F383297

General Info

Members Datasets Scaffolds Average Seq Length
279 153 558 186

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_1004577|Ga0496112_1004577_13_699
Length 228
Sequence MTWGLGIRYLGLADHAVTPHTDRGCHKDVDARLSNAHALIRSIVALTVALVLLAPLGALAFKEGPYPNVTGGFGEQSCHLCHLDNPINAPGGAVTLDGVPATFAPGQTYPITVAVTREGLRRGGFEIAARFASGRQKGRQAGTWKPRDARVQLIPGAVDKVLTFVQHNLAGSRVPETGANRWTIDWTAPSAATSPVQFNVAANASNNDDSPLGDYIYLKSVKSLPQPK

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
113 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
114 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
120 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
126 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 2.51
Rhizosphere 96.42
Stem 0
Stem Tuber 0
Unclassified 32.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_1004577 3300048915 Unclassified 754
2 rootL2_10320493 3300003322 Unclassified 1252
3 Ga0070676_10052407 3300005328 Bacteria 2399
4 Ga0070690_100151496 3300005330 Unclassified 1583
5 Ga0070666_10011113 3300005335 Bacteria 5642
6 Ga0070666_10082710 3300005335 Unclassified 2196
7 Ga0068868_100070540 3300005338 Bacteria 2786
8 Ga0070689_100076691 3300005340 Unclassified 2619
9 Ga0070689_100208188 3300005340 Unclassified 1600
10 Ga0070687_100149930 3300005343 Unclassified 1368
11 Ga0070687_100175624 3300005343 Unclassified 1279
12 Ga0070668_100561241 3300005347 Unclassified 995
13 Ga0070669_100018301 3300005353 Bacteria 5007
14 Ga0070669_100036087 3300005353 Bacteria 3581
15 Ga0070675_100327300 3300005354 Unclassified 1354
16 Ga0070674_100050339 3300005356 Unclassified 2868
17 Ga0070674_100380217 3300005356 Bacteria 1149
18 Ga0070673_100392002 3300005364 Unclassified 1240
19 Ga0070659_100152158 3300005366 Bacteria 1888
20 Ga0070709_10152958 3300005434 Unclassified 1596
21 Ga0070705_100027147 3300005440 Bacteria 3123
22 Ga0070700_100027888 3300005441 Bacteria 3353
23 Ga0070700_100162971 3300005441 Unclassified 1537
24 Ga0070694_100002220 3300005444 Bacteria 11486
25 Ga0070694_100341302 3300005444 Unclassified 1158
26 Ga0070694_100408077 3300005444 Bacteria 1065
27 Ga0070708_100053705 3300005445 Bacteria 3576
28 Ga0070708_100845582 3300005445 Bacteria 860
29 Ga0070662_100155962 3300005457 Bacteria 1782
30 Ga0070662_100526484 3300005457 Bacteria 988
31 Ga0070681_10799641 3300005458 Bacteria 860
32 Ga0068867_100147350 3300005459 Unclassified 1846
33 Ga0068867_101004357 3300005459 Unclassified 757
34 Ga0070706_100997836 3300005467 Bacteria 772
35 Ga0070707_100174765 3300005468 Bacteria 2093
36 Ga0070707_100211949 3300005468 Bacteria 1888
37 Ga0070698_100093074 3300005471 Bacteria 2994
38 Ga0070698_100782216 3300005471 Bacteria 898
39 Ga0070679_100226231 3300005530 Bacteria 1831
40 Ga0070697_100670694 3300005536 Unclassified 914
41 Ga0070686_100001161 3300005544 Bacteria 15057
42 Ga0070686_101144614 3300005544 Unclassified 644
