F382885

General Info

Members Datasets Scaffolds Average Seq Length
279 179 558 328

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100203029|Ga0070713_1002030292
Length 345
Sequence MKPVLGTQYSVASYTLEGSLFMLRKLYLQCLILSVGLAAPAQESRHFTFHYGFTVKNLPAGKRVRIWIPAAQSDAYQDVKVFSALGDLPLKHTHESRYGNEMYFAETRHLVGSELHFDIEYEVTRRERVALRPSPQLSTVALTRRERHDDLQPDALVPITGLPAELAVKVTQGRAQPLDKARAIYDYVFTTLRYDKTGTGWGRGDVRYACDAKKGNCTDFHSLFIAMARSQGIPARFEIGFPLPTDKHSGEIAGYHCWSDFYIDGKGWVPVDVSEAWKHPEKRDYFFGSHDVNRVQFSMGRDLRLSPPQDGKLLNYFVYPYVEVDGKDYPNVSLEFAFQDVGPVM

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
71 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
72 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
73 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.49
Metatranscriptomes 2.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.09
Rhizosphere 93.91
Stem 0
Stem Tuber 0
Unclassified 20.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100203029 3300005436 Unclassified 1791
2 Ga0070683_100186874 3300005329 Unclassified 1967
3 Ga0070690_100032211 3300005330 Bacteria 3272
4 Ga0068869_100034119 3300005334 Unclassified 3598
5 Ga0070680_100010017 3300005336 Bacteria 7302
6 Ga0070660_100013662 3300005339 Bacteria 5835
7 Ga0070689_100405612 3300005340 Bacteria 1153
8 Ga0070661_100024341 3300005344 Bacteria 4343
9 Ga0070668_100020678 3300005347 Bacteria 4969
10 Ga0070674_100132840 3300005356 Unclassified 1858
11 Ga0070667_100033965 3300005367 Bacteria 4266
12 Ga0070709_10059865 3300005434 Bacteria 2419
13 Ga0070714_100000060 3300005435 Bacteria 100913
14 Ga0070714_100049580 3300005435 Bacteria 3574
15 Ga0070714_100456542 3300005435 Unclassified 1214
16 Ga0070713_100014443 3300005436 Bacteria 5866
17 Ga0070713_100090024 3300005436 Bacteria 2637
18 Ga0070713_100165924 3300005436 Bacteria 1975
19 Ga0070710_10006940 3300005437 Bacteria 5462
20 Ga0070711_100000231 3300005439 Bacteria 29031
21 Ga0070711_100007008 3300005439 Bacteria 6839
22 Ga0070711_100023564 3300005439 Bacteria 4006
23 Ga0070708_100016411 3300005445 Bacteria 6144
24 Ga0070708_100024442 3300005445 Bacteria 5156
25 Ga0070708_100061902 3300005445 Bacteria 3345
26 Ga0070708_100095273 3300005445 Bacteria 2717
27 Ga0070708_100284906 3300005445 Bacteria 1555
28 Ga0070662_100001140 3300005457 Bacteria 16274
29 Ga0070681_10066734 3300005458 Bacteria 3567
30 Ga0068867_100002521 3300005459 Bacteria 12881
31 Ga0070706_100001310 3300005467 Bacteria 26450
32 Ga0070706_100068756 3300005467 Bacteria 3275
33 Ga0070706_100097260 3300005467 Bacteria 2734
34 Ga0070707_100003053 3300005468 Bacteria 15870
35 Ga0070707_100074260 3300005468 Unclassified 3279
36 Ga0070698_100010712 3300005471 Bacteria 9765
37 Ga0070698_100023404 3300005471 Bacteria 6457
38 Ga0070699_100011779 3300005518 Bacteria 7547
39 Ga0070699_100029873 3300005518 Bacteria 4701
40 Ga0070679_100261890 3300005530 Bacteria 1684
41 Ga0070684_100123393 3300005535 Unclassified 2331
42 Ga0070697_100000108 3300005536 Bacteria 64148
43 Ga0070697_100000336 3300005536 Bacteria 37001
44 Ga0068853_100014375 3300005539 Bacteria 6481
45 Ga0070672_100114545 3300005543 Bacteria 2201
46 Ga0070686_100058369 3300005544 Bacteria 2483
