F382226

General Info

Members Datasets Scaffolds Average Seq Length
278 154 556 167

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_101145080|Ga0070713_1011450801
Length 154
Sequence MQVLEAGSNKYLLLELDPEFVGNIARQSGFDFKIDDQGRVMSLDLAATERQAPLLLFDAADPGNLGWFSRCQFYVDGKSGAVLQTPLSLANQRDRTGRTLPHAVRVQIAKELPGTFRMPGRQPVSEQVITGVGVCGGPIVKPLAGRTETVGTKN

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.8
Rhizosphere 97.48
Stem 0
Stem Tuber 0
Unclassified 33.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_101145080 3300005436 Unclassified 752
2 Ga0070683_101190672 3300005329 Unclassified 732
3 Ga0070666_10396558 3300005335 Bacteria 992
4 Ga0070666_10398640 3300005335 Unclassified 989
5 Ga0070680_100010687 3300005336 Bacteria 7083
6 Ga0070680_100367919 3300005336 Bacteria 1223
7 Ga0070680_100752781 3300005336 Bacteria 839
8 Ga0070660_100348449 3300005339 Unclassified 1219
9 Ga0070660_101009017 3300005339 Bacteria 703
10 Ga0070689_100158076 3300005340 Bacteria 1831
11 Ga0070661_100311643 3300005344 Bacteria 1227
12 Ga0070674_100914773 3300005356 Bacteria 765
13 Ga0070673_100403424 3300005364 Bacteria 1223
14 Ga0070688_100239791 3300005365 Bacteria 1286
15 Ga0070659_100144646 3300005366 Bacteria 1937
16 Ga0070667_100699650 3300005367 Unclassified 938
17 Ga0070667_100806158 3300005367 Bacteria 872
18 Ga0070709_10348645 3300005434 Bacteria 1093
19 Ga0070714_100439324 3300005435 Bacteria 1238
20 Ga0070714_101381650 3300005435 Unclassified 688
21 Ga0070713_100007418 3300005436 Bacteria 7696
22 Ga0070713_100691575 3300005436 Unclassified 973
23 Ga0070713_101376152 3300005436 Unclassified 684
24 Ga0070663_100431849 3300005455 Unclassified 1082
25 Ga0070681_10004213 3300005458 Bacteria 13627
26 Ga0070681_10225680 3300005458 Bacteria 1788
27 Ga0070681_10282010 3300005458 Bacteria 1572
28 Ga0070681_10547360 3300005458 Bacteria 1071
29 Ga0070706_100201513 3300005467 Bacteria 1859
30 Ga0070679_100152174 3300005530 Unclassified 2290
31 Ga0070679_100212455 3300005530 Bacteria 1898
32 Ga0070679_100253576 3300005530 Bacteria 1715
33 Ga0070684_100000590 3300005535 Bacteria 25018
34 Ga0070684_100109451 3300005535 Bacteria 2476
35 Ga0070696_100005868 3300005546 Bacteria 8198
36 Ga0070665_101341921 3300005548 Bacteria 725
37 Ga0068855_100030512 3300005563 Bacteria 6447
38 Ga0068855_100073092 3300005563 Unclassified 3985
39 Ga0068855_100251808 3300005563 Bacteria 1970
40 Ga0068855_100836220 3300005563 Bacteria 976
41 Ga0070664_100137514 3300005564 Unclassified 2149
42 Ga0068857_101174651 3300005577 Unclassified 743
43 Ga0068856_100006931 3300005614 Bacteria 11085
44 Ga0068856_100246120 3300005614 Bacteria 1803
45 Ga0068852_100052777 3300005616 Bacteria 3496
46 Ga0068852_100207671 3300005616 Bacteria 1856
47 Ga0068852_100269426 3300005616 Bacteria 1638
48 Ga0068852_101044101 3300005616 Unclassified 836
49 Ga0068859_100398788 3300005617 Bacteria 1472
50 Ga0068859_100866405 3300005617 Bacteria 989
51 Ga0068864_100241885 3300005618 Bacteria 1672
52 Ga0068861_100514553 3300005719 Bacteria 1084
53 Ga0068863_100127778 3300005841 Bacteria 2426
54 Ga0068858_100261901 3300005842 Bacteria 1644