43 Ga0070695_100008449 3300005545 Bacteria 6108
44 Ga0070695_100030149 3300005545 Bacteria 3375
45 Ga0070695_100645970 3300005545 Bacteria 835
46 Ga0070695_100713459 3300005545 Bacteria 797
47 Ga0070696_100037687 3300005546 Bacteria 3335
48 Ga0070696_100040423 3300005546 Unclassified 3220
49 Ga0070693_100108698 3300005547 Unclassified 1702
50 Ga0070665_100005091 3300005548 Bacteria 13635
51 Ga0070665_100151321 3300005548 Unclassified 2323
52 Ga0068855_100136878 3300005563 Bacteria 2793
53 Ga0068854_100020430 3300005578 Bacteria 4480
54 Ga0068854_100068679 3300005578 Bacteria 2585
55 Ga0068852_100579404 3300005616 Unclassified 1125
56 Ga0068859_100295054 3300005617 Bacteria 1714
57 Ga0068859_100972506 3300005617 Bacteria 932
58 Ga0068864_100004407 3300005618 Bacteria 11565
59 Ga0068866_10191656 3300005718 Unclassified 1215
60 Ga0068861_100002889 3300005719 Bacteria 11319
61 Ga0068861_100043551 3300005719 Bacteria 3370
62 Ga0068861_100152851 3300005719 Unclassified 1895
63 Ga0068861_100315303 3300005719 Bacteria 1360
64 Ga0068861_100447573 3300005719 Unclassified 1157
65 Ga0068863_100011663 3300005841 Bacteria 8502
66 Ga0068863_100413855 3300005841 Unclassified 1320
67 Ga0068863_100668153 3300005841 Bacteria 1031
68 Ga0068858_100004715 3300005842 Bacteria 13353
69 Ga0068858_100049330 3300005842 Bacteria 3898
70 Ga0068858_100365286 3300005842 Unclassified 1384
71 Ga0068862_100034024 3300005844 Bacteria 4309
72 Ga0068862_100090870 3300005844 Bacteria 2658
73 Ga0068862_100438771 3300005844 Bacteria 1229
74 Ga0075367_10345143 3300006178 Unclassified 939
75 Ga0097621_100065685 3300006237 Unclassified 2987
76 Ga0097621_100099530 3300006237 Unclassified 2444
77 Ga0068871_100014957 3300006358 Bacteria 5802
78 Ga0068871_100071513 3300006358 Unclassified 2853
79 Ga0075428_100079422 3300006844 Bacteria 3581
80 Ga0075433_10295749 3300006852 Unclassified 1434
81 Ga0075433_10431047 3300006852 Unclassified 1162
82 Ga0075434_100001809 3300006871 Bacteria 18491
83 Ga0075434_100705861 3300006871 Unclassified 1026
84 Ga0068865_100019925 3300006881 Bacteria 4346
85 Ga0068865_100291012 3300006881 Bacteria 1304
86 Ga0068865_100390219 3300006881 Bacteria 1138
87 Ga0075436_100118177 3300006914 Bacteria 1853
88 Ga0075436_100219971 3300006914 Unclassified 1347
89 Ga0075436_100534637 3300006914 Bacteria 860
90 Ga0075436_100675880 3300006914 Unclassified 764
91 Ga0097620_100295062 3300006931 Bacteria 1714
92 Ga0097620_100972556 3300006931 Bacteria 932
93 Ga0075435_100003111 3300007076 Bacteria 11213
94 Ga0075435_100003819 3300007076 Bacteria 10277
95 Ga0075435_100015774 3300007076 Bacteria 5685
96 Ga0075435_100103535 3300007076 Bacteria 2361
97 Ga0075435_100226570 3300007076 Unclassified 1588
98 Ga0099794_10142589 3300007265 Bacteria 1214
99 Ga0105240_10360553 3300009093 Unclassified 1647
