F382282

General Info

Members Datasets Scaffolds Average Seq Length
278 149 556 155

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100072648|Ga0068852_1000726484
Length 155
Sequence MLPDNLRERAVAAAVESFDGDAIQGGKYDRDELTLEIAPAKIASVCGFLKYDQKFVRLSSVTAVDRYPAEPRFEVVYHLHSIERNERLRLKARIAGEEIDTVTTVWRGANWYEREVFDLFGIRFTGHPDLRRIMMPDDWNGHPLRKDYPITGTRV

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
91 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.44
Rhizosphere 96.04
Stem 0
Stem Tuber 0
Unclassified 2.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100072648 3300005616 Bacteria 3024
2 Ga0070658_10405726 3300005327 Bacteria 1171
3 Ga0070683_100000001 3300005329 Bacteria 529385
4 Ga0070683_100020135 3300005329 Bacteria 5935
5 Ga0070683_100325428 3300005329 Bacteria 1463
6 Ga0070683_100795255 3300005329 Bacteria 907
7 Ga0070670_100925036 3300005331 Bacteria 791
8 Ga0070680_100108923 3300005336 Bacteria 2305
9 Ga0070680_101392570 3300005336 Bacteria 607
10 Ga0070689_101454471 3300005340 Bacteria 620
11 Ga0070671_100173991 3300005355 Bacteria 1821
12 Ga0070673_100034832 3300005364 Bacteria 3814
13 Ga0070659_100401500 3300005366 Bacteria 1157
14 Ga0070667_100499606 3300005367 Bacteria 1115
15 Ga0070709_10093676 3300005434 Bacteria 1986
16 Ga0070709_10170564 3300005434 Bacteria 1520
17 Ga0070714_101596213 3300005435 Bacteria 637
18 Ga0070713_100116475 3300005436 Bacteria 2337
19 Ga0070713_100547883 3300005436 Bacteria 1095
20 Ga0070681_10577346 3300005458 Bacteria 1038
21 Ga0070679_100302858 3300005530 Bacteria 1549
22 Ga0070684_100000006 3300005535 Bacteria 227715
23 Ga0070684_100031744 3300005535 Bacteria 4499
24 Ga0070684_100715914 3300005535 Bacteria 934
25 Ga0070684_101884568 3300005535 Bacteria 564
26 Ga0070672_101601822 3300005543 Bacteria 584
27 Ga0070686_100185472 3300005544 Bacteria 1481
28 Ga0070665_100292892 3300005548 Bacteria 1630
29 Ga0070665_100318373 3300005548 Bacteria 1560
30 Ga0068855_101281722 3300005563 Bacteria 759
31 Ga0068856_100078116 3300005614 Bacteria 3281
32 Ga0068859_100362187 3300005617 Bacteria 1545
33 Ga0068859_100397509 3300005617 Bacteria 1474
34 Ga0068859_100963673 3300005617 Bacteria 936
35 Ga0068859_101019858 3300005617 Bacteria 909
36 Ga0068864_100322786 3300005618 Bacteria 1450
37 Ga0068863_100482076 3300005841 Bacteria 1220
38 Ga0068858_100277342 3300005842 Bacteria 1596
39 Ga0068860_100790116 3300005843 Bacteria 962
40 Ga0070717_10046911 3300006028 Bacteria 3537
41 Ga0070717_10139042 3300006028 Bacteria 2094
42 Ga0097621_100148245 3300006237 Bacteria 2010
43 Ga0097621_100592411 3300006237 Bacteria 1013
44 Ga0068871_100104497 3300006358 Bacteria 2376
45 Ga0068871_100692818 3300006358 Bacteria 933
46 Ga0068871_100851919 3300006358 Bacteria 843
47 Ga0068871_101074558 3300006358 Bacteria 752
48 Ga0075431_100142368 3300006847 Bacteria 2472
49 Ga0075434_101707537 3300006871 Bacteria 637
50 Ga0068865_100185503 3300006881 Bacteria 1605
51 Ga0097620_100362195 3300006931 Bacteria 1545
52 Ga0097620_100397528 3300006931 Bacteria 1474
53 Ga0097620_100963725 3300006931 Bacteria 936
54 Ga0097620_101020057 3300006931 Bacteria 909
