 3300048905 Bacteria 7369
188 Ga0496102_0580663 3300048905 Bacteria 1044
189 Ga0496102_0933863 3300048905 Bacteria 789
190 Ga0496103_0024175 3300048906 Bacteria 3665
191 Ga0496104_0000455 3300048907 Bacteria 35340
192 Ga0496104_0003529 3300048907 Bacteria 13484
193 Ga0496104_0006892 3300048907 Bacteria 10020
194 Ga0496104_0193993 3300048907 Bacteria 1943
195 Ga0496104_1284161 3300048907 Bacteria 635
196 Ga0496105_0001898 3300048908 Bacteria 15002
197 Ga0496105_0006350 3300048908 Bacteria 9080
198 Ga0496105_0048578 3300048908 Bacteria 3503
199 Ga0496105_0630426 3300048908 Bacteria 829
200 Ga0496106_0052225 3300048909 Bacteria 3083
201 Ga0496106_0100275 3300048909 Bacteria 2245
202 Ga0496107_0252424 3300048910 Bacteria 1312
203 Ga0496107_0503565 3300048910 Bacteria 898
204 Ga0496108_0000313 3300048911 Bacteria 41243
205 Ga0496108_0164967 3300048911 Bacteria 1915
206 Ga0496108_0415947 3300048911 Bacteria 1174
207 Ga0496108_0549061 3300048911 Bacteria 1008
208 Ga0496109_0024365 3300048912 Bacteria 5379
209 Ga0496109_0057286 3300048912 Bacteria 3557
210 Ga0496110_0069298 3300048913 Bacteria 3123
211 Ga0496110_0225245 3300048913 Bacteria 1705
212 Ga0496110_0669487 3300048913 Bacteria 938
213 Ga0496111_0002228 3300048914 Bacteria 11629
214 Ga0496112_0001234 3300048915 Bacteria 19296
215 Ga0496112_0355107 3300048915 Bacteria 1408
216 Ga0496113_0000593 3300048916 Bacteria 18082
217 Ga0496113_0409360 3300048916 Unclassified 1089
218 Ga0496113_0618085 3300048916 Bacteria 867
219 Ga0496113_1044302 3300048916 Bacteria 642
220 Ga0496114_0145573 3300048917 Bacteria 2054
221 Ga0496114_0212043 3300048917 Bacteria 1699
222 Ga0496115_0133446 3300048918 Bacteria 2047
223 Ga0496115_0150101 3300048918 Bacteria 1924
224 Ga0496115_0265729 3300048918 Bacteria 1410
225 Ga0496126_0068119 3300048929 Bacteria 3179
226 Ga0501036_0234267 3300049572 Bacteria 1540
227 Ga0501038_0657517 3300049574 Bacteria 788
228 Ga0501040_1171881 3300049576 Bacteria 558
229 Ga0501042_0764480 3300049578 Bacteria 703
230 Ga0501043_0505134 3300049579 Bacteria 903
231 Ga0501046_0094503 3300049580 Bacteria 2298
232 Ga0501047_0013795 3300049581 Bacteria 7676
233 Ga0501070_1138873 3300049586 Bacteria 601
234 Ga0501074_0499133 3300049590 Bacteria 862
235 Ga0501079_0658064 3300049741 Bacteria 825
236 Ga0501080_0557912 3300049742 Bacteria 1020
237 Ga0501081_0141076 3300049743 Bacteria 1727
238 Ga0501035_0061484 3300049822 Bacteria 3342
239 Ga0501035_0584279 3300049822 Bacteria 912
240 Ga0501035_0732903 3300049822 Bacteria 795
241 Ga0501044_0013041 3300049823 Bacteria 8993
242 nmdc:mga03683_14914_c1 3300050489 Bacteria 2887
243 nmdc:mga00v17_215932_c1 3300050491 Bacteria 915
244 nmdc:mga00v17_218367_c1 3300050491 Bacteria 1234
245 nmdc:mga00v17_478836_c1 3300050491 Bacteria 807
246 nmdc:mga00v17_688888_c1 3300050491 Bacteria 656
247 nmdc:mga0yw44_150466_c1 3300050492 Bacteria 1518