55 Ga0068860_100451065 3300005843 Bacteria 1279
56 Ga0068860_101258412 3300005843 Bacteria 760
57 Ga0070717_10003222 3300006028 Bacteria 11653
58 Ga0070717_10100383 3300006028 Unclassified 2457
59 Ga0070712_100809498 3300006175 Bacteria 804
60 Ga0097621_100333473 3300006237 Unclassified 1346
61 Ga0097621_101179679 3300006237 Unclassified 721
62 Ga0068871_100331710 3300006358 Bacteria 1342
63 Ga0075433_11410295 3300006852 Unclassified 602
64 Ga0075434_101198406 3300006871 Unclassified 771
65 Ga0097620_100398817 3300006931 Bacteria 1472
66 Ga0097620_100866406 3300006931 Bacteria 989
67 Ga0105240_10000274 3300009093 Bacteria 102157
68 Ga0105240_10297745 3300009093 Bacteria 1846
69 Ga0105240_10300676 3300009093 Unclassified 1836
70 Ga0105240_11050269 3300009093 Unclassified 869
71 Ga0111539_10712244 3300009094 Unclassified 1168
72 Ga0105245_10195539 3300009098 Unclassified 1940
73 Ga0105245_10972892 3300009098 Unclassified 892
74 Ga0105247_10532228 3300009101 Bacteria 861
75 Ga0105241_10126310 3300009174 Unclassified 2066
76 Ga0105241_10528941 3300009174 Unclassified 1055
77 Ga0105241_11388031 3300009174 Bacteria 672
78 Ga0105242_10822881 3300009176 Bacteria 921
79 Ga0105248_10007347 3300009177 Bacteria 12090
80 Ga0105248_10103868 3300009177 Bacteria 3203
81 Ga0105248_10297665 3300009177 Unclassified 1817
82 Ga0105248_11276146 3300009177 Unclassified 831
83 Ga0105248_11929051 3300009177 Unclassified 670
84 Ga0105237_10012985 3300009545 Bacteria 8745
85 Ga0105237_10115448 3300009545 Bacteria 2678
86 Ga0105237_10297280 3300009545 Bacteria 1617
87 Ga0105237_10355762 3300009545 Bacteria 1469
88 Ga0105237_10699839 3300009545 Bacteria 1020
89 Ga0105237_11933932 3300009545 Bacteria 598
90 Ga0105238_10146111 3300009551 Unclassified 2341
91 Ga0105238_10153305 3300009551 Bacteria 2279
92 Ga0105238_10188495 3300009551 Bacteria 2039
93 Ga0105238_10188800 3300009551 Unclassified 2037
94 Ga0105238_10469348 3300009551 Bacteria 1257
95 Ga0105238_11125470 3300009551 Unclassified 808
96 Ga0105249_10167985 3300009553 Unclassified 2125
97 Ga0105239_10119922 3300010375 Bacteria 2920
98 Ga0105239_10192689 3300010375 Unclassified 2282
99 Ga0105239_10201775 3300010375 Bacteria 2228
100 Ga0105239_10483532 3300010375 Bacteria 1407
101 Ga0105239_10809527 3300010375 Unclassified 1073
102 Ga0105246_10242441 3300011119 Bacteria 1426
103 Ga0157371_10622720 3300013102 Bacteria 804
104 Ga0157370_10004424 3300013104 Bacteria 16099
105 Ga0157370_10587751 3300013104 Bacteria 1020
106 Ga0157369_10044393 3300013105 Bacteria 4838
107 Ga0157369_10078483 3300013105 Bacteria 3537
108 Ga0157369_10355421 3300013105 Bacteria 1521
109 Ga0157369_10571469 3300013105 Bacteria 1168
110 Ga0157374_11227292 3300013296 Bacteria 771
111 Ga0157378_10229998 3300013297 Bacteria 1766
112 Ga0157378_10298982 3300013297 Bacteria 1557
113 Ga0163162_10529959 3300013306 Bacteria 1307
114 Ga0163162_10578493 3300013306 Bacteria 1250
115 Ga0163162_10626460 3300013306 Bacteria 1200
116 Ga0157372_10119472 3300013307 Unclassified 3026
117 Ga0157372_10227078 3300013307 Bacteria 2164
118 Ga0157372_10917189 3300013307 Bacteria 1016