55 Ga0099794_10032057 3300007265 Bacteria 2464
56 Ga0105240_10001937 3300009093 Bacteria 34329
57 Ga0105240_10106722 3300009093 Bacteria 3396
58 Ga0111539_10205438 3300009094 Bacteria 2296
59 Ga0105245_10238514 3300009098 Bacteria 1762
60 Ga0105245_10607190 3300009098 Bacteria 1121
61 Ga0105245_11125730 3300009098 Bacteria 832
62 Ga0105245_11739061 3300009098 Unclassified 676
63 Ga0105247_10765916 3300009101 Bacteria 733
64 Ga0105247_11137868 3300009101 Bacteria 618
65 Ga0114129_10288736 3300009147 Bacteria 2189
66 Ga0105241_10292020 3300009174 Bacteria 1396
67 Ga0105241_10501703 3300009174 Bacteria 1082
68 Ga0105242_10980573 3300009176 Bacteria 851
69 Ga0105242_12090331 3300009176 Bacteria 610
70 Ga0105248_10036894 3300009177 Bacteria 5466
71 Ga0105248_10164242 3300009177 Bacteria 2504
72 Ga0105248_10599262 3300009177 Unclassified 1243
73 Ga0105248_10716539 3300009177 Bacteria 1129
74 Ga0105248_11088365 3300009177 Bacteria 903
75 Ga0105248_11295336 3300009177 Bacteria 824
76 Ga0105248_12105272 3300009177 Bacteria 642
77 Ga0105237_10077681 3300009545 Bacteria 3310
78 Ga0105237_12743773 3300009545 Bacteria 504
79 Ga0105246_10314154 3300011119 Bacteria 1270
80 Ga0105246_10436757 3300011119 Bacteria 1096
81 Ga0105246_10738579 3300011119 Bacteria 867
82 Ga0157370_10202117 3300013104 Bacteria 1843
83 Ga0157370_10299937 3300013104 Bacteria 1483
84 Ga0157370_10646024 3300013104 Bacteria 967
85 Ga0157369_10024618 3300013105 Bacteria 6693
86 Ga0157369_10275775 3300013105 Bacteria 1752
87 Ga0157374_10446428 3300013296 Bacteria 1294
88 Ga0157374_10920024 3300013296 Bacteria 892
89 Ga0157374_11102003 3300013296 Bacteria 814
90 Ga0157378_11777712 3300013297 Bacteria 664
91 Ga0163162_10578842 3300013306 Bacteria 1250
92 Ga0157372_10013327 3300013307 Bacteria 8776
93 Ga0157372_10505407 3300013307 Bacteria 1409
94 Ga0157372_10615294 3300013307 Bacteria 1266
95 Ga0157372_10931022 3300013307 Bacteria 1008
96 Ga0157375_10135269 3300013308 Bacteria 2588
97 Ga0157375_10324782 3300013308 Bacteria 1703
98 Ga0157375_10573602 3300013308 Bacteria 1289
99 Ga0157375_10715104 3300013308 Bacteria 1155
100 Ga0157375_10992433 3300013308 Bacteria 980
101 Ga0157375_11226317 3300013308 Bacteria 880
102 Ga0163163_10028897 3300014325 Bacteria 5329
103 Ga0163163_10042559 3300014325 Bacteria 4449
104 Ga0163163_10639546 3300014325 Bacteria 1127
105 Ga0163163_10920236 3300014325 Bacteria 938
106 Ga0163163_11451427 3300014325 Bacteria 748
107 Ga0163163_11716787 3300014325 Bacteria 688
108 Ga0157376_10040617 3300014969 Bacteria 3803
109 Ga0157376_10086958 3300014969 Bacteria 2696
110 Ga0157376_10097791 3300014969 Bacteria 2558
111 Ga0157376_10302076 3300014969 Unclassified 1515
112 Ga0213876_10026298 3300021384 Bacteria 3070
113 Ga0213875_10008183 3300021388 Bacteria 5366
114 Ga0213875_10169142 3300021388 Bacteria 1026
115 Ga0207699_10074376 3300025906 Bacteria 2087
116 Ga0207699_10115020 3300025906 Bacteria 1730
117 Ga0207705_10448315 3300025909 Bacteria 1000
118 Ga0207654_10578353 3300025911 Bacteria 800
119 Ga0207707_10811967 3300025912 Bacteria 778
120 Ga0207695_10005117 3300025913 Bacteria 17558