248 nmdc:mga0yw44_47407_c1 3300050492 Bacteria 2586
249 nmdc:mga0yw44_474737_c1 3300050492 Bacteria 848
250 nmdc:mga0yw44_644351_c1 3300050492 Bacteria 720
251 nmdc:mga06z11_18819_c2 3300050494 Bacteria 1481
252 nmdc:mga06z11_235703_c1 3300050494 Bacteria 1073
253 nmdc:mga06z11_68334_c1 3300050494 Bacteria 1872
254 nmdc:mga05p37_4199_c1 3300050507 Bacteria 16834
255 nmdc:mga05p37_500203_c1 3300050507 Bacteria 1395
256 nmdc:mga05p37_662585_c1 3300050507 Bacteria 1166
257 nmdc:mga06r32_44523_c1 3300050510 Bacteria 4226
258 nmdc:mga06r32_60850_c1 3300050510 Bacteria 3634
259 nmdc:mga0n895_11539_c1 3300050512 Bacteria 7890
260 nmdc:mga0n895_266669_c1 3300050512 Bacteria 1737
261 nmdc:mga0n895_50798_c1 3300050512 Bacteria 4066
262 nmdc:mga0n895_655295_c1 3300050512 Bacteria 1048
263 nmdc:mga0rr50_201571_c1 3300050513 Bacteria 1635
264 nmdc:mga0rr50_31225_c1 3300050513 Bacteria 3781
265 nmdc:mga08x19_7784_c1 3300050514 Bacteria 6365
266 nmdc:mga0a205_54096_c1 3300050515 Bacteria 3875
267 Ga0495601_0434888 3300053077 Bacteria 849
268 Ga0495601_0750612 3300053077 Bacteria 621
269 Ga0500651_0370952 3300053093 Bacteria 809
270 Ga0500642_0094112 3300053130 Bacteria 1387
271 Ga0500652_238445 3300053131 Bacteria 725
272 Ga0500655_029289 3300053133 Bacteria 1056
273 Ga0500559_0251277 3300053136 Bacteria 833
274 Ga0500588_0395855 3300053146 Bacteria 526
275 Ga0501084_0095546 3300054114 Bacteria 2496
276 Ga0501084_0128185 3300054114 Bacteria 2136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034820 Ga0373959_0197552 Ga0373959_0197552_110_514 131
2 3300031251 Ga0265327_10015928 Ga0265327_100159283 142
3 3300013308 Ga0157375_11202491 Ga0157375_112024911 143
4 3300046530 Ga0495654_0009433 Ga0495654_0009433_2213_2650 143
5 3300048929 Ga0496126_0068119 Ga0496126_0068119_1009_1446 143
6 3300049586 Ga0501070_1138873 Ga0501070_1138873_19_456 143
7 3300025940 Ga0207691_11473548 Ga0207691_114735481 144
8 3300025928 Ga0207700_10362212 Ga0207700_103622123 145
9 3300025986 Ga0207658_11227167 Ga0207658_112271671 149
10 iso_pu_bacteria 2829745981 2829750116 149
11 iso_pu_bacteria 2861691609 2861694235 149
12 3300005327 Ga0070658_10511405 Ga0070658_105114052 150
13 3300005328 Ga0070676_10554605 Ga0070676_105546052 150
14 3300005353 Ga0070669_100470257 Ga0070669_1004702572 150
15 3300005435 Ga0070714_101006289 Ga0070714_1010062891 150
16 3300005436 Ga0070713_100263580 Ga0070713_1002635803 150
17 3300005439 Ga0070711_100105068 Ga0070711_1001050684 150
18 3300005445 Ga0070708_100420506 Ga0070708_1004205061 150
19 3300005467 Ga0070706_101955576 Ga0070706_1019555761 150
20 3300005471 Ga0070698_100006503 Ga0070698_1000065034 150
21 3300005518 Ga0070699_100024906 Ga0070699_1000249066 150
22 3300005536 Ga0070697_100043088 Ga0070697_1000430884 150
23 3300005548 Ga0070665_101182160 Ga0070665_1011821602 150