47 Ga0070665_100016599 3300005548 Bacteria 7381
48 Ga0068857_100061420 3300005577 Bacteria 3338
49 Ga0068854_100020547 3300005578 Bacteria 4470
50 Ga0068856_100584152 3300005614 Bacteria 1138
51 Ga0068852_100030846 3300005616 Bacteria 4418
52 Ga0068859_100040390 3300005617 Bacteria 4683
53 Ga0068864_100094645 3300005618 Unclassified 2640
54 Ga0068851_10076967 3300005834 Bacteria 1736
55 Ga0068858_100030044 3300005842 Bacteria 5045
56 Ga0068860_100128137 3300005843 Unclassified 2433
57 Ga0070717_10001814 3300006028 Bacteria 14923
58 Ga0070717_10003194 3300006028 Bacteria 11706
59 Ga0070717_10008520 3300006028 Bacteria 7659
60 Ga0070717_10027506 3300006028 Bacteria 4546
61 Ga0070717_10054868 3300006028 Bacteria 3287
62 Ga0070715_10013704 3300006163 Bacteria 2984
63 Ga0070716_100010952 3300006173 Bacteria 4563
64 Ga0070716_100117496 3300006173 Unclassified 1659
65 Ga0070712_100000057 3300006175 Bacteria 56727
66 Ga0070712_100024140 3300006175 Bacteria 4025
67 Ga0070712_100158631 3300006175 Bacteria 1745
68 Ga0070712_100190489 3300006175 Unclassified 1605
69 Ga0070712_100255564 3300006175 Unclassified 1402
70 Ga0097621_100005252 3300006237 Bacteria 9114
71 Ga0097621_100038344 3300006237 Bacteria 3845
72 Ga0068871_100027499 3300006358 Bacteria 4450
73 Ga0068871_100031717 3300006358 Bacteria 4169
74 Ga0068871_100176961 3300006358 Bacteria 1832
75 Ga0075434_100021868 3300006871 Bacteria 6225
76 Ga0075436_100001616 3300006914 Bacteria 15424
77 Ga0075436_100022991 3300006914 Bacteria 4283
78 Ga0097620_100040385 3300006931 Bacteria 4683
79 Ga0105240_10028317 3300009093 Bacteria 7320
80 Ga0105240_10216868 3300009093 Bacteria 2232
81 Ga0105240_10572781 3300009093 Unclassified 1246
82 Ga0105245_10133917 3300009098 Bacteria 2327
83 Ga0105245_10162157 3300009098 Unclassified 2122
84 Ga0105245_10380254 3300009098 Bacteria 1406
85 Ga0105247_10084652 3300009101 Bacteria 2004
86 Ga0105243_10022056 3300009148 Bacteria 4838
87 Ga0105241_10031195 3300009174 Unclassified 3990
88 Ga0105242_10028821 3300009176 Bacteria 4422
89 Ga0105248_10006235 3300009177 Bacteria 13073
90 Ga0105248_10379032 3300009177 Bacteria 1593
91 Ga0105237_10234849 3300009545 Bacteria 1835
92 Ga0105237_10290896 3300009545 Bacteria 1636
93 Ga0105237_10386763 3300009545 Unclassified 1404
94 Ga0105238_10004823 3300009551 Bacteria 13343
95 Ga0105249_10002573 3300009553 Bacteria 15693
96 Ga0157373_10073455 3300013100 Unclassified 2413
97 Ga0157369_10011811 3300013105 Bacteria 9919
98 Ga0157369_10050104 3300013105 Bacteria 4524
99 Ga0157369_10205243 3300013105 Bacteria 2067
100 Ga0157374_10078017 3300013296 Bacteria 3136
101 Ga0157374_10108830 3300013296 Bacteria 2664
102 Ga0157374_10214661 3300013296 Bacteria 1887
103 Ga0157374_10373278 3300013296 Bacteria 1420
104 Ga0157378_10071529 3300013297 Bacteria 3115
105 Ga0157378_10090821 3300013297 Bacteria 2776
106 Ga0157378_10186386 3300013297 Unclassified 1955
107 Ga0163162_10024585 3300013306 Bacteria 5948
108 Ga0163162_10127136 3300013306 Unclassified 2656
109 Ga0157372_10000416 3300013307 Bacteria 46749
110 Ga0157372_10015070 3300013307 Bacteria 8275
111 Ga0157372_10038984 3300013307 Bacteria 5244
112 Ga0157372_10161994 3300013307 Bacteria 2585