121 Ga0207695_10060056 3300025913 Bacteria 3938
122 Ga0207671_10042762 3300025914 Bacteria 3353
123 Ga0207660_10260210 3300025917 Bacteria 1372
124 Ga0207687_10420546 3300025927 Bacteria 1103
125 Ga0207700_10015851 3300025928 Unclassified 4987
126 Ga0207700_10773155 3300025928 Bacteria 858
127 Ga0207700_10998942 3300025928 Unclassified 749
128 Ga0207644_10142596 3300025931 Bacteria 1846
129 Ga0207670_10227169 3300025936 Bacteria 1432
130 Ga0207669_10955070 3300025937 Bacteria 718
131 Ga0207691_11115975 3300025940 Bacteria 656
132 Ga0207711_10120736 3300025941 Bacteria 2339
133 Ga0207711_10386408 3300025941 Bacteria 1299
134 Ga0207711_10435127 3300025941 Bacteria 1221
135 Ga0207661_10000005 3300025944 Bacteria 557888
136 Ga0207661_10014604 3300025944 Bacteria 5760
137 Ga0207661_10287767 3300025944 Bacteria 1470
138 Ga0207661_10543336 3300025944 Bacteria 1064
139 Ga0207651_10047036 3300025960 Bacteria 2906
140 Ga0207677_10106520 3300026023 Bacteria 2077
141 Ga0207702_10242951 3300026078 Bacteria 1688
142 Ga0207641_10099224 3300026088 Bacteria 2562
143 Ga0207641_10100368 3300026088 Bacteria 2549
144 Ga0207676_10153877 3300026095 Bacteria 1984
145 Ga0207676_11430719 3300026095 Bacteria 688
146 Ga0207674_10941258 3300026116 Bacteria 832
147 Ga0207683_10199126 3300026121 Bacteria 1820
148 Ga0207698_10066668 3300026142 Bacteria 2835
149 Ga0268266_10210181 3300028379 Bacteria 1784
150 Ga0268266_10284070 3300028379 Bacteria 1540
151 Ga0265323_10000289 3300028653 Bacteria 29020
152 Ga0265338_10157702 3300028800 Bacteria 1756
153 Ga0265760_10055096 3300031090 Bacteria 1201
154 Ga0265332_10399279 3300031238 Bacteria 568
155 Ga0265325_10265306 3300031241 Bacteria 774
156 Ga0265325_10385458 3300031241 Bacteria 615
157 Ga0265329_10165389 3300031242 Bacteria 720
158 Ga0265331_10045253 3300031250 Bacteria 2125
159 Ga0265316_10009633 3300031344 Bacteria 8874
160 Ga0265316_10010568 3300031344 Bacteria 8402
161 Ga0265316_10019419 3300031344 Bacteria 5815
162 Ga0265316_10046883 3300031344 Bacteria 3421
163 Ga0265316_10089087 3300031344 Bacteria 2355
164 Ga0265316_10108921 3300031344 Bacteria 2099
165 Ga0265316_10501445 3300031344 Bacteria 867
166 Ga0265316_10518544 3300031344 Bacteria 850
167 Ga0265314_10110720 3300031711 Bacteria 1745
168 Ga0265342_10160256 3300031712 Bacteria 1244
169 Ga0265342_10211504 3300031712 Bacteria 1048
170 Ga0373926_0019869 3300035083 Bacteria 2318
171 Ga0373940_0210274 3300035088 Bacteria 643
172 Ga0373945_0136778 3300035116 Bacteria 985
173 Ga0373954_0131216 3300035118 Bacteria 1220
174 Ga0373954_0270172 3300035118 Bacteria 838
175 Ga0373957_0277184 3300035120 Bacteria 709
176 Ga0373943_0094128 3300035170 Bacteria 1556
177 Ga0373946_0247111 3300035171 Bacteria 869
178 Ga0373955_0368026 3300035172 Bacteria 872
179 Ga0373931_0209248 3300035691 Bacteria 1169
180 Ga0373931_0907885 3300035691 Bacteria 592
181 Ga0373935_0046555 3300035692 Bacteria 2740
182 Ga0373927_0007588 3300035695 Bacteria 7344
183 Ga0373927_0116579 3300035695 Bacteria 1742
184 Ga0373927_0273298 3300035695 Bacteria 1111
185 Ga0373933_0189477 3300035724 Bacteria 1314
186 Ga0373947_0003593 3300035725 Bacteria 9144