24 3300005937 Ga0081455_10001191 Ga0081455_1000119120 150
25 3300005985 Ga0081539_10001888 Ga0081539_1000188831 150
26 3300006028 Ga0070717_11348849 Ga0070717_113488491 150
27 3300006038 Ga0075365_10259105 Ga0075365_102591051 150
28 3300006038 Ga0075365_10332453 Ga0075365_103324531 150
29 3300006038 Ga0075365_10353758 Ga0075365_103537582 150
30 3300006042 Ga0075368_10241294 Ga0075368_102412941 150
31 3300006051 Ga0075364_10526083 Ga0075364_105260832 150
32 3300006051 Ga0075364_10849992 Ga0075364_108499921 150
33 3300006173 Ga0070716_100512362 Ga0070716_1005123622 150
34 3300006173 Ga0070716_100965074 Ga0070716_1009650741 150
35 3300006177 Ga0075362_10039492 Ga0075362_100394923 150
36 3300006186 Ga0075369_10271230 Ga0075369_102712302 150
37 3300006844 Ga0075428_101606264 Ga0075428_1016062642 150
38 3300006871 Ga0075434_102000880 Ga0075434_1020008801 150
39 3300007265 Ga0099794_10100627 Ga0099794_101006273 150
40 3300009101 Ga0105247_10183184 Ga0105247_101831842 150
41 3300009553 Ga0105249_12052909 Ga0105249_120529091 150
42 3300011119 Ga0105246_10603481 Ga0105246_106034811 150
43 3300014325 Ga0163163_11064568 Ga0163163_110645682 150
44 3300014969 Ga0157376_10475701 Ga0157376_104757012 150
45 3300025901 Ga0207688_10089103 Ga0207688_100891032 150
46 3300025907 Ga0207645_10601905 Ga0207645_106019051 150
47 3300025910 Ga0207684_10175893 Ga0207684_101758933 150
48 3300025910 Ga0207684_10573887 Ga0207684_105738871 150
49 3300025916 Ga0207663_10103361 Ga0207663_101033612 150
50 3300025922 Ga0207646_10635141 Ga0207646_106351412 150
51 3300025928 Ga0207700_10057367 Ga0207700_100573674 150
52 3300025939 Ga0207665_10320171 Ga0207665_103201712 150
53 3300027866 Ga0209813_10205781 Ga0209813_102057811 150
54 3300035117 Ga0373953_0167559 Ga0373953_0167559_301_765 150
55 3300035118 Ga0373954_0078502 Ga0373954_0078502_764_1228 150
56 3300035172 Ga0373955_0024589 Ga0373955_0024589_351_815 150
57 3300035410 Ga0373924_0021577 Ga0373924_0021577_80_544 150
58 3300035691 Ga0373931_0433581 Ga0373931_0433581_271_729 150
59 3300036401 Ga0373937_0002711 Ga0373937_0002711_11265_11729 150
60 3300036401 Ga0373937_0371479 Ga0373937_0371479_80_544 150
61 3300046533 Ga0495640_0292016 Ga0495640_0292016_277_735 150
62 3300047319 Ga0495674_0181205 Ga0495674_0181205_1052_1516 150
63 3300047322 Ga0495680_0551804 Ga0495680_0551804_155_619 150
64 3300048088 Ga0495602_0486624 Ga0495602_0486624_107_571 150
65 3300048904 Ga0496101_0425604 Ga0496101_0425604_444_911 150
66 3300048907 Ga0496104_0193993 Ga0496104_0193993_405_872 150
67 3300048908 Ga0496105_0630426 Ga0496105_0630426_37_504 150
68 3300048911 Ga0496108_0415947 Ga0496108_0415947_112_579 150
69 3300048912 Ga0496109_0057286 Ga0496109_0057286_2625_3092 150
70 3300048913 Ga0496110_0225245 Ga0496110_0225245_998_1465 150
71 3300048915 Ga0496112_0355107 Ga0496112_0355107_50_517 150
72 3300049572 Ga0501036_0234267 Ga0501036_0234267_980_1438 150