113 Ga0157372_10749323 3300013307 Unclassified 1136
114 Ga0157375_10053310 3300013308 Bacteria 3979
115 Ga0163163_10071962 3300014325 Bacteria 3446
116 Ga0157379_10001621 3300014968 Bacteria 18558
117 Ga0157379_10041765 3300014968 Bacteria 4093
118 Ga0157376_10139255 3300014969 Bacteria 2175
119 Ga0182005_1027995 3300015265 Unclassified 1537
120 Ga0224569_100079 3300022732 Bacteria 6430
121 Ga0224571_101364 3300022734 Bacteria 1523
122 Ga0224572_1000721 3300024225 Bacteria 4268
123 Ga0224572_1018626 3300024225 Unclassified 1334
124 Ga0228598_1006765 3300024227 Unclassified 2362
125 Ga0228598_1010318 3300024227 Bacteria 1861
126 Ga0207692_10027501 3300025898 Bacteria 2680
127 Ga0207692_10207066 3300025898 Unclassified 1156
128 Ga0207710_10114308 3300025900 Unclassified 1284
129 Ga0207680_10041575 3300025903 Unclassified 2683
130 Ga0207699_10037195 3300025906 Bacteria 2781
131 Ga0207699_10269116 3300025906 Bacteria 1180
132 Ga0207645_10028347 3300025907 Bacteria 3615
133 Ga0207684_10000607 3300025910 Bacteria 42607
134 Ga0207684_10000621 3300025910 Bacteria 42216
135 Ga0207684_10035393 3300025910 Bacteria 4240
136 Ga0207684_10075375 3300025910 Bacteria 2867
137 Ga0207654_10013901 3300025911 Bacteria 4149
138 Ga0207707_10024077 3300025912 Bacteria 5324
139 Ga0207695_10012559 3300025913 Bacteria 10151
140 Ga0207695_10060907 3300025913 Bacteria 3904
141 Ga0207671_10053701 3300025914 Unclassified 2986
142 Ga0207693_10000850 3300025915 Bacteria 27261
143 Ga0207693_10033563 3300025915 Bacteria 4050
144 Ga0207663_10000480 3300025916 Bacteria 17362
145 Ga0207663_10024972 3300025916 Bacteria 3448
146 Ga0207657_10004889 3300025919 Bacteria 14096
147 Ga0207649_10010662 3300025920 Bacteria 5054
148 Ga0207652_10378730 3300025921 Unclassified 1277
149 Ga0207646_10003520 3300025922 Bacteria 17641
150 Ga0207646_10034525 3300025922 Unclassified 4571
151 Ga0207646_10553325 3300025922 Unclassified 1034
152 Ga0207694_10036509 3300025924 Bacteria 3772
153 Ga0207687_10090269 3300025927 Bacteria 2232
154 Ga0207700_10000467 3300025928 Bacteria 23733
155 Ga0207700_10057503 3300025928 Unclassified 2933
156 Ga0207700_10070352 3300025928 Bacteria 2689
157 Ga0207700_10076918 3300025928 Bacteria 2591
158 Ga0207700_10197748 3300025928 Unclassified 1693
159 Ga0207664_10000017 3300025929 Bacteria 230967
160 Ga0207664_10029014 3300025929 Bacteria 4212
161 Ga0207664_10221679 3300025929 Unclassified 1640
162 Ga0207664_10336582 3300025929 Unclassified 1334
163 Ga0207690_10265986 3300025932 Unclassified 1330
164 Ga0207706_10000532 3300025933 Bacteria 40449
165 Ga0207686_10032631 3300025934 Unclassified 3101
166 Ga0207669_10287128 3300025937 Bacteria 1244
167 Ga0207665_10012820 3300025939 Bacteria 5512
168 Ga0207665_10031184 3300025939 Bacteria 3527
169 Ga0207691_10119371 3300025940 Bacteria 2338
170 Ga0207711_10008364 3300025941 Bacteria 8658
171 Ga0207689_10043140 3300025942 Bacteria 3728
172 Ga0207689_10443039 3300025942 Bacteria 1085
173 Ga0207679_10072310 3300025945 Unclassified 2604
174 Ga0207667_10005965 3300025949 Bacteria 14832
175 Ga0207668_10032869 3300025972 Unclassified 3433
176 Ga0207640_10035967 3300025981 Bacteria 3104
177 Ga0207658_10033012 3300025986 Bacteria 3689
