F381665

General Info

Members Datasets Scaffolds Average Seq Length
277 168 277 153

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100915498|Ga0070696_1009154982
Length 163
Sequence MSAGTQARRAAGAALVILALALPFAAAGLAGAQEPGAAAQVPATLYRRLGGYDSLAVLTDDFIGRLVRDPALARHFAAATAESRDRMRQHLLDQLCAASGGPCLYVGRDMKTAHRGLGIRESDWAATVGHLIASLDRRGLAQKEKDEILAIVAGLKRNIVEKP

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
159 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
160 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 2.53
Rhizosphere 96.03
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10014034 3300003203 Bacteria 3416
2 rootH2_10200480 3300003320 Unclassified 1359
3 Ga0070658_10090727 3300005327 Bacteria 2518
4 Ga0070676_10014990 3300005328 Unclassified 4268
5 Ga0070683_100767665 3300005329 Bacteria 924
6 Ga0070683_101975261 3300005329 Unclassified 560
7 Ga0070690_101247646 3300005330 Unclassified 594
8 Ga0070677_10057354 3300005333 Viruses 1596
9 Ga0070677_10093230 3300005333 Bacteria 1314
10 Ga0068869_100095604 3300005334 Bacteria 2242
11 Ga0070680_100026084 3300005336 Bacteria 4674
12 Ga0070680_100032548 3300005336 Unclassified 4197
13 Ga0070680_100146727 3300005336 Bacteria 1980
14 Ga0070680_100396861 3300005336 Bacteria 1175
15 Ga0070680_101445475 3300005336 Unclassified 595
16 Ga0070682_100074394 3300005337 Bacteria 2182
17 Ga0068868_100155881 3300005338 Unclassified 1883
18 Ga0070660_100010575 3300005339 Bacteria 6521
19 Ga0070689_100752012 3300005340 Unclassified 854
20 Ga0070691_10065294 3300005341 Bacteria 1757
21 Ga0070691_10490999 3300005341 Unclassified 708
22 Ga0070687_100318115 3300005343 Unclassified 993
23 Ga0070687_100702171 3300005343 Bacteria 707
24 Ga0070692_10137426 3300005345 Bacteria 1380
25 Ga0070692_10193248 3300005345 Bacteria 1187
26 Ga0070668_100370233 3300005347 Bacteria 1217
27 Ga0070669_100063811 3300005353 Viruses 2711
28 Ga0070669_100332411 3300005353 Unclassified 1229
29 Ga0070669_100452692 3300005353 Bacteria 1058
30 Ga0070675_100119747 3300005354 Unclassified 2236
31 Ga0070671_100132935 3300005355 Bacteria 2096
32 Ga0070674_100695221 3300005356 Bacteria 869
33 Ga0070659_101511820 3300005366 Unclassified 598
34 Ga0070667_100812934 3300005367 Unclassified 868
35 Ga0070703_10079709 3300005406 Bacteria 1112
36 Ga0070703_10278970 3300005406 Unclassified 689
37 Ga0070705_100190676 3300005440 Bacteria 1397
38 Ga0070705_100687771 3300005440 Unclassified 802
39 Ga0070700_100002407 3300005441 Bacteria 9539
40 Ga0070694_100038585 3300005444 Bacteria 3175
41 Ga0070694_100050868 3300005444 Unclassified 2795
42 Ga0070694_100112805 3300005444 Unclassified 1939
43 Ga0070708_101579010 3300005445 Bacteria 611
44 Ga0070678_100122739 3300005456 Bacteria 2051
45 Ga0070678_101316893 3300005456 Unclassified 672
46 Ga0070662_100044623 3300005457 Bacteria 3176
47 Ga0070662_100147886 3300005457 Bacteria 1826
48 Ga0070681_10052610 3300005458 Bacteria 4062
49 Ga0070681_10069526 3300005458 Unclassified 3487
50 Ga0070681_10222953 3300005458 Bacteria 1800
51 Ga0070681_10247311 3300005458 Bacteria 1696
52 Ga0068867_100103134 3300005459 Unclassified 2181
53 Ga0068867_101058938 3300005459 Unclassified 738
54 Ga0070706_100574793 3300005467 Unclassified 1048
55 Ga0070707_101209895 3300005468 Bacteria 722
56 Ga0070698_100018678 3300005471 Bacteria 7298
57 Ga0070698_100147285 3300005471 Bacteria 2303
58 Ga0070698_100595351 3300005471 Bacteria 1046
59 Ga0070699_100001157 3300005518 Bacteria 24482
60 Ga0070679_100055858 3300005530 Bacteria 3933
61 Ga0070679_101445818 3300005530 Unclassified 634
62 Ga0070697_100146313 3300005536 Unclassified 1989
63 Ga0068853_100030207 3300005539 Unclassified 4576
64 Ga0068853_100407426 3300005539 Bacteria 1273
65 Ga0068853_100557674 3300005539 Bacteria 1086
66 Ga0070672_100055678 3300005543 Bacteria 3099
67 Ga0070686_100137525 3300005544 Bacteria 1697