73 3300049574 Ga0501038_0657517 Ga0501038_0657517_320_778 150
74 3300049581 Ga0501047_0013795 Ga0501047_0013795_4849_5307 150
75 3300049822 Ga0501035_0061484 Ga0501035_0061484_622_1080 150
76 3300049823 Ga0501044_0013041 Ga0501044_0013041_561_1019 150
77 3300050489 nmdc:mga03683_14914_c1 nmdc:mga03683_14914_c1_1188_1646 150
78 3300050491 nmdc:mga00v17_218367_c1 nmdc:mga00v17_218367_c1_48_506 150
79 3300050491 nmdc:mga00v17_688888_c1 nmdc:mga00v17_688888_c1_107_565 150
80 3300050494 nmdc:mga06z11_235703_c1 nmdc:mga06z11_235703_c1_298_756 150
81 3300050494 nmdc:mga06z11_68334_c1 nmdc:mga06z11_68334_c1_340_798 150
82 3300050512 nmdc:mga0n895_11539_c1 nmdc:mga0n895_11539_c1_1532_1996 150
83 3300053077 Ga0495601_0434888 Ga0495601_0434888_205_669 150
84 iso_pu_bacteria 2897803580 2897806614 150
85 3300006028 Ga0070717_10255257 Ga0070717_102552571 151
86 3300025915 Ga0207693_10133078 Ga0207693_101330782 151
87 3300035692 Ga0373935_0283027 Ga0373935_0283027_375_836 151
88 3300046678 Ga0495599_0765820 Ga0495599_0765820_18_479 151
89 3300053093 Ga0500651_0370952 Ga0500651_0370952_178_639 151
90 3300053133 Ga0500655_029289 Ga0500655_029289_86_547 151
91 3300006847 Ga0075431_100069966 Ga0075431_1000699663 152
92 3300006871 Ga0075434_100351569 Ga0075434_1003515692 152
93 3300009545 Ga0105237_11081066 Ga0105237_110810661 152
94 3300025914 Ga0207671_10649608 Ga0207671_106496081 152
95 3300042876 Ga0451577_0112272 Ga0451577_0112272_818_1294 152
96 3300046535 Ga0495586_0114189 Ga0495586_0114189_1022_1486 152
97 3300050510 nmdc:mga06r32_60850_c1 nmdc:mga06r32_60850_c1_1532_2005 152
98 3300050512 nmdc:mga0n895_266669_c1 nmdc:mga0n895_266669_c1_300_782 152
99 3300053077 Ga0495601_0750612 Ga0495601_0750612_74_541 152
100 3300005327 Ga0070658_10380313 Ga0070658_103803132 153
101 3300028379 Ga0268266_10038586 Ga0268266_100385862 153
102 3300013297 Ga0157378_11304122 Ga0157378_113041222 154
103 3300031507 Ga0307509_10000044 Ga0307509_10000044121 154
104 3300032002 Ga0307416_100921232 Ga0307416_1009212321 154
105 3300033180 Ga0307510_10455331 Ga0307510_104553311 154
106 3300039450 Ga0436363_0346351 Ga0436363_0346351_1305_1775 154
107 3300039453 Ga0436362_0327735 Ga0436362_0327735_76_546 154
108 3300053131 Ga0500652_238445 Ga0500652_238445_230_700 154
109 3300053146 Ga0500588_0395855 Ga0500588_0395855_16_486 154
110 3300005616 Ga0068852_100271381 Ga0068852_1002713812 155
111 3300025921 Ga0207652_10656544 Ga0207652_106565442 155
112 3300026142 Ga0207698_10764739 Ga0207698_107647392 155
113 3300037853 Ga0436364_0087799 Ga0436364_0087799_232_705 155
114 3300039438 Ga0436360_1060031 Ga0436360_1060031_343_816 155
115 3300005336 Ga0070680_100653315 Ga0070680_1006533151 156
116 3300005458 Ga0070681_10062585 Ga0070681_100625856 156
117 3300005530 Ga0070679_100166772 Ga0070679_1001667722 156