100 Ga0111539_10011957 3300009094 Bacteria 10883
101 Ga0111539_10050331 3300009094 Bacteria 4962
102 Ga0111539_10136403 3300009094 Bacteria 2874
103 Ga0111539_10562954 3300009094 Bacteria 1327
104 Ga0105245_10021789 3300009098 Bacteria 5624
105 Ga0105245_10216751 3300009098 Bacteria 1845
106 Ga0105245_11177614 3300009098 Unclassified 814
107 Ga0105247_10224981 3300009101 Unclassified 1272
108 Ga0114129_10000192 3300009147 Bacteria 68551
109 Ga0114129_10036233 3300009147 Bacteria 6967
110 Ga0114129_10077362 3300009147 Bacteria 4628
111 Ga0114129_10130767 3300009147 Bacteria 3448
112 Ga0114129_10225843 3300009147 Bacteria 2524
113 Ga0114129_10253215 3300009147 Unclassified 2363
114 Ga0105243_10234816 3300009148 Unclassified 1629
115 Ga0105243_10639232 3300009148 Unclassified 1030
116 Ga0105241_10034011 3300009174 Unclassified 3828
117 Ga0105241_10149097 3300009174 Unclassified 1912
118 Ga0105242_10039895 3300009176 Bacteria 3781
119 Ga0105242_10043272 3300009176 Bacteria 3643
120 Ga0105248_10173686 3300009177 Bacteria 2429
121 Ga0105248_10268162 3300009177 Unclassified 1922
122 Ga0105248_10447167 3300009177 Bacteria 1456
123 Ga0105248_10913365 3300009177 Unclassified 991
124 Ga0105249_10111496 3300009553 Unclassified 2587
125 Ga0105249_10333162 3300009553 Bacteria 1532
126 Ga0105239_10932397 3300010375 Unclassified 997
127 Ga0105246_11367227 3300011119 Unclassified 659
128 Ga0157374_10003571 3300013296 Bacteria 13092
129 Ga0157378_10400615 3300013297 Bacteria 1352
130 Ga0157378_11095405 3300013297 Unclassified 833
131 Ga0157380_10463219 3300014326 Unclassified 1221
132 Ga0157380_10987781 3300014326 Bacteria 874
133 Ga0157377_10017626 3300014745 Bacteria 3696
134 Ga0157379_10181257 3300014968 Bacteria 1903
135 Ga0157379_10297575 3300014968 Unclassified 1470
136 Ga0157379_11154725 3300014968 Bacteria 743
137 Ga0157376_10016234 3300014969 Bacteria 5646
138 Ga0157376_10070256 3300014969 Bacteria 2971
139 Ga0157376_10257261 3300014969 Unclassified 1634
140 Ga0163161_10189459 3300017792 Bacteria 1580
141 Ga0207697_10170069 3300025315 Unclassified 953
142 Ga0207710_10295390 3300025900 Unclassified 818
143 Ga0207680_10016520 3300025903 Bacteria 3877
144 Ga0207680_10148960 3300025903 Unclassified 1558
145 Ga0207645_10013046 3300025907 Bacteria 5614
146 Ga0207684_10663916 3300025910 Bacteria 888
147 Ga0207654_10414087 3300025911 Bacteria 939
148 Ga0207707_10157465 3300025912 Bacteria 1986
149 Ga0207707_10678020 3300025912 Bacteria 867
150 Ga0207695_10073142 3300025913 Bacteria 3494
151 Ga0207695_10333131 3300025913 Unclassified 1406
152 Ga0207671_10367536 3300025914 Bacteria 1142
153 Ga0207662_10110250 3300025918 Unclassified 1715
154 Ga0207662_10485002 3300025918 Unclassified 849
155 Ga0207657_10001951 3300025919 Bacteria 22271
156 Ga0207652_10115170 3300025921 Bacteria 2388
157 Ga0207646_10785115 3300025922 Bacteria 849