187 Ga0373947_0208297 3300035725 Bacteria 1282
188 Ga0373937_0110874 3300036401 Bacteria 2552
189 Ga0373937_0536010 3300036401 Bacteria 1112
190 Ga0373937_1541666 3300036401 Bacteria 612
191 Ga0373925_0000705 3300037068 Bacteria 31255
192 Ga0373925_0144464 3300037068 Bacteria 1864
193 Ga0373925_0273678 3300037068 Bacteria 1359
194 Ga0373925_0631151 3300037068 Bacteria 883
195 Ga0373925_0786863 3300037068 Bacteria 784
196 Ga0436364_0297563 3300037853 Bacteria 10532
197 Ga0436364_0446679 3300037853 Bacteria 1784
198 Ga0436364_0585944 3300037853 Bacteria 4192
199 Ga0436365_1514739 3300039437 Bacteria 2926
200 Ga0451576_0054775 3300045051 Bacteria 4175
201 Ga0451576_0108601 3300045051 Bacteria 2887
202 Ga0466967_0315138 3300045976 Bacteria 1508
203 Ga0495592_0020017 3300046454 Bacteria 5088
204 Ga0495592_0372074 3300046454 Bacteria 911
205 Ga0495651_0059398 3300046462 Bacteria 2932
206 Ga0495653_0089880 3300046463 Bacteria 2249
207 Ga0495653_0363698 3300046463 Bacteria 928
208 Ga0495580_0012002 3300046472 Bacteria 6676
209 Ga0495580_0025788 3300046472 Bacteria 4293
210 Ga0495580_0096509 3300046472 Bacteria 2056
211 Ga0495580_0156694 3300046472 Bacteria 1577
212 Ga0495580_0198905 3300046472 Bacteria 1381
213 Ga0495580_0415233 3300046472 Unclassified 906
214 Ga0495580_0560054 3300046472 Bacteria 758
215 Ga0495582_0317881 3300046473 Bacteria 896
216 Ga0495582_0694825 3300046473 Bacteria 589
217 Ga0495639_0100124 3300046475 Bacteria 1368
218 Ga0495662_0016750 3300046476 Bacteria 3550
219 Ga0495664_0010238 3300046477 Bacteria 5260
220 Ga0495664_0149513 3300046477 Bacteria 1417
221 Ga0495608_0029141 3300046511 Bacteria 3748
222 Ga0495628_0046220 3300046516 Bacteria 3458
223 Ga0495628_0312149 3300046516 Bacteria 1162
224 Ga0495628_0480753 3300046516 Bacteria 899
225 Ga0495630_0017284 3300046517 Bacteria 5282
226 Ga0495630_0045559 3300046517 Bacteria 3278
227 Ga0495666_0355863 3300046526 Bacteria 659
228 Ga0495652_0005574 3300046529 Bacteria 11835
229 Ga0495640_0039719 3300046533 Bacteria 3300
230 Ga0495586_0078986 3300046535 Bacteria 1806
231 Ga0495586_0400983 3300046535 Bacteria 789
232 Ga0495587_0020478 3300046536 Bacteria 4083
233 Ga0495587_0107653 3300046536 Bacteria 1603
234 Ga0495645_0003176 3300046543 Bacteria 11138
235 Ga0495645_0039446 3300046543 Bacteria 3444
236 Ga0495645_0182146 3300046543 Bacteria 1438
237 Ga0495645_0311125 3300046543 Bacteria 1026
238 Ga0495645_0475194 3300046543 Bacteria 785
239 Ga0495645_0774785 3300046543 Bacteria 577
240 Ga0495667_0011259 3300046559 Bacteria 6054
241 Ga0495667_0162535 3300046559 Bacteria 1436
242 Ga0495667_0281034 3300046559 Bacteria 1056
243 Ga0495635_0010472 3300046663 Bacteria 6485
244 Ga0495635_0397198 3300046663 Bacteria 916
245 Ga0495599_0003935 3300046678 Bacteria 8736
246 Ga0495599_0189335 3300046678 Bacteria 1266
247 Ga0495599_0834416 3300046678 Bacteria 525
248 Ga0495623_0063406 3300046679 Bacteria 2314
249 Ga0495623_0433016 3300046679 Unclassified 703
250 Ga0495646_0126752 3300046680 Bacteria 1440
251 Ga0495613_0241094 3300046689 Bacteria 1264
252 Ga0495613_0663240 3300046689 Bacteria 689
253 Ga0495624_0114199 3300046690 Bacteria 1660