118 3300006038 Ga0075365_10117509 Ga0075365_101175092 156
119 3300006175 Ga0070712_100466222 Ga0070712_1004662223 156
120 3300006871 Ga0075434_100808200 Ga0075434_1008082002 156
121 3300014325 Ga0163163_10500557 Ga0163163_105005572 156
122 3300021441 Ga0213871_10201497 Ga0213871_102014971 156
123 3300025899 Ga0207642_10353400 Ga0207642_103534002 156
124 3300025915 Ga0207693_10447408 Ga0207693_104474083 156
125 3300025921 Ga0207652_10158484 Ga0207652_101584842 156
126 3300025981 Ga0207640_10302016 Ga0207640_103020162 156
127 3300035092 Ga0373952_0152056 Ga0373952_0152056_157_633 156
128 3300039438 Ga0436360_0055257 Ga0436360_0055257_66_542 156
129 3300048905 Ga0496102_0580663 Ga0496102_0580663_314_790 156
130 3300048907 Ga0496104_0000455 Ga0496104_0000455_32714_33190 156
131 3300048907 Ga0496104_0006892 Ga0496104_0006892_2214_2690 156
132 3300048907 Ga0496104_1284161 Ga0496104_1284161_90_566 156
133 3300048908 Ga0496105_0006350 Ga0496105_0006350_971_1447 156
134 3300048908 Ga0496105_0048578 Ga0496105_0048578_906_1382 156
135 3300048910 Ga0496107_0503565 Ga0496107_0503565_234_710 156
136 3300048911 Ga0496108_0164967 Ga0496108_0164967_102_578 156
137 3300048911 Ga0496108_0549061 Ga0496108_0549061_440_916 156
138 3300048913 Ga0496110_0669487 Ga0496110_0669487_260_736 156
139 3300048916 Ga0496113_0409360 Ga0496113_0409360_106_582 156
140 3300048916 Ga0496113_0618085 Ga0496113_0618085_375_851 156
141 3300048916 Ga0496113_1044302 Ga0496113_1044302_147_623 156
142 3300048918 Ga0496115_0150101 Ga0496115_0150101_335_811 156
143 3300049579 Ga0501043_0505134 Ga0501043_0505134_308_784 156
144 3300050492 nmdc:mga0yw44_474737_c1 nmdc:mga0yw44_474737_c1_246_722 156
145 3300050512 nmdc:mga0n895_655295_c1 nmdc:mga0n895_655295_c1_343_819 156
146 3300006871 Ga0075434_100027279 Ga0075434_1000272794 157
147 3300007076 Ga0075435_100006325 Ga0075435_1000063252 157
148 3300009094 Ga0111539_10045082 Ga0111539_100450824 157
149 3300009147 Ga0114129_10844041 Ga0114129_108440411 157
150 3300025909 Ga0207705_10225447 Ga0207705_102254471 157
151 3300031548 Ga0307408_100652383 Ga0307408_1006523832 157
152 3300046515 Ga0495620_0138075 Ga0495620_0138075_420_902 157
153 3300046616 Ga0495668_0465267 Ga0495668_0465267_199_681 157
154 3300050507 nmdc:mga05p37_500203_c1 nmdc:mga05p37_500203_c1_341_820 157
155 3300050512 nmdc:mga0n895_50798_c1 nmdc:mga0n895_50798_c1_2913_3392 157
156 3300050513 nmdc:mga0rr50_31225_c1 nmdc:mga0rr50_31225_c1_1019_1498 157
157 3300050515 nmdc:mga0a205_54096_c1 nmdc:mga0a205_54096_c1_215_694 157
158 3300005331 Ga0070670_100031315 Ga0070670_1000313156 158
159 3300005335 Ga0070666_10240084 Ga0070666_102400842 158
160 3300005338 Ga0068868_101046069 Ga0068868_1010460691 158
161 3300005343 Ga0070687_100324825 Ga0070687_1003248251 158
162 3300005347 Ga0070668_100122605 Ga0070668_1001226053 158
163 3300005356 Ga0070674_100270965 Ga0070674_1002709652 158