158 Ga0207646_10859579 3300025922 Bacteria 806
159 Ga0207681_10066083 3300025923 Bacteria 2502
160 Ga0207681_10769592 3300025923 Unclassified 803
161 Ga0207659_10000541 3300025926 Bacteria 22593
162 Ga0207659_10138949 3300025926 Unclassified 1884
163 Ga0207687_10090457 3300025927 Unclassified 2230
164 Ga0207687_10275631 3300025927 Unclassified 1346
165 Ga0207644_10280525 3300025931 Bacteria 1338
166 Ga0207686_10035000 3300025934 Bacteria 3011
167 Ga0207686_10044240 3300025934 Unclassified 2733
168 Ga0207709_10062233 3300025935 Bacteria 2335
169 Ga0207670_10070948 3300025936 Bacteria 2408
170 Ga0207670_10274752 3300025936 Bacteria 1311
171 Ga0207669_10157782 3300025937 Bacteria 1598
172 Ga0207704_10003091 3300025938 Bacteria 7523
173 Ga0207704_10435128 3300025938 Bacteria 1043
174 Ga0207711_10025942 3300025941 Bacteria 4915
175 Ga0207711_10240388 3300025941 Unclassified 1660
176 Ga0207679_10066381 3300025945 Bacteria 2703
177 Ga0207667_10024647 3300025949 Bacteria 6601
178 Ga0207667_10345701 3300025949 Unclassified 1517
179 Ga0207651_10372610 3300025960 Unclassified 1208
180 Ga0207640_10006620 3300025981 Bacteria 6367
181 Ga0207677_10424686 3300026023 Bacteria 1133
182 Ga0207677_10810913 3300026023 Unclassified 838
183 Ga0207703_10035720 3300026035 Bacteria 3950
184 Ga0207703_10238697 3300026035 Bacteria 1633
185 Ga0207703_10349054 3300026035 Bacteria 1362
186 Ga0207708_10147125 3300026075 Bacteria 1852
187 Ga0207641_10008848 3300026088 Bacteria 8314
188 Ga0207641_10459877 3300026088 Unclassified 1231
189 Ga0207648_10116184 3300026089 Bacteria 2351
190 Ga0207675_100008422 3300026118 Bacteria 9721
191 Ga0207675_100284920 3300026118 Unclassified 1606
192 Ga0207675_100373937 3300026118 Bacteria 1400
193 Ga0207675_100431431 3300026118 Bacteria 1303
194 Ga0207675_100594093 3300026118 Bacteria 1109
195 Ga0207675_100724991 3300026118 Unclassified 1004
196 Ga0207675_101100489 3300026118 Unclassified 814
197 Ga0207698_10290529 3300026142 Unclassified 1517
198 Ga0207428_10132257 3300027907 Bacteria 1908
199 Ga0268266_10017114 3300028379 Bacteria 6191
200 Ga0268266_10148303 3300028379 Unclassified 2111
201 Ga0268265_10003692 3300028380 Bacteria 10922
202 Ga0268265_10030116 3300028380 Bacteria 3904
203 Ga0268265_10171860 3300028380 Bacteria 1853
204 Ga0268265_10278795 3300028380 Bacteria 1495
205 Ga0268264_10822766 3300028381 Bacteria 929
206 Ga0307408_100045543 3300031548 Bacteria 3134
207 Ga0373930_0013669 3300034816 Bacteria 1500
208 Ga0373938_0001957 3300034957 Bacteria 3300
209 Ga0373928_0003346 3300035084 Bacteria 3058
210 Ga0373929_0000161 3300035085 Bacteria 11652
211 Ga0373940_0001327 3300035088 Bacteria 4409
212 Ga0373949_0001358 3300035090 Bacteria 7048
213 Ga0373951_0000272 3300035091 Bacteria 16526
214 Ga0373952_0001004 3300035092 Bacteria 5155
215 Ga0373939_0002128 3300035114 Bacteria 4714