119 Ga0157375_10144864 3300013308 Bacteria 2505
120 Ga0157375_10938999 3300013308 Unclassified 1007
121 Ga0163163_10799131 3300014325 Unclassified 1007
122 Ga0163163_11257036 3300014325 Bacteria 803
123 Ga0163163_11493505 3300014325 Unclassified 737
124 Ga0157377_10484821 3300014745 Bacteria 861
125 Ga0157376_10108445 3300014969 Bacteria 2439
126 Ga0157376_10207856 3300014969 Bacteria 1805
127 Ga0163161_10301663 3300017792 Bacteria 1262
128 Ga0224712_10175420 3300022467 Unclassified 963
129 Ga0224712_10490394 3300022467 Unclassified 593
130 Ga0207680_10296343 3300025903 Bacteria 1126
131 Ga0207699_10312610 3300025906 Unclassified 1100
132 Ga0207699_10367737 3300025906 Bacteria 1018
133 Ga0207705_10287165 3300025909 Unclassified 1260
134 Ga0207684_10289641 3300025910 Bacteria 1412
135 Ga0207654_10445401 3300025911 Unclassified 907
136 Ga0207707_10226536 3300025912 Unclassified 1627
137 Ga0207695_10001788 3300025913 Bacteria 33918
138 Ga0207695_10005757 3300025913 Bacteria 16315
139 Ga0207695_10153464 3300025913 Bacteria 2240
140 Ga0207695_10214068 3300025913 Unclassified 1836
141 Ga0207671_10095154 3300025914 Unclassified 2249
142 Ga0207671_10799507 3300025914 Unclassified 748
143 Ga0207663_10843053 3300025916 Bacteria 731
144 Ga0207660_10036012 3300025917 Bacteria 3438
145 Ga0207660_10192798 3300025917 Bacteria 1588
146 Ga0207660_10305786 3300025917 Bacteria 1267
147 Ga0207657_10320696 3300025919 Unclassified 1225
148 Ga0207657_10849449 3300025919 Bacteria 704
149 Ga0207652_10179184 3300025921 Bacteria 1904
150 Ga0207652_10335257 3300025921 Unclassified 1366
151 Ga0207652_10710569 3300025921 Bacteria 896
152 Ga0207694_10107506 3300025924 Bacteria 2216
153 Ga0207694_11079926 3300025924 Bacteria 679
154 Ga0207650_10758611 3300025925 Unclassified 821
155 Ga0207700_10017482 3300025928 Bacteria 4791
156 Ga0207700_10325836 3300025928 Unclassified 1332
157 Ga0207700_11079588 3300025928 Unclassified 718
158 Ga0207664_10834816 3300025929 Bacteria 828
159 Ga0207644_10510103 3300025931 Bacteria 993
160 Ga0207711_10050821 3300025941 Bacteria 3549
161 Ga0207711_10073197 3300025941 Bacteria 2978
162 Ga0207661_10000144 3300025944 Bacteria 45140
163 Ga0207661_11402579 3300025944 Unclassified 641
164 Ga0207679_11921801 3300025945 Unclassified 539
165 Ga0207667_10190705 3300025949 Unclassified 2103
166 Ga0207667_10288383 3300025949 Unclassified 1677
167 Ga0207667_10579725 3300025949 Bacteria 1132
168 Ga0207667_10955333 3300025949 Unclassified 846
169 Ga0207703_10047630 3300026035 Bacteria 3457
170 Ga0207702_10003732 3300026078 Bacteria 13765
171 Ga0207702_10221410 3300026078 Unclassified 1764
172 Ga0207641_10058940 3300026088 Unclassified 3269
173 Ga0207641_10114592 3300026088 Bacteria 2395
174 Ga0207648_11611954 3300026089 Bacteria 610
175 Ga0207676_10213767 3300026095 Unclassified 1713
176 Ga0207676_10525271 3300026095 Bacteria 1127
177 Ga0207683_10051247 3300026121 Bacteria 3616
178 Ga0207683_10152826 3300026121 Unclassified 2084
179 Ga0207698_10240535 3300026142 Unclassified 1649
180 Ga0207698_11860402 3300026142 Unclassified 617
181 Ga0268266_10210654 3300028379 Unclassified 1782