164 3300005364 Ga0070673_101219800 Ga0070673_1012198001 158
165 3300005436 Ga0070713_100248496 Ga0070713_1002484962 158
166 3300005459 Ga0068867_100073057 Ga0068867_1000730571 158
167 3300005530 Ga0070679_101131198 Ga0070679_1011311982 158
168 3300005535 Ga0070684_100079797 Ga0070684_1000797972 158
169 3300005543 Ga0070672_100331265 Ga0070672_1003312652 158
170 3300005577 Ga0068857_101471761 Ga0068857_1014717611 158
171 3300005840 Ga0068870_10527649 Ga0068870_105276492 158
172 3300005844 Ga0068862_100627826 Ga0068862_1006278262 158
173 3300005937 Ga0081455_10005174 Ga0081455_1000517410 158
174 3300005937 Ga0081455_10143290 Ga0081455_101432902 158
175 3300005983 Ga0081540_1156162 Ga0081540_11561622 158
176 3300006028 Ga0070717_10024658 Ga0070717_100246584 158
177 3300006038 Ga0075365_10010222 Ga0075365_100102227 158
178 3300006038 Ga0075365_10247239 Ga0075365_102472392 158
179 3300006038 Ga0075365_10501502 Ga0075365_105015022 158
180 3300006178 Ga0075367_10012025 Ga0075367_100120253 158
181 3300006844 Ga0075428_100027289 Ga0075428_1000272894 158
182 3300006844 Ga0075428_100046857 Ga0075428_1000468574 158
183 3300006847 Ga0075431_100070852 Ga0075431_1000708523 158
184 3300006914 Ga0075436_100036628 Ga0075436_1000366284 158
185 3300007076 Ga0075435_100224267 Ga0075435_1002242673 158
186 3300009094 Ga0111539_10011801 Ga0111539_100118015 158
187 3300009094 Ga0111539_10670373 Ga0111539_106703731 158
188 3300009147 Ga0114129_10004610 Ga0114129_1000461016 158
189 3300009147 Ga0114129_10592457 Ga0114129_105924572 158
190 3300009148 Ga0105243_10802308 Ga0105243_108023082 158
191 3300009176 Ga0105242_11922739 Ga0105242_119227391 158
192 3300010375 Ga0105239_10628623 Ga0105239_106286232 158
193 3300011119 Ga0105246_10269375 Ga0105246_102693751 158
194 3300013306 Ga0163162_10214696 Ga0163162_102146962 158
195 3300013306 Ga0163162_11621772 Ga0163162_116217721 158
196 3300013306 Ga0163162_12099098 Ga0163162_120990981 158
197 3300014325 Ga0163163_10016858 Ga0163163_100168583 158
198 3300014326 Ga0157380_11530220 Ga0157380_115302201 158
199 3300014745 Ga0157377_10418458 Ga0157377_104184581 158
200 3300014968 Ga0157379_10198927 Ga0157379_101989272 158
201 3300025908 Ga0207643_10684583 Ga0207643_106845831 158
202 3300025925 Ga0207650_10075355 Ga0207650_100753553 158
203 3300025937 Ga0207669_10163606 Ga0207669_101636063 158
204 3300025960 Ga0207651_10743248 Ga0207651_107432481 158
205 3300025972 Ga0207668_10214366 Ga0207668_102143661 158
206 3300026067 Ga0207678_10860281 Ga0207678_108602812 158
207 3300026075 Ga0207708_10839042 Ga0207708_108390421 158
208 3300031251 Ga0265327_10003165 Ga0265327_1000316510 158
209 3300031251 Ga0265327_10021453 Ga0265327_100214532 158
210 3300031711 Ga0265314_10033530 Ga0265314_100335306 158
211 3300035116 Ga0373945_0263366 Ga0373945_0263366_235_717 158
212 3300035695 Ga0373927_0020606 Ga0373927_0020606_423_905 158