254 Ga0495600_0011033 3300046809 Bacteria 5623
255 Ga0495604_0040055 3300047317 Bacteria 3680
256 Ga0495604_0169984 3300047317 Bacteria 1534
257 Ga0495674_0006733 3300047319 Bacteria 11001
258 Ga0495674_0083917 3300047319 Bacteria 2730
259 Ga0495674_0455003 3300047319 Bacteria 1028
260 Ga0495674_0964079 3300047319 Unclassified 655
261 Ga0495680_0347187 3300047322 Bacteria 1034
262 Ga0495680_0553887 3300047322 Bacteria 774
263 Ga0495675_0017442 3300047444 Bacteria 4550
264 Ga0495675_0028768 3300047444 Bacteria 3542
265 Ga0495684_0004888 3300047471 Bacteria 10454
266 Ga0495684_0161656 3300047471 Bacteria 1670
267 Ga0495684_0179197 3300047471 Bacteria 1571
268 Ga0495602_0112800 3300048088 Bacteria 2205
269 Ga0496104_1394138 3300048907 Bacteria 604
270 Ga0496105_0676988 3300048908 Bacteria 794
271 Ga0496109_1161656 3300048912 Bacteria 709
272 Ga0496112_0283576 3300048915 Bacteria 1603
273 nmdc:mga0qj67_403936_c1 3300050509 Bacteria 1102
274 nmdc:mga06r32_600612_c1 3300050510 Bacteria 1071
275 nmdc:mga08y16_250726_c1 3300050511 Bacteria 1829
276 Ga0495601_0216546 3300053077 Bacteria 1251
277 Ga0495619_0128769 3300053085 Bacteria 1739
278 Ga0501082_0001157 3300060353 Bacteria 23236
279 Ga0068852_100072648
280 Ga0070658_10405726
281 Ga0070683_100000001
282 Ga0070683_100020135
283 Ga0070683_100325428
284 Ga0070683_100795255
285 Ga0070670_100925036
286 Ga0070680_100108923
287 Ga0070680_101392570
288 Ga0070689_101454471
289 Ga0070671_100173991
290 Ga0070673_100034832
291 Ga0070659_100401500
292 Ga0070667_100499606
293 Ga0070709_10093676
294 Ga0070709_10170564
295 Ga0070714_101596213
296 Ga0070713_100116475
297 Ga0070713_100547883
298 Ga0070681_10577346
299 Ga0070679_100302858
300 Ga0070684_100000006
301 Ga0070684_100031744
302 Ga0070684_100715914
303 Ga0070684_101884568
304 Ga0070672_101601822
305 Ga0070686_100185472
306 Ga0070665_100292892
307 Ga0070665_100318373
308 Ga0068855_101281722
309 Ga0068856_100078116
310 Ga0068859_100362187
311 Ga0068859_100397509
312 Ga0068859_100963673
313 Ga0068859_101019858
314 Ga0068864_100322786
315 Ga0068863_100482076
316 Ga0068858_100277342
317 Ga0068860_100790116
318 Ga0070717_10046911
319 Ga0070717_10139042
320 Ga0097621_100148245
321 Ga0097621_100592411
322 Ga0068871_100104497
323 Ga0068871_100692818
324 Ga0068871_100851919
325 Ga0068871_101074558
326 Ga0075431_100142368
327 Ga0075434_101707537
328 Ga0068865_100185503
329 Ga0097620_100362195
330 Ga0097620_100397528
331 Ga0097620_100963725
332 Ga0097620_101020057
333 Ga0099794_10032057
334 Ga0105240_10001937
335 Ga0105240_10106722
336 Ga0111539_10205438
337 Ga0105245_10238514
338 Ga0105245_10607190
339 Ga0105245_11125730
340 Ga0105245_11739061
341 Ga0105247_10765916
342 Ga0105247_11137868
343 Ga0114129_10288736
344 Ga0105241_10292020
345 Ga0105241_10501703
346 Ga0105242_10980573
347 Ga0105242_12090331
348 Ga0105248_10036894
349 Ga0105248_10164242
350 Ga0105248_10599262
351 Ga0105248_10716539
352 Ga0105248_11088365
353 Ga0105248_11295336
354 Ga0105248_12105272
355 Ga0105237_10077681
356 Ga0105237_12743773
357 Ga0105246_10314154
358 Ga0105246_10436757
359 Ga0105246_10738579