216 Ga0373941_0013526 3300035115 Bacteria 2159
217 Ga0373960_0008837 3300035121 Bacteria 2426
218 Ga0373955_0159950 3300035172 Bacteria 1329
219 Ga0373955_0266126 3300035172 Bacteria 1030
220 Ga0373942_0000021 3300035207 Bacteria 30804
221 Ga0373961_0004620 3300035241 Bacteria 3323
222 Ga0373962_0081795 3300035242 Bacteria 982
223 Ga0373931_0001288 3300035691 Bacteria 10722
224 Ga0373937_0049715 3300036401 Bacteria 3839
225 Ga0373925_0385136 3300037068 Unclassified 1142
226 Ga0451576_0244602 3300045051 Bacteria 1874
227 Ga0495603_0041763 3300046455 Bacteria 2742
228 Ga0495653_0549988 3300046463 Bacteria 714
229 Ga0495628_0397074 3300046516 Bacteria 1008
230 Ga0495640_0253421 3300046533 Bacteria 1102
231 Ga0495645_0009303 3300046543 Bacteria 6872
232 Ga0495635_0293000 3300046663 Bacteria 1092
233 Ga0495674_0317993 3300047319 Bacteria 1269
234 Ga0495684_0113395 3300047471 Bacteria 2044
235 Ga0496101_0331381 3300048904 Bacteria 1195
236 Ga0496102_0342575 3300048905 Unclassified 1408
237 Ga0496104_0519236 3300048907 Unclassified 1102
238 Ga0496106_0545809 3300048909 Unclassified 930
239 Ga0496112_0421812 3300048915 Bacteria 1273
240 Ga0496112_0700374 3300048915 Bacteria 941
241 nmdc:mga06z11_311304_c1 3300050494 Unclassified 938
242 nmdc:mga05p37_168078_c1 3300050507 Bacteria 2676
243 nmdc:mga05p37_223715_c1 3300050507 Bacteria 2270
244 nmdc:mga05p37_65466_c1 3300050507 Bacteria 4471
245 nmdc:mga05p37_73123_c1 3300050507 Bacteria 4219
246 nmdc:mga05p37_8693_c1 3300050507 Bacteria 11999
247 nmdc:mga06r32_203889_c1 3300050510 Unclassified 1965
248 nmdc:mga08y16_1176110_c1 3300050511 Bacteria 739
249 nmdc:mga08y16_250299_c1 3300050511 Unclassified 1831
250 nmdc:mga08y16_55197_c1 3300050511 Bacteria 4152
251 nmdc:mga08y16_79729_c1 3300050511 Bacteria 3413
252 nmdc:mga08y16_83637_c1 3300050511 Bacteria 3326
253 nmdc:mga0n895_18128_c1 3300050512 Bacteria 6508
254 nmdc:mga0n895_399_c1 3300050512 Bacteria 29189
255 nmdc:mga0n895_46179_c1 3300050512 Bacteria 4253
256 nmdc:mga0n895_511651_c1 3300050512 Unclassified 1209
257 nmdc:mga0n895_89901_c1 3300050512 Unclassified 3072
258 nmdc:mga0rr50_146931_c1 3300050513 Bacteria 1902
259 nmdc:mga0rr50_216891_c1 3300050513 Bacteria 1579
260 nmdc:mga0rr50_217013_c1 3300050513 Bacteria 1578
261 nmdc:mga0rr50_299474_c1 3300050513 Unclassified 1345
262 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
263 nmdc:mga0rr50_492001_c1 3300050513 Unclassified 1042
264 nmdc:mga08x19_16633_c1 3300050514 Bacteria 4489
265 nmdc:mga08x19_228027_c1 3300050514 Unclassified 941
266 nmdc:mga08x19_228617_c1 3300050514 Bacteria 1280
267 nmdc:mga08x19_31887_c1 3300050514 Bacteria 3319
268 nmdc:mga08x19_37284_c1 3300050514 Bacteria 3085
269 nmdc:mga08x19_726810_c1 3300050514 Bacteria 705
270 nmdc:mga0a205_105134_c1 3300050515 Bacteria 2722
271 nmdc:mga0a205_117555_c1 3300050515 Unclassified 2557