213 3300036401 Ga0373937_1226781 Ga0373937_1226781_139_621 158
214 3300037068 Ga0373925_0010407 Ga0373925_0010407_1604_2086 158
215 3300046474 Ga0495605_0377423 Ga0495605_0377423_13_498 158
216 3300046499 Ga0495594_0652266 Ga0495594_0652266_89_574 158
217 3300046681 Ga0495647_0056953 Ga0495647_0056953_800_1282 158
218 3300046683 Ga0495658_0014842 Ga0495658_0014842_1310_1792 158
219 3300046794 Ga0495589_0027381 Ga0495589_0027381_10_495 158
220 3300047315 Ga0495581_0246680 Ga0495581_0246680_80_562 158
221 3300048904 Ga0496101_0173382 Ga0496101_0173382_685_1170 158
222 3300048904 Ga0496101_0324434 Ga0496101_0324434_667_1152 158
223 3300048905 Ga0496102_0012421 Ga0496102_0012421_6284_6769 158
224 3300048905 Ga0496102_0933863 Ga0496102_0933863_271_756 158
225 3300048906 Ga0496103_0024175 Ga0496103_0024175_2822_3307 158
226 3300048907 Ga0496104_0003529 Ga0496104_0003529_6254_6739 158
227 3300048908 Ga0496105_0001898 Ga0496105_0001898_14036_14521 158
228 3300048909 Ga0496106_0052225 Ga0496106_0052225_230_715 158
229 3300048909 Ga0496106_0100275 Ga0496106_0100275_1266_1751 158
230 3300048910 Ga0496107_0252424 Ga0496107_0252424_166_651 158
231 3300048911 Ga0496108_0000313 Ga0496108_0000313_6164_6649 158
232 3300048912 Ga0496109_0024365 Ga0496109_0024365_4869_5354 158
233 3300048913 Ga0496110_0069298 Ga0496110_0069298_358_843 158
234 3300048914 Ga0496111_0002228 Ga0496111_0002228_2410_2895 158
235 3300048915 Ga0496112_0001234 Ga0496112_0001234_9826_10311 158
236 3300048916 Ga0496113_0000593 Ga0496113_0000593_12395_12880 158
237 3300048917 Ga0496114_0145573 Ga0496114_0145573_899_1384 158
238 3300048917 Ga0496114_0212043 Ga0496114_0212043_726_1211 158
239 3300048918 Ga0496115_0133446 Ga0496115_0133446_821_1306 158
240 3300049576 Ga0501040_1171881 Ga0501040_1171881_43_525 158
241 3300049578 Ga0501042_0764480 Ga0501042_0764480_89_571 158
242 3300049580 Ga0501046_0094503 Ga0501046_0094503_1060_1542 158
243 3300049590 Ga0501074_0499133 Ga0501074_0499133_198_680 158
244 3300049741 Ga0501079_0658064 Ga0501079_0658064_49_531 158
245 3300049742 Ga0501080_0557912 Ga0501080_0557912_287_769 158
246 3300049743 Ga0501081_0141076 Ga0501081_0141076_728_1210 158
247 3300049822 Ga0501035_0732903 Ga0501035_0732903_95_577 158
248 3300050491 nmdc:mga00v17_215932_c1 nmdc:mga00v17_215932_c1_207_692 158
249 3300050491 nmdc:mga00v17_478836_c1 nmdc:mga00v17_478836_c1_135_668 158
250 3300050492 nmdc:mga0yw44_150466_c1 nmdc:mga0yw44_150466_c1_613_1095 158
251 3300050492 nmdc:mga0yw44_47407_c1 nmdc:mga0yw44_47407_c1_1928_2413 158
252 3300050492 nmdc:mga0yw44_644351_c1 nmdc:mga0yw44_644351_c1_94_576 158
253 3300050494 nmdc:mga06z11_18819_c2 nmdc:mga06z11_18819_c2_500_985 158
254 3300050507 nmdc:mga05p37_4199_c1 nmdc:mga05p37_4199_c1_13528_14013 158
255 3300050507 nmdc:mga05p37_662585_c1 nmdc:mga05p37_662585_c1_460_942 158