182 Ga0268264_10650471 3300028381 Unclassified 1043
183 Ga0268264_10971611 3300028381 Bacteria 855
184 Ga0265338_10335971 3300028800 Bacteria 1090
185 Ga0265330_10140449 3300031235 Bacteria 1027
186 Ga0265325_10106718 3300031241 Bacteria 1365
187 Ga0265331_10063018 3300031250 Bacteria 1748
188 Ga0265331_10288031 3300031250 Bacteria 736
189 Ga0265316_10014035 3300031344 Bacteria 7076
190 Ga0265316_10061264 3300031344 Bacteria 2923
191 Ga0265316_10065937 3300031344 Bacteria 2803
192 Ga0265316_10279186 3300031344 Bacteria 1221
193 Ga0265316_10437084 3300031344 Bacteria 939
194 Ga0265314_10014627 3300031711 Bacteria 6266
195 Ga0265342_10045498 3300031712 Bacteria 2642
196 Ga0373926_0155081 3300035083 Unclassified 873
197 Ga0373923_0385008 3300035111 Bacteria 673
198 Ga0373936_0163482 3300035113 Unclassified 971
199 Ga0373954_0031992 3300035118 Bacteria 2431
200 Ga0373957_0036877 3300035120 Bacteria 1824
201 Ga0373957_0295157 3300035120 Unclassified 687
202 Ga0373943_0313345 3300035170 Unclassified 893
203 Ga0373931_0381276 3300035691 Bacteria 889
204 Ga0373935_0162142 3300035692 Bacteria 1525
205 Ga0373927_0001128 3300035695 Bacteria 20226
206 Ga0373927_0233665 3300035695 Bacteria 1208
207 Ga0373927_0359883 3300035695 Unclassified 959
208 Ga0373927_0414474 3300035695 Bacteria 889
209 Ga0373933_0082758 3300035724 Bacteria 1970
210 Ga0373933_0241465 3300035724 Bacteria 1162
211 Ga0373933_0592307 3300035724 Bacteria 728
212 Ga0373947_0070733 3300035725 Unclassified 2139
213 Ga0373947_0185023 3300035725 Bacteria 1358
214 Ga0373947_0259600 3300035725 Unclassified 1151
215 Ga0373937_0177258 3300036401 Bacteria 2001
216 Ga0373937_0797459 3300036401 Bacteria 892
217 Ga0373937_0982103 3300036401 Unclassified 793
218 Ga0373925_0040599 3300037068 Bacteria 3446
219 Ga0373925_0178801 3300037068 Bacteria 1678
220 Ga0373925_0263388 3300037068 Unclassified 1385
221 Ga0373925_0399045 3300037068 Bacteria 1122
222 Ga0373925_0551266 3300037068 Bacteria 948
223 Ga0395899_0291988 3300037312 Bacteria 1106
224 Ga0395898_0597575 3300037466 Bacteria 1046
225 Ga0436364_0890364 3300037853 Unclassified 736
226 Ga0436364_1107523 3300037853 Unclassified 615
227 Ga0436360_0098055 3300039438 Unclassified 599
228 Ga0451576_0281494 3300045051 Bacteria 1739
229 Ga0451576_1013299 3300045051 Unclassified 870
230 Ga0466967_0015851 3300045976 Bacteria 5924
231 Ga0495592_0030942 3300046454 Bacteria 4048
232 Ga0495651_0011558 3300046462 Bacteria 6782
233 Ga0495651_0311336 3300046462 Bacteria 1053
234 Ga0495653_0108415 3300046463 Bacteria 2000
235 Ga0495653_0663065 3300046463 Unclassified 636
236 Ga0495580_0021766 3300046472 Bacteria 4728
237 Ga0495580_0150226 3300046472 Bacteria 1614
238 Ga0495580_0307553 3300046472 Bacteria 1079
239 Ga0495662_0046740 3300046476 Unclassified 2090
240 Ga0495594_0387173 3300046499 Bacteria 796
241 Ga0495596_0357520 3300046500 Bacteria 569
242 Ga0495608_0071512 3300046511 Bacteria 2263
243 Ga0495618_0054002 3300046514 Bacteria 2541
244 Ga0495628_0018349 3300046516 Bacteria 5797
245 Ga0495628_0800906 3300046516 Unclassified 659
246 Ga0495640_0039230 3300046533 Bacteria 3325
247 Ga0495587_0024654 3300046536 Bacteria 3684