178 Ga0207677_10004912 3300026023 Bacteria 7219
179 Ga0207677_10153896 3300026023 Bacteria 1778
180 Ga0207703_10155806 3300026035 Bacteria 1996
181 Ga0207639_10018994 3300026041 Bacteria 4894
182 Ga0207678_10002529 3300026067 Bacteria 16668
183 Ga0207702_10089500 3300026078 Unclassified 2692
184 Ga0207702_10399845 3300026078 Bacteria 1325
185 Ga0207648_10006426 3300026089 Bacteria 11681
186 Ga0207648_10308804 3300026089 Bacteria 1419
187 Ga0207676_10059481 3300026095 Unclassified 3018
188 Ga0207674_10200514 3300026116 Bacteria 1945
189 Ga0207675_100020789 3300026118 Bacteria 6119
190 Ga0207698_10010353 3300026142 Bacteria 5984
191 Ga0268266_10119173 3300028379 Bacteria 2347
192 Ga0268264_10146607 3300028381 Bacteria 2111
193 Ga0265338_10029405 3300028800 Bacteria 5448
194 Ga0265338_10061987 3300028800 Bacteria 3273
195 Ga0265762_1000097 3300030760 Bacteria 12380
196 Ga0265762_1000380 3300030760 Bacteria 7597
197 Ga0265765_1003240 3300030879 Bacteria 1623
198 Ga0265760_10000112 3300031090 Bacteria 20679
199 Ga0265760_10000813 3300031090 Bacteria 8994
200 Ga0265760_10001941 3300031090 Bacteria 6068
201 Ga0265760_10008435 3300031090 Bacteria 2947
202 Ga0265325_10007786 3300031241 Bacteria 6381
203 Ga0265339_10036997 3300031249 Bacteria 2729
204 Ga0265316_10002195 3300031344 Bacteria 20507
205 Ga0265314_10001900 3300031711 Bacteria 22356
206 Ga0265314_10131589 3300031711 Unclassified 1560
207 Ga0373950_0025761 3300034818 Unclassified 1064
208 Ga0373926_0003464 3300035083 Bacteria 5094
209 Ga0373923_0010883 3300035111 Bacteria 3323
210 Ga0373939_0047689 3300035114 Unclassified 1317
211 Ga0373945_0029128 3300035116 Bacteria 1938
212 Ga0373953_0015081 3300035117 Bacteria 2792
213 Ga0373954_0011634 3300035118 Bacteria 3903
214 Ga0373960_0041705 3300035121 Unclassified 1330
215 Ga0373943_0002055 3300035170 Bacteria 9132
216 Ga0373946_0042269 3300035171 Bacteria 1873
217 Ga0373955_0021273 3300035172 Bacteria 3272
218 Ga0373962_0011402 3300035242 Bacteria 2229
219 Ga0373935_0006094 3300035692 Bacteria 7168
220 Ga0373935_0026098 3300035692 Unclassified 3603
221 Ga0373927_0000085 3300035695 Bacteria 70359
222 Ga0373927_0106606 3300035695 Unclassified 1825
223 Ga0373933_0070195 3300035724 Bacteria 2130
224 Ga0373933_0090958 3300035724 Unclassified 1883
225 Ga0373933_0166763 3300035724 Unclassified 1400
226 Ga0373947_0003047 3300035725 Bacteria 9968
227 Ga0373947_0038042 3300035725 Bacteria 2856
228 Ga0373947_0041201 3300035725 Bacteria 2753
229 Ga0373947_0111372 3300035725 Bacteria 1730
230 Ga0373937_0060676 3300036401 Bacteria 3475
231 Ga0373925_0074384 3300037068 Unclassified 2573
232 Ga0373925_0077790 3300037068 Bacteria 2518
233 Ga0451576_0442133 3300045051 Bacteria 1365
234 Ga0451576_0507284 3300045051 Bacteria 1267
235 Ga0466967_0212125 3300045976 Unclassified 1837
236 Ga0495629_0012343 3300046459 Bacteria 6185
237 Ga0495580_0000655 3300046472 Bacteria 29380
238 Ga0495580_0003361 3300046472 Bacteria 13673
239 Ga0495580_0194227 3300046472 Bacteria 1399
240 Ga0495582_0048294 3300046473 Bacteria 2344
241 Ga0495664_0008691 3300046477 Bacteria 5669
242 Ga0495664_0104539 3300046477 Unclassified 1707
243 Ga0495665_0028868 3300046531 Unclassified 2972