360 Ga0157370_10202117
361 Ga0157370_10299937
362 Ga0157370_10646024
363 Ga0157369_10024618
364 Ga0157369_10275775
365 Ga0157374_10446428
366 Ga0157374_10920024
367 Ga0157374_11102003
368 Ga0157378_11777712
369 Ga0163162_10578842
370 Ga0157372_10013327
371 Ga0157372_10505407
372 Ga0157372_10615294
373 Ga0157372_10931022
374 Ga0157375_10135269
375 Ga0157375_10324782
376 Ga0157375_10573602
377 Ga0157375_10715104
378 Ga0157375_10992433
379 Ga0157375_11226317
380 Ga0163163_10028897
381 Ga0163163_10042559
382 Ga0163163_10639546
383 Ga0163163_10920236
384 Ga0163163_11451427
385 Ga0163163_11716787
386 Ga0157376_10040617
387 Ga0157376_10086958
388 Ga0157376_10097791
389 Ga0157376_10302076
390 Ga0213876_10026298
391 Ga0213875_10008183
392 Ga0213875_10169142
393 Ga0207699_10074376
394 Ga0207699_10115020
395 Ga0207705_10448315
396 Ga0207654_10578353
397 Ga0207707_10811967
398 Ga0207695_10005117
399 Ga0207695_10060056
400 Ga0207671_10042762
401 Ga0207660_10260210
402 Ga0207687_10420546
403 Ga0207700_10015851
404 Ga0207700_10773155
405 Ga0207700_10998942
406 Ga0207644_10142596
407 Ga0207670_10227169
408 Ga0207669_10955070
409 Ga0207691_11115975
410 Ga0207711_10120736
411 Ga0207711_10386408
412 Ga0207711_10435127
413 Ga0207661_10000005
414 Ga0207661_10014604
415 Ga0207661_10287767
416 Ga0207661_10543336
417 Ga0207651_10047036
418 Ga0207677_10106520
419 Ga0207702_10242951
420 Ga0207641_10099224
421 Ga0207641_10100368
422 Ga0207676_10153877
423 Ga0207676_11430719
424 Ga0207674_10941258
425 Ga0207683_10199126
426 Ga0207698_10066668
427 Ga0268266_10210181
428 Ga0268266_10284070
429 Ga0265323_10000289
430 Ga0265338_10157702
431 Ga0265760_10055096
432 Ga0265332_10399279
433 Ga0265325_10265306
434 Ga0265325_10385458
435 Ga0265329_10165389
436 Ga0265331_10045253
437 Ga0265316_10009633
438 Ga0265316_10010568
439 Ga0265316_10019419
440 Ga0265316_10046883
441 Ga0265316_10089087
442 Ga0265316_10108921
443 Ga0265316_10501445
444 Ga0265316_10518544
445 Ga0265314_10110720
446 Ga0265342_10160256
447 Ga0265342_10211504
448 Ga0373926_0019869
449 Ga0373940_0210274
450 Ga0373945_0136778
451 Ga0373954_0131216
452 Ga0373954_0270172
453 Ga0373957_0277184
454 Ga0373943_0094128
455 Ga0373946_0247111
456 Ga0373955_0368026
457 Ga0373931_0209248
458 Ga0373931_0907885
459 Ga0373935_0046555
460 Ga0373927_0007588
461 Ga0373927_0116579
462 Ga0373927_0273298
463 Ga0373933_0189477
464 Ga0373947_0003593
465 Ga0373947_0208297
466 Ga0373937_0110874
467 Ga0373937_0536010
468 Ga0373937_1541666
469 Ga0373925_0000705
470 Ga0373925_0144464
471 Ga0373925_0273678
472 Ga0373925_0631151
473 Ga0373925_0786863
474 Ga0436364_0297563
475 Ga0436364_0446679
476 Ga0436364_0585944
477 Ga0436365_1514739
478 Ga0451576_0054775
479 Ga0451576_0108601
480 Ga0466967_0315138
481 Ga0495592_0020017
482 Ga0495592_0372074
483 Ga0495651_0059398
484 Ga0495653_0089880
485 Ga0495653_0363698
486 Ga0495580_0012002
487 Ga0495580_0025788
488 Ga0495580_0096509
489 Ga0495580_0156694
490 Ga0495580_0198905
491 Ga0495580_0415233
492 Ga0495580_0560054
493 Ga0495582_0317881
494 Ga0495582_0694825
495 Ga0495639_0100124
496 Ga0495662_0016750
497 Ga0495664_0010238