248 Ga0495587_0342853 3300046536 Unclassified 833
249 Ga0495645_0023587 3300046543 Bacteria 4457
250 Ga0495645_0099185 3300046543 Bacteria 2073
251 Ga0495667_0011190 3300046559 Bacteria 6074
252 Ga0495667_0109052 3300046559 Bacteria 1789
253 Ga0495635_0025425 3300046663 Bacteria 4124
254 Ga0495599_0571340 3300046678 Unclassified 660
255 Ga0495623_0083454 3300046679 Bacteria 1973
256 Ga0495669_0225613 3300046684 Bacteria 898
257 Ga0495613_0138254 3300046689 Bacteria 1742
258 Ga0495600_0202859 3300046809 Unclassified 1273
259 Ga0495604_0364328 3300047317 Unclassified 958
260 Ga0495674_0051011 3300047319 Bacteria 3648
261 Ga0495674_0966804 3300047319 Unclassified 654
262 Ga0495680_0095310 3300047322 Bacteria 2225
263 Ga0495675_0111106 3300047444 Bacteria 1711
264 Ga0495675_0325321 3300047444 Unclassified 909
265 Ga0495675_0571918 3300047444 Unclassified 643
266 Ga0495684_0010258 3300047471 Bacteria 7244
267 Ga0495684_0198622 3300047471 Bacteria 1479
268 Ga0495602_0105293 3300048088 Bacteria 2306
269 Ga0496104_1153796 3300048907 Bacteria 678
270 Ga0496109_0667196 3300048912 Unclassified 977
271 Ga0496112_1107927 3300048915 Bacteria 710
272 Ga0496115_0167708 3300048918 Bacteria 1816
273 Ga0496115_0690555 3300048918 Unclassified 803
274 nmdc:mga08y16_114579_c1 3300050511 Bacteria 2806
275 nmdc:mga0a205_1009763_c1 3300050515 Unclassified 679
276 Ga0495601_0182991 3300053077 Bacteria 1370
277 Ga0501082_0000532 3300060353 Bacteria 33889
278 Ga0501082_0593680 3300060353 Bacteria 969
279 Ga0070713_101145080
280 Ga0070683_101190672
281 Ga0070666_10396558
282 Ga0070666_10398640
283 Ga0070680_100010687
284 Ga0070680_100367919
285 Ga0070680_100752781
286 Ga0070660_100348449
287 Ga0070660_101009017
288 Ga0070689_100158076
289 Ga0070661_100311643
290 Ga0070674_100914773
291 Ga0070673_100403424
292 Ga0070688_100239791
293 Ga0070659_100144646
294 Ga0070667_100699650
295 Ga0070667_100806158
296 Ga0070709_10348645
297 Ga0070714_100439324
298 Ga0070714_101381650
299 Ga0070713_100007418
300 Ga0070713_100691575
301 Ga0070713_101376152
302 Ga0070663_100431849
303 Ga0070681_10004213
304 Ga0070681_10225680
305 Ga0070681_10282010
306 Ga0070681_10547360
307 Ga0070706_100201513
308 Ga0070679_100152174
309 Ga0070679_100212455
310 Ga0070679_100253576
311 Ga0070684_100000590
312 Ga0070684_100109451
313 Ga0070696_100005868
314 Ga0070665_101341921
315 Ga0068855_100030512
316 Ga0068855_100073092
317 Ga0068855_100251808
318 Ga0068855_100836220
319 Ga0070664_100137514
320 Ga0068857_101174651
321 Ga0068856_100006931
322 Ga0068856_100246120
323 Ga0068852_100052777
324 Ga0068852_100207671
325 Ga0068852_100269426
326 Ga0068852_101044101
327 Ga0068859_100398788
328 Ga0068859_100866405
329 Ga0068864_100241885
330 Ga0068861_100514553
331 Ga0068863_100127778
332 Ga0068858_100261901
333 Ga0068860_100451065
334 Ga0068860_101258412
335 Ga0070717_10003222
336 Ga0070717_10100383
337 Ga0070712_100809498
338 Ga0097621_100333473
339 Ga0097621_101179679
340 Ga0068871_100331710
341 Ga0075433_11410295
342 Ga0075434_101198406
343 Ga0097620_100398817
344 Ga0097620_100866406
345 Ga0105240_10000274
346 Ga0105240_10297745