244 Ga0495645_0035850 3300046543 Bacteria 3617
245 Ga0495599_0159995 3300046678 Unclassified 1392
246 Ga0495623_0051711 3300046679 Bacteria 2598
247 Ga0495658_0070196 3300046683 Bacteria 2032
248 Ga0495669_0142962 3300046684 Bacteria 1130
249 Ga0495674_0002028 3300047319 Bacteria 19892
250 Ga0495674_0015346 3300047319 Bacteria 7166
251 Ga0495602_0041527 3300048088 Bacteria 4200
252 Ga0496100_0366704 3300048903 Bacteria 1091
253 Ga0496101_0231914 3300048904 Bacteria 1435
254 Ga0496102_0002175 3300048905 Bacteria 16841
255 Ga0496102_0136364 3300048905 Bacteria 2300
256 Ga0496102_0180040 3300048905 Bacteria 1991
257 Ga0496103_0004438 3300048906 Bacteria 8510
258 Ga0496105_0068723 3300048908 Bacteria 2927
259 Ga0496105_0152802 3300048908 Bacteria 1897
260 Ga0496105_0195667 3300048908 Bacteria 1652
261 Ga0496106_0013763 3300048909 Bacteria 5976
262 Ga0496107_0140466 3300048910 Bacteria 1785
263 Ga0496108_0249281 3300048911 Bacteria 1545
264 Ga0496111_0238638 3300048914 Unclassified 1350
265 Ga0496112_0255985 3300048915 Unclassified 1701
266 Ga0496114_0016216 3300048917 Bacteria 5999
267 Ga0496115_0006988 3300048918 Bacteria 8291
268 Ga0496115_0053572 3300048918 Bacteria 3238
269 Ga0501033_0067330 3300049570 Bacteria 2633
270 Ga0501034_0000258 3300049571 Bacteria 95869
271 Ga0501037_0116422 3300049573 Bacteria 1923
272 Ga0501038_0000185 3300049574 Bacteria 53588
273 Ga0501080_0085181 3300049742 Bacteria 2937
274 Ga0501044_0052446 3300049823 Bacteria 4203
275 nmdc:mga08x19_3589_c1 3300050514 Bacteria 9229
276 nmdc:mga08x19_3944_c1 3300050514 Bacteria 8837
277 nmdc:mga08x19_39919_c1 3300050514 Bacteria 2985
278 Ga0495601_0122300 3300053077 Unclassified 1691
279 Ga0495619_0092227 3300053085 Bacteria 2052
280 Ga0070713_100203029
281 Ga0070683_100186874
282 Ga0070690_100032211
283 Ga0068869_100034119
284 Ga0070680_100010017
285 Ga0070660_100013662
286 Ga0070689_100405612
287 Ga0070661_100024341
288 Ga0070668_100020678
289 Ga0070674_100132840
290 Ga0070667_100033965
291 Ga0070709_10059865
292 Ga0070714_100000060
293 Ga0070714_100049580
294 Ga0070714_100456542
295 Ga0070713_100014443
296 Ga0070713_100090024
297 Ga0070713_100165924
298 Ga0070710_10006940
299 Ga0070711_100000231
300 Ga0070711_100007008
301 Ga0070711_100023564
302 Ga0070708_100016411
303 Ga0070708_100024442
304 Ga0070708_100061902
305 Ga0070708_100095273
306 Ga0070708_100284906
307 Ga0070662_100001140
308 Ga0070681_10066734
309 Ga0068867_100002521
310 Ga0070706_100001310
311 Ga0070706_100068756
312 Ga0070706_100097260
313 Ga0070707_100003053
314 Ga0070707_100074260
315 Ga0070698_100010712
316 Ga0070698_100023404
317 Ga0070699_100011779
318 Ga0070699_100029873
319 Ga0070679_100261890
320 Ga0070684_100123393
321 Ga0070697_100000108
322 Ga0070697_100000336
323 Ga0068853_100014375
324 Ga0070672_100114545
325 Ga0070686_100058369
326 Ga0070665_100016599
327 Ga0068857_100061420
328 Ga0068854_100020547
329 Ga0068856_100584152
330 Ga0068852_100030846
331 Ga0068859_100040390
332 Ga0068864_100094645
333 Ga0068851_10076967
334 Ga0068858_100030044
335 Ga0068860_100128137
336 Ga0070717_10001814
337 Ga0070717_10003194
338 Ga0070717_10008520
339 Ga0070717_10027506
340 Ga0070717_10054868