272 nmdc:mga0a205_147449_c1 3300050515 Bacteria 2253
273 nmdc:mga0a205_247881_c1 3300050515 Bacteria 1661
274 nmdc:mga0a205_84160_c1 3300050515 Unclassified 3072
275 nmdc:mga0a205_955850_c1 3300050515 Bacteria 703
276 Ga0495601_0430002 3300053077 Bacteria 855
277 Ga0495595_0064485 3300053084 Bacteria 1722
278 Ga0495619_0026934 3300053085 Bacteria 3702
279 Ga0495619_0129871 3300053085 Bacteria 1731
280 Ga0496112_1004577
281 rootL2_10320493
282 Ga0070676_10052407
283 Ga0070690_100151496
284 Ga0070666_10011113
285 Ga0070666_10082710
286 Ga0068868_100070540
287 Ga0070689_100076691
288 Ga0070689_100208188
289 Ga0070687_100149930
290 Ga0070687_100175624
291 Ga0070668_100561241
292 Ga0070669_100018301
293 Ga0070669_100036087
294 Ga0070675_100327300
295 Ga0070674_100050339
296 Ga0070674_100380217
297 Ga0070673_100392002
298 Ga0070659_100152158
299 Ga0070709_10152958
300 Ga0070705_100027147
301 Ga0070700_100027888
302 Ga0070700_100162971
303 Ga0070694_100002220
304 Ga0070694_100341302
305 Ga0070694_100408077
306 Ga0070708_100053705
307 Ga0070708_100845582
308 Ga0070662_100155962
309 Ga0070662_100526484
310 Ga0070681_10799641
311 Ga0068867_100147350
312 Ga0068867_101004357
313 Ga0070706_100997836
314 Ga0070707_100174765
315 Ga0070707_100211949
316 Ga0070698_100093074
317 Ga0070698_100782216
318 Ga0070679_100226231
319 Ga0070697_100670694
320 Ga0070686_100001161
321 Ga0070686_101144614
322 Ga0070695_100008449
323 Ga0070695_100030149
324 Ga0070695_100645970
325 Ga0070695_100713459
326 Ga0070696_100037687
327 Ga0070696_100040423
328 Ga0070693_100108698
329 Ga0070665_100005091
330 Ga0070665_100151321
331 Ga0068855_100136878
332 Ga0068854_100020430
333 Ga0068854_100068679
334 Ga0068852_100579404
335 Ga0068859_100295054
336 Ga0068859_100972506
337 Ga0068864_100004407
338 Ga0068866_10191656
339 Ga0068861_100002889
340 Ga0068861_100043551
341 Ga0068861_100152851
342 Ga0068861_100315303
343 Ga0068861_100447573
344 Ga0068863_100011663
345 Ga0068863_100413855
346 Ga0068863_100668153
347 Ga0068858_100004715
348 Ga0068858_100049330
349 Ga0068858_100365286
350 Ga0068862_100034024
351 Ga0068862_100090870
352 Ga0068862_100438771
353 Ga0075367_10345143
354 Ga0097621_100065685
355 Ga0097621_100099530
356 Ga0068871_100014957
357 Ga0068871_100071513
358 Ga0075428_100079422
359 Ga0075433_10295749
360 Ga0075433_10431047
361 Ga0075434_100001809
362 Ga0075434_100705861
363 Ga0068865_100019925
364 Ga0068865_100291012
365 Ga0068865_100390219
366 Ga0075436_100118177
367 Ga0075436_100219971
368 Ga0075436_100534637
369 Ga0075436_100675880
370 Ga0097620_100295062
371 Ga0097620_100972556
372 Ga0075435_100003111
373 Ga0075435_100003819
374 Ga0075435_100015774
375 Ga0075435_100103535
376 Ga0075435_100226570
377 Ga0099794_10142589
378 Ga0105240_10360553
379 Ga0111539_10011957
380 Ga0111539_10050331
381 Ga0111539_10136403
382 Ga0111539_10562954
383 Ga0105245_10021789