256 3300050510 nmdc:mga06r32_44523_c1 nmdc:mga06r32_44523_c1_803_1285 158
257 3300050513 nmdc:mga0rr50_201571_c1 nmdc:mga0rr50_201571_c1_419_904 158
258 3300050514 nmdc:mga08x19_7784_c1 nmdc:mga08x19_7784_c1_4865_5350 158
259 3300053130 Ga0500642_0094112 Ga0500642_0094112_762_1247 158
260 3300053136 Ga0500559_0251277 Ga0500559_0251277_177_668 158
261 3300054114 Ga0501084_0095546 Ga0501084_0095546_656_1138 158
262 3300054114 Ga0501084_0128185 Ga0501084_0128185_1015_1497 158
263 3300025261 Ga0209233_1028623 Ga0209233_10286231 159
264 3300028379 Ga0268266_10446007 Ga0268266_104460071 159
265 3300028800 Ga0265338_10016112 Ga0265338_100161124 159
266 3300025907 Ga0207645_10327100 Ga0207645_103271002 160
267 3300048918 Ga0496115_0265729 Ga0496115_0265729_486_983 160
268 3300049822 Ga0501035_0584279 Ga0501035_0584279_317_814 160
269 3300003215 JGI25153J46596_10000639 JGI25153J46596_1000063918 161
270 3300013104 Ga0157370_10021447 Ga0157370_100214475 161
271 3300025297 Ga0209758_1000088 Ga0209758_1000088237 161
272 3300035692 Ga0373935_0039389 Ga0373935_0039389_659_1150 161
273 3300035725 Ga0373947_0352717 Ga0373947_0352717_96_587 161
274 3300036401 Ga0373937_0362265 Ga0373937_0362265_564_1076 161
275 3300037068 Ga0373925_0252374 Ga0373925_0252374_126_617 161
276 3300046473 Ga0495582_0272275 Ga0495582_0272275_299_790 161
277 3300046475 Ga0495639_0270078 Ga0495639_0270078_181_672 161
278 3300046689 Ga0495613_0376759 Ga0495613_0376759_331_822 161
279 3300047319 Ga0495674_0220855 Ga0495674_0220855_36_527 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

39

175

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xfs-assembly1.cif.gz_A x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.9766 17 160
1xfs-assembly1.cif.gz_B x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.9495 17 160
3pu2-assembly8.cif.gz_H crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.905 8 160
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9028 10 160
1xfs-assembly1.cif.gz_A x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.9022 17 160
ID Description Score Start End Superfamily
1xfsB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.948 17 160 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8908 10 161 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8842 10 160 3.30.530.20
1xfsB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8745 17 160 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.869 10 161 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A436M615-F1-model_v4 deleted 0.994 38 159
AF-A0A503I7G5-F1-model_v4 Polyketide cyclase 0.992 24 160
AF-A0A2R7RKA3-F1-model_v4 deleted 0.9919 16 160
AF-A0A6I2IYJ5-F1-model_v4 deleted 0.9901 25 107
AF-A0A0Q7TGI3-F1-model_v4 Polyketide cyclase 0.9896 16 160

Feature Viewer

pLDDT pTM Quality
91.91 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map