341 Ga0070715_10013704
342 Ga0070716_100010952
343 Ga0070716_100117496
344 Ga0070712_100000057
345 Ga0070712_100024140
346 Ga0070712_100158631
347 Ga0070712_100190489
348 Ga0070712_100255564
349 Ga0097621_100005252
350 Ga0097621_100038344
351 Ga0068871_100027499
352 Ga0068871_100031717
353 Ga0068871_100176961
354 Ga0075434_100021868
355 Ga0075436_100001616
356 Ga0075436_100022991
357 Ga0097620_100040385
358 Ga0105240_10028317
359 Ga0105240_10216868
360 Ga0105240_10572781
361 Ga0105245_10133917
362 Ga0105245_10162157
363 Ga0105245_10380254
364 Ga0105247_10084652
365 Ga0105243_10022056
366 Ga0105241_10031195
367 Ga0105242_10028821
368 Ga0105248_10006235
369 Ga0105248_10379032
370 Ga0105237_10234849
371 Ga0105237_10290896
372 Ga0105237_10386763
373 Ga0105238_10004823
374 Ga0105249_10002573
375 Ga0157373_10073455
376 Ga0157369_10011811
377 Ga0157369_10050104
378 Ga0157369_10205243
379 Ga0157374_10078017
380 Ga0157374_10108830
381 Ga0157374_10214661
382 Ga0157374_10373278
383 Ga0157378_10071529
384 Ga0157378_10090821
385 Ga0157378_10186386
386 Ga0163162_10024585
387 Ga0163162_10127136
388 Ga0157372_10000416
389 Ga0157372_10015070
390 Ga0157372_10038984
391 Ga0157372_10161994
392 Ga0157372_10749323
393 Ga0157375_10053310
394 Ga0163163_10071962
395 Ga0157379_10001621
396 Ga0157379_10041765
397 Ga0157376_10139255
398 Ga0182005_1027995
399 Ga0224569_100079
400 Ga0224571_101364
401 Ga0224572_1000721
402 Ga0224572_1018626
403 Ga0228598_1006765
404 Ga0228598_1010318
405 Ga0207692_10027501
406 Ga0207692_10207066
407 Ga0207710_10114308
408 Ga0207680_10041575
409 Ga0207699_10037195
410 Ga0207699_10269116
411 Ga0207645_10028347
412 Ga0207684_10000607
413 Ga0207684_10000621
414 Ga0207684_10035393
415 Ga0207684_10075375
416 Ga0207654_10013901
417 Ga0207707_10024077
418 Ga0207695_10012559
419 Ga0207695_10060907
420 Ga0207671_10053701
421 Ga0207693_10000850
422 Ga0207693_10033563
423 Ga0207663_10000480
424 Ga0207663_10024972
425 Ga0207657_10004889
426 Ga0207649_10010662
427 Ga0207652_10378730
428 Ga0207646_10003520
429 Ga0207646_10034525
430 Ga0207646_10553325
431 Ga0207694_10036509
432 Ga0207687_10090269
433 Ga0207700_10000467
434 Ga0207700_10057503
435 Ga0207700_10070352
436 Ga0207700_10076918
437 Ga0207700_10197748
438 Ga0207664_10000017
439 Ga0207664_10029014
440 Ga0207664_10221679
441 Ga0207664_10336582
442 Ga0207690_10265986
443 Ga0207706_10000532
444 Ga0207686_10032631
445 Ga0207669_10287128
446 Ga0207665_10012820
447 Ga0207665_10031184
448 Ga0207691_10119371
449 Ga0207711_10008364
450 Ga0207689_10043140
451 Ga0207689_10443039
452 Ga0207679_10072310
453 Ga0207667_10005965
454 Ga0207668_10032869
455 Ga0207640_10035967
456 Ga0207658_10033012
457 Ga0207677_10004912
458 Ga0207677_10153896
459 Ga0207703_10155806
460 Ga0207639_10018994
461 Ga0207678_10002529
462 Ga0207702_10089500
463 Ga0207702_10399845
464 Ga0207648_10006426
465 Ga0207648_10308804
466 Ga0207676_10059481
467 Ga0207674_10200514
468 Ga0207675_100020789
469 Ga0207698_10010353
470 Ga0268266_10119173
471 Ga0268264_10146607
472 Ga0265338_10029405
473 Ga0265338_10061987
474 Ga0265762_1000097
475 Ga0265762_1000380
476 Ga0265765_1003240
477 Ga0265760_10000112
478 Ga0265760_10000813