384 Ga0105245_10216751
385 Ga0105245_11177614
386 Ga0105247_10224981
387 Ga0114129_10000192
388 Ga0114129_10036233
389 Ga0114129_10077362
390 Ga0114129_10130767
391 Ga0114129_10225843
392 Ga0114129_10253215
393 Ga0105243_10234816
394 Ga0105243_10639232
395 Ga0105241_10034011
396 Ga0105241_10149097
397 Ga0105242_10039895
398 Ga0105242_10043272
399 Ga0105248_10173686
400 Ga0105248_10268162
401 Ga0105248_10447167
402 Ga0105248_10913365
403 Ga0105249_10111496
404 Ga0105249_10333162
405 Ga0105239_10932397
406 Ga0105246_11367227
407 Ga0157374_10003571
408 Ga0157378_10400615
409 Ga0157378_11095405
410 Ga0157380_10463219
411 Ga0157380_10987781
412 Ga0157377_10017626
413 Ga0157379_10181257
414 Ga0157379_10297575
415 Ga0157379_11154725
416 Ga0157376_10016234
417 Ga0157376_10070256
418 Ga0157376_10257261
419 Ga0163161_10189459
420 Ga0207697_10170069
421 Ga0207710_10295390
422 Ga0207680_10016520
423 Ga0207680_10148960
424 Ga0207645_10013046
425 Ga0207684_10663916
426 Ga0207654_10414087
427 Ga0207707_10157465
428 Ga0207707_10678020
429 Ga0207695_10073142
430 Ga0207695_10333131
431 Ga0207671_10367536
432 Ga0207662_10110250
433 Ga0207662_10485002
434 Ga0207657_10001951
435 Ga0207652_10115170
436 Ga0207646_10785115
437 Ga0207646_10859579
438 Ga0207681_10066083
439 Ga0207681_10769592
440 Ga0207659_10000541
441 Ga0207659_10138949
442 Ga0207687_10090457
443 Ga0207687_10275631
444 Ga0207644_10280525
445 Ga0207686_10035000
446 Ga0207686_10044240
447 Ga0207709_10062233
448 Ga0207670_10070948
449 Ga0207670_10274752
450 Ga0207669_10157782
451 Ga0207704_10003091
452 Ga0207704_10435128
453 Ga0207711_10025942
454 Ga0207711_10240388
455 Ga0207679_10066381
456 Ga0207667_10024647
457 Ga0207667_10345701
458 Ga0207651_10372610
459 Ga0207640_10006620
460 Ga0207677_10424686
461 Ga0207677_10810913
462 Ga0207703_10035720
463 Ga0207703_10238697
464 Ga0207703_10349054
465 Ga0207708_10147125
466 Ga0207641_10008848
467 Ga0207641_10459877
468 Ga0207648_10116184
469 Ga0207675_100008422
470 Ga0207675_100284920
471 Ga0207675_100373937
472 Ga0207675_100431431
473 Ga0207675_100594093
474 Ga0207675_100724991
475 Ga0207675_101100489
476 Ga0207698_10290529
477 Ga0207428_10132257
478 Ga0268266_10017114
479 Ga0268266_10148303
480 Ga0268265_10003692
481 Ga0268265_10030116
482 Ga0268265_10171860
483 Ga0268265_10278795
484 Ga0268264_10822766
485 Ga0307408_100045543
486 Ga0373930_0013669
487 Ga0373938_0001957
488 Ga0373928_0003346
489 Ga0373929_0000161
490 Ga0373940_0001327
491 Ga0373949_0001358
492 Ga0373951_0000272
493 Ga0373952_0001004
494 Ga0373939_0002128
495 Ga0373941_0013526
496 Ga0373960_0008837
497 Ga0373955_0159950
498 Ga0373955_0266126
499 Ga0373942_0000021
500 Ga0373961_0004620
501 Ga0373962_0081795
502 Ga0373931_0001288
503 Ga0373937_0049715
504 Ga0373925_0385136
505 Ga0451576_0244602
506 Ga0495603_0041763
507 Ga0495653_0549988