347 Ga0105240_10300676
348 Ga0105240_11050269
349 Ga0111539_10712244
350 Ga0105245_10195539
351 Ga0105245_10972892
352 Ga0105247_10532228
353 Ga0105241_10126310
354 Ga0105241_10528941
355 Ga0105241_11388031
356 Ga0105242_10822881
357 Ga0105248_10007347
358 Ga0105248_10103868
359 Ga0105248_10297665
360 Ga0105248_11276146
361 Ga0105248_11929051
362 Ga0105237_10012985
363 Ga0105237_10115448
364 Ga0105237_10297280
365 Ga0105237_10355762
366 Ga0105237_10699839
367 Ga0105237_11933932
368 Ga0105238_10146111
369 Ga0105238_10153305
370 Ga0105238_10188495
371 Ga0105238_10188800
372 Ga0105238_10469348
373 Ga0105238_11125470
374 Ga0105249_10167985
375 Ga0105239_10119922
376 Ga0105239_10192689
377 Ga0105239_10201775
378 Ga0105239_10483532
379 Ga0105239_10809527
380 Ga0105246_10242441
381 Ga0157371_10622720
382 Ga0157370_10004424
383 Ga0157370_10587751
384 Ga0157369_10044393
385 Ga0157369_10078483
386 Ga0157369_10355421
387 Ga0157369_10571469
388 Ga0157374_11227292
389 Ga0157378_10229998
390 Ga0157378_10298982
391 Ga0163162_10529959
392 Ga0163162_10578493
393 Ga0163162_10626460
394 Ga0157372_10119472
395 Ga0157372_10227078
396 Ga0157372_10917189
397 Ga0157375_10144864
398 Ga0157375_10938999
399 Ga0163163_10799131
400 Ga0163163_11257036
401 Ga0163163_11493505
402 Ga0157377_10484821
403 Ga0157376_10108445
404 Ga0157376_10207856
405 Ga0163161_10301663
406 Ga0224712_10175420
407 Ga0224712_10490394
408 Ga0207680_10296343
409 Ga0207699_10312610
410 Ga0207699_10367737
411 Ga0207705_10287165
412 Ga0207684_10289641
413 Ga0207654_10445401
414 Ga0207707_10226536
415 Ga0207695_10001788
416 Ga0207695_10005757
417 Ga0207695_10153464
418 Ga0207695_10214068
419 Ga0207671_10095154
420 Ga0207671_10799507
421 Ga0207663_10843053
422 Ga0207660_10036012
423 Ga0207660_10192798
424 Ga0207660_10305786
425 Ga0207657_10320696
426 Ga0207657_10849449
427 Ga0207652_10179184
428 Ga0207652_10335257
429 Ga0207652_10710569
430 Ga0207694_10107506
431 Ga0207694_11079926
432 Ga0207650_10758611
433 Ga0207700_10017482
434 Ga0207700_10325836
435 Ga0207700_11079588
436 Ga0207664_10834816
437 Ga0207644_10510103
438 Ga0207711_10050821
439 Ga0207711_10073197
440 Ga0207661_10000144
441 Ga0207661_11402579
442 Ga0207679_11921801
443 Ga0207667_10190705
444 Ga0207667_10288383
445 Ga0207667_10579725
446 Ga0207667_10955333
447 Ga0207703_10047630
448 Ga0207702_10003732
449 Ga0207702_10221410
450 Ga0207641_10058940
451 Ga0207641_10114592
452 Ga0207648_11611954
453 Ga0207676_10213767
454 Ga0207676_10525271
455 Ga0207683_10051247
456 Ga0207683_10152826
457 Ga0207698_10240535
458 Ga0207698_11860402
459 Ga0268266_10210654
460 Ga0268264_10650471
461 Ga0268264_10971611
462 Ga0265338_10335971
463 Ga0265330_10140449
464 Ga0265325_10106718
465 Ga0265331_10063018
466 Ga0265331_10288031
467 Ga0265316_10014035
468 Ga0265316_10061264
469 Ga0265316_10065937
470 Ga0265316_10279186
471 Ga0265316_10437084
472 Ga0265314_10014627
473 Ga0265342_10045498
474 Ga0373926_0155081
475 Ga0373923_0385008
476 Ga0373936_0163482
477 Ga0373954_0031992
478 Ga0373957_0036877
479 Ga0373957_0295157
480 Ga0373943_0313345
481 Ga0373931_0381276
482 Ga0373935_0162142