498 Ga0495664_0149513
499 Ga0495608_0029141
500 Ga0495628_0046220
501 Ga0495628_0312149
502 Ga0495628_0480753
503 Ga0495630_0017284
504 Ga0495630_0045559
505 Ga0495666_0355863
506 Ga0495652_0005574
507 Ga0495640_0039719
508 Ga0495586_0078986
509 Ga0495586_0400983
510 Ga0495587_0020478
511 Ga0495587_0107653
512 Ga0495645_0003176
513 Ga0495645_0039446
514 Ga0495645_0182146
515 Ga0495645_0311125
516 Ga0495645_0475194
517 Ga0495645_0774785
518 Ga0495667_0011259
519 Ga0495667_0162535
520 Ga0495667_0281034
521 Ga0495635_0010472
522 Ga0495635_0397198
523 Ga0495599_0003935
524 Ga0495599_0189335
525 Ga0495599_0834416
526 Ga0495623_0063406
527 Ga0495623_0433016
528 Ga0495646_0126752
529 Ga0495613_0241094
530 Ga0495613_0663240
531 Ga0495624_0114199
532 Ga0495600_0011033
533 Ga0495604_0040055
534 Ga0495604_0169984
535 Ga0495674_0006733
536 Ga0495674_0083917
537 Ga0495674_0455003
538 Ga0495674_0964079
539 Ga0495680_0347187
540 Ga0495680_0553887
541 Ga0495675_0017442
542 Ga0495675_0028768
543 Ga0495684_0004888
544 Ga0495684_0161656
545 Ga0495684_0179197
546 Ga0495602_0112800
547 Ga0496104_1394138
548 Ga0496105_0676988
549 Ga0496109_1161656
550 Ga0496112_0283576
551 nmdc:mga0qj67_403936_c1
552 nmdc:mga06r32_600612_c1
553 nmdc:mga08y16_250726_c1
554 Ga0495601_0216546
555 Ga0495619_0128769
556 Ga0501082_0001157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00329

Complex1_30kDa

Respiratory-chain NADH dehydrogenase, 30 Kd subunit

35

154

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mcr-assembly1.cif.gz_A crystal structure of nadh dehydrogenase subunit c (tfu_2693) from thermobifida fusca yx-er1 at 2.65 a resolution 0.9303 16 129
5b3q-assembly1.cif.gz_A nqo5 of the trypsin-resistant fragment (1-134) in p63 form 0.899 22 127
7a24-assembly1.cif.gz_F assembly intermediate of the plant mitochondrial complex i 0.8429 11 147
7v2f-assembly1.cif.gz_P deactive state complex i from q10-nadh dataset 0.8304 5 147
5xtb-assembly1.cif.gz_P cryo-em structure of human respiratory complex i matrix arm 0.8301 11 147
ID Description Score Start End Superfamily
af_A0A2P2CLF6_6_131_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9435 17 130 3.30.460.80
af_A0A1D8PJ73_47_194_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9269 11 130 3.30.460.80
af_P9WJH3_48_196_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.9153 11 130 3.30.460.80
5b3qA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.899 22 127 3.30.460.80
af_P33599_5_153_3.30.460.80 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;NADH:ubiquinone oxidoreductase Nqo5 subunit 0.8973 8 130 3.30.460.80
ID Description Score Start End GO Terms
AF-A0A7C2I8K4-F1-model_v4 NADH-quinone oxidoreductase subunit C 0.9259 11 105 GO:0008137
AF-A0A7Y4YY92-F1-model_v4 NADH-quinone oxidoreductase subunit C 0.9192 4 119 GO:0008137
AF-A0A395M120-F1-model_v4 NADH:ubiquinone oxidoreductase 30kDa subunit domain-containing protein 0.9108 11 91 GO:0008137
AF-A0A2W5YXH4-F1-model_v4 NADH-quinone oxidoreductase subunit C 0.9083 1 109 GO:0008137
AF-A0A3D3NPJ5-F1-model_v4 NADH-quinone oxidoreductase (EC 7.1.1.-) 0.9004 4 132 GO:0008137
GO:0048038

Map