508 Ga0495628_0397074
509 Ga0495640_0253421
510 Ga0495645_0009303
511 Ga0495635_0293000
512 Ga0495674_0317993
513 Ga0495684_0113395
514 Ga0496101_0331381
515 Ga0496102_0342575
516 Ga0496104_0519236
517 Ga0496106_0545809
518 Ga0496112_0421812
519 Ga0496112_0700374
520 nmdc:mga06z11_311304_c1
521 nmdc:mga05p37_168078_c1
522 nmdc:mga05p37_223715_c1
523 nmdc:mga05p37_65466_c1
524 nmdc:mga05p37_73123_c1
525 nmdc:mga05p37_8693_c1
526 nmdc:mga06r32_203889_c1
527 nmdc:mga08y16_1176110_c1
528 nmdc:mga08y16_250299_c1
529 nmdc:mga08y16_55197_c1
530 nmdc:mga08y16_79729_c1
531 nmdc:mga08y16_83637_c1
532 nmdc:mga0n895_18128_c1
533 nmdc:mga0n895_399_c1
534 nmdc:mga0n895_46179_c1
535 nmdc:mga0n895_511651_c1
536 nmdc:mga0n895_89901_c1
537 nmdc:mga0rr50_146931_c1
538 nmdc:mga0rr50_216891_c1
539 nmdc:mga0rr50_217013_c1
540 nmdc:mga0rr50_299474_c1
541 nmdc:mga0rr50_2_c1
542 nmdc:mga0rr50_492001_c1
543 nmdc:mga08x19_16633_c1
544 nmdc:mga08x19_228027_c1
545 nmdc:mga08x19_228617_c1
546 nmdc:mga08x19_31887_c1
547 nmdc:mga08x19_37284_c1
548 nmdc:mga08x19_726810_c1
549 nmdc:mga0a205_105134_c1
550 nmdc:mga0a205_117555_c1
551 nmdc:mga0a205_147449_c1
552 nmdc:mga0a205_247881_c1
553 nmdc:mga0a205_84160_c1
554 nmdc:mga0a205_955850_c1
555 Ga0495601_0430002
556 Ga0495595_0064485
557 Ga0495619_0026934
558 Ga0495619_0129871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jpn-assembly1.cif.gz_B structure of human complement c4 rebuilt using imdff 0.6752 36 174
2zou-assembly2.cif.gz_B crystal structure of human f-spondin reeler domain (fragment 2) 0.6659 36 171
2zot-assembly1.cif.gz_A crystal structure of human f-spondin reeler domain (fragment 1) 0.6608 24 171
7v0q-assembly1.cif.gz_X local refinement of protein 4.2, class 1 of erythrocyte ankyrin-1 complex 0.6582 36 174
2zot-assembly1.cif.gz_A crystal structure of human f-spondin reeler domain (fragment 1) 0.6485 24 171
ID Description Score Start End Superfamily
af_A8WHS3_35_164_2.60.40.4060 Mainly Beta;Sandwich;Immunoglobulin-like;Reeler domain 0.7287 29 162 2.60.40.4060
af_U4PBJ9_255_348_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7053 34 148 2.60.40.10
af_Q63041_453_562_2.60.40.1930 Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain 0.699 37 171 2.60.40.1930
af_Q8MSU3_34_173_2.60.40.4060 Mainly Beta;Sandwich;Immunoglobulin-like;Reeler domain 0.6933 28 163 2.60.40.4060
af_Q9VLU2_537_652_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6891 37 173 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A800FB23-F1-model_v4 Reelin domain-containing protein 0.9434 37 172
AF-A0A2V7GZ89-F1-model_v4 Reelin domain-containing protein 0.9364 33 173
AF-A0A2V7GZ89-F1-model_v4 Reelin domain-containing protein 0.9236 33 173
AF-A0A4P5TUC3-F1-model_v4 T9SS type A sorting domain-containing protein 0.9043 30 170
AF-A0A7X7PJ95-F1-model_v4 Reelin domain-containing protein 0.9019 19 169

Map