479 Ga0265760_10001941
480 Ga0265760_10008435
481 Ga0265325_10007786
482 Ga0265339_10036997
483 Ga0265316_10002195
484 Ga0265314_10001900
485 Ga0265314_10131589
486 Ga0373950_0025761
487 Ga0373926_0003464
488 Ga0373923_0010883
489 Ga0373939_0047689
490 Ga0373945_0029128
491 Ga0373953_0015081
492 Ga0373954_0011634
493 Ga0373960_0041705
494 Ga0373943_0002055
495 Ga0373946_0042269
496 Ga0373955_0021273
497 Ga0373962_0011402
498 Ga0373935_0006094
499 Ga0373935_0026098
500 Ga0373927_0000085
501 Ga0373927_0106606
502 Ga0373933_0070195
503 Ga0373933_0090958
504 Ga0373933_0166763
505 Ga0373947_0003047
506 Ga0373947_0038042
507 Ga0373947_0041201
508 Ga0373947_0111372
509 Ga0373937_0060676
510 Ga0373925_0074384
511 Ga0373925_0077790
512 Ga0451576_0442133
513 Ga0451576_0507284
514 Ga0466967_0212125
515 Ga0495629_0012343
516 Ga0495580_0000655
517 Ga0495580_0003361
518 Ga0495580_0194227
519 Ga0495582_0048294
520 Ga0495664_0008691
521 Ga0495664_0104539
522 Ga0495665_0028868
523 Ga0495645_0035850
524 Ga0495599_0159995
525 Ga0495623_0051711
526 Ga0495658_0070196
527 Ga0495669_0142962
528 Ga0495674_0002028
529 Ga0495674_0015346
530 Ga0495602_0041527
531 Ga0496100_0366704
532 Ga0496101_0231914
533 Ga0496102_0002175
534 Ga0496102_0136364
535 Ga0496102_0180040
536 Ga0496103_0004438
537 Ga0496105_0068723
538 Ga0496105_0152802
539 Ga0496105_0195667
540 Ga0496106_0013763
541 Ga0496107_0140466
542 Ga0496108_0249281
543 Ga0496111_0238638
544 Ga0496112_0255985
545 Ga0496114_0016216
546 Ga0496115_0006988
547 Ga0496115_0053572
548 Ga0501033_0067330
549 Ga0501034_0000258
550 Ga0501037_0116422
551 Ga0501038_0000185
552 Ga0501080_0085181
553 Ga0501044_0052446
554 nmdc:mga08x19_3589_c1
555 nmdc:mga08x19_3944_c1
556 nmdc:mga08x19_39919_c1
557 Ga0495601_0122300
558 Ga0495619_0092227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01841

Transglut_core

Transglutaminase-like superfamily

164

273

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.6979 23 325
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.6537 23 325
8tid-assembly1.cif.gz_H combined linker domain of n-drc and associated proteins tetrahymena 0.6369 137 255
2pqt-assembly1.cif.gz_A human n-acetyltransferase 1 0.6291 141 255
4x5y-assembly1.cif.gz_A menin in complex with mi-503 0.6261 144 255
ID Description Score Start End Superfamily
af_O53920_94_280_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8478 108 290 3.10.620.30
af_O53920_94_280_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8265 108 290 3.10.620.30
af_Q54IX2_591_772_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8116 111 281 3.10.620.30
af_Q54IX2_1026_1205_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8034 107 279 3.10.620.30
af_Q86AX0_679_844_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7996 111 269 3.10.620.30
ID Description Score Start End GO Terms
AF-A0A2W0BLI0-F1-model_v4 Transglutaminase 0.9616 105 326
AF-A0A2E3MLN5-F1-model_v4 Transglutaminase 0.9605 20 328 GO:0016020
AF-A0A1G3BIV1-F1-model_v4 Transglutaminase-like domain-containing protein 0.9591 22 323
AF-A0A2V6CV66-F1-model_v4 Transglutaminase 0.9566 158 311
AF-A0A7C7GI16-F1-model_v4 Transglutaminase domain-containing protein 0.9558 54 323

Map