483 Ga0373927_0001128
484 Ga0373927_0233665
485 Ga0373927_0359883
486 Ga0373927_0414474
487 Ga0373933_0082758
488 Ga0373933_0241465
489 Ga0373933_0592307
490 Ga0373947_0070733
491 Ga0373947_0185023
492 Ga0373947_0259600
493 Ga0373937_0177258
494 Ga0373937_0797459
495 Ga0373937_0982103
496 Ga0373925_0040599
497 Ga0373925_0178801
498 Ga0373925_0263388
499 Ga0373925_0399045
500 Ga0373925_0551266
501 Ga0395899_0291988
502 Ga0395898_0597575
503 Ga0436364_0890364
504 Ga0436364_1107523
505 Ga0436360_0098055
506 Ga0451576_0281494
507 Ga0451576_1013299
508 Ga0466967_0015851
509 Ga0495592_0030942
510 Ga0495651_0011558
511 Ga0495651_0311336
512 Ga0495653_0108415
513 Ga0495653_0663065
514 Ga0495580_0021766
515 Ga0495580_0150226
516 Ga0495580_0307553
517 Ga0495662_0046740
518 Ga0495594_0387173
519 Ga0495596_0357520
520 Ga0495608_0071512
521 Ga0495618_0054002
522 Ga0495628_0018349
523 Ga0495628_0800906
524 Ga0495640_0039230
525 Ga0495587_0024654
526 Ga0495587_0342853
527 Ga0495645_0023587
528 Ga0495645_0099185
529 Ga0495667_0011190
530 Ga0495667_0109052
531 Ga0495635_0025425
532 Ga0495599_0571340
533 Ga0495623_0083454
534 Ga0495669_0225613
535 Ga0495613_0138254
536 Ga0495600_0202859
537 Ga0495604_0364328
538 Ga0495674_0051011
539 Ga0495674_0966804
540 Ga0495680_0095310
541 Ga0495675_0111106
542 Ga0495675_0325321
543 Ga0495675_0571918
544 Ga0495684_0010258
545 Ga0495684_0198622
546 Ga0495602_0105293
547 Ga0496104_1153796
548 Ga0496109_0667196
549 Ga0496112_1107927
550 Ga0496115_0167708
551 Ga0496115_0690555
552 nmdc:mga08y16_114579_c1
553 nmdc:mga0a205_1009763_c1
554 Ga0495601_0182991
555 Ga0501082_0000532
556 Ga0501082_0593680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fyh-assembly1.cif.gz_B 1:1 complex between an interferon gamma single-chain variant and its receptor 0.6287 29 47
6w80-assembly1.cif.gz_A-2 crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from stenotrophomonas maltophilia k279a in complex with plp 0.6065 18 51
4zm3-assembly1.cif.gz_A crystal structure of plp-dependent 3-aminobenzoate synthase pctv wild-type 0.6037 19 49
4zm3-assembly1.cif.gz_B crystal structure of plp-dependent 3-aminobenzoate synthase pctv wild-type 0.6024 19 46
5i92-assembly3.cif.gz_F crystal structure of glutamate-1-semialdehyde 2,1- aminomutase (gsa) from pseudomonas aeruginosa 0.5967 18 50
ID Description Score Start End Superfamily
af_I1LRE9_81_351_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7159 27 47 3.40.50.150
af_K7VAH5_1_253_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6803 31 51 2.130.10.10
5vehB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.6492 18 43 3.90.1150.10
af_Q8SXC2_335_450_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.6482 18 43 3.90.1150.10
af_Q54KM6_325_434_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.6228 18 44 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A6L8HQZ7-F1-model_v4 deleted 0.74 1 158
AF-A0A2V8V9K9-F1-model_v4 Uncharacterized protein 0.7375 1 162
AF-A0A2V8V9K9-F1-model_v4 Uncharacterized protein 0.7334 1 162
AF-A0A6L8HQZ7-F1-model_v4 deleted 0.697 1 158
AF-A0A6I0IEC5-F1-model_v4 Phage protein 0.6685 19 46

Map