68 Ga0070695_100019052 3300005545 Bacteria 4173
69 Ga0070696_100025563 3300005546 Bacteria 4016
70 Ga0070696_100373963 3300005546 Bacteria 1109
71 Ga0070696_100717394 3300005546 Bacteria 816
72 Ga0070696_100915498 3300005546 Bacteria 728
73 Ga0070693_100123981 3300005547 Bacteria 1606
74 Ga0070665_100473835 3300005548 Bacteria 1263
75 Ga0070704_100126233 3300005549 Bacteria 1975
76 Ga0070704_100144851 3300005549 Unclassified 1860
77 Ga0070704_100275334 3300005549 Bacteria 1392
78 Ga0070704_100504781 3300005549 Unclassified 1050
79 Ga0068855_100026177 3300005563 Bacteria 6978
80 Ga0068854_100286227 3300005578 Bacteria 1329
81 Ga0068854_100620227 3300005578 Unclassified 925
82 Ga0068854_101783496 3300005578 Unclassified 564
83 Ga0068852_100036556 3300005616 Unclassified 4111
84 Ga0068852_100057947 3300005616 Viruses 3353
85 Ga0068859_100393195 3300005617 Unclassified 1482
86 Ga0068859_100603456 3300005617 Bacteria 1191
87 Ga0068859_100704430 3300005617 Unclassified 1100
88 Ga0068864_100000008 3300005618 Bacteria 390035
89 Ga0068864_101204537 3300005618 Bacteria 756
90 Ga0068866_11058263 3300005718 Unclassified 579
91 Ga0068861_100041204 3300005719 Bacteria 3458
92 Ga0068861_101368873 3300005719 Bacteria 690
93 Ga0068870_10049177 3300005840 Bacteria 2223
94 Ga0068870_10317992 3300005840 Unclassified 988
95 Ga0068870_10519087 3300005840 Unclassified 797
96 Ga0068863_100467501 3300005841 Bacteria 1239
97 Ga0068858_100097733 3300005842 Bacteria 2737
98 Ga0068858_100234867 3300005842 Bacteria 1739
99 Ga0068860_100123669 3300005843 Unclassified 2479
100 Ga0068860_101618901 3300005843 Unclassified 669
101 Ga0068862_100016526 3300005844 Bacteria 6143
102 Ga0068862_100259578 3300005844 Bacteria 1586
103 Ga0068862_100465446 3300005844 Bacteria 1194
104 Ga0081539_10000318 3300005985 Bacteria 107294
105 Ga0070717_10136376 3300006028 Unclassified 2114
106 Ga0070716_100018846 3300006173 Bacteria 3599
107 Ga0070716_100240178 3300006173 Unclassified 1228
108 Ga0097621_100131121 3300006237 Bacteria 2134
109 Ga0075428_100160276 3300006844 Bacteria 2442
110 Ga0075433_10007337 3300006852 Bacteria 8749
111 Ga0075433_10169548 3300006852 Bacteria 1943
112 Ga0075433_10513802 3300006852 Bacteria 1054
113 Ga0075434_100001699 3300006871 Bacteria 18839
114 Ga0075434_100053176 3300006871 Unclassified 4024
115 Ga0075434_100149542 3300006871 Unclassified 2355
116 Ga0075434_100593028 3300006871 Unclassified 1127
117 Ga0075434_100961303 3300006871 Bacteria 868
118 Ga0075429_100152996 3300006880 Bacteria 2020
119 Ga0075429_100511460 3300006880 Bacteria 1052
120 Ga0068865_100072589 3300006881 Bacteria 2445
121 Ga0075436_100158120 3300006914 Unclassified 1597
122 Ga0097620_100393199 3300006931 Unclassified 1482
123 Ga0097620_100603466 3300006931 Bacteria 1191
124 Ga0097620_100704362 3300006931 Unclassified 1100
125 Ga0075435_100070598 3300007076 Unclassified 2851
126 Ga0075435_100781926 3300007076 Unclassified 831
127 Ga0105240_10092048 3300009093 Bacteria 3703
128 Ga0105240_10311039 3300009093 Bacteria 1799
129 Ga0111539_10993657 3300009094 Unclassified 976
130 Ga0114129_10144384 3300009147 Unclassified 3260
131 Ga0114129_10201796 3300009147 Bacteria 2693
132 Ga0114129_10687982 3300009147 Unclassified 1316
133 Ga0114129_12604593 3300009147 Unclassified 603
134 Ga0105243_10062457 3300009148 Bacteria 2982
135 Ga0105241_10039408 3300009174 Bacteria 3564
136 Ga0105242_10030113 3300009176 Bacteria 4333
137 Ga0105242_10502858 3300009176 Bacteria 1153
138 Ga0105237_10067012 3300009545 Bacteria 3584
139 Ga0105237_10081062 3300009545 Bacteria 3235
140 Ga0105249_11657435 3300009553 Unclassified 712
141 Ga0105239_10014210 3300010375 Bacteria 8836
142 Ga0105239_10861364 3300010375 Unclassified 1039
143 Ga0105246_10141611 3300011119 Unclassified 1809
144 Ga0105246_11921457 3300011119 Unclassified 569
145 Ga0157370_10368406 3300013104 Bacteria 1324
146 Ga0157369_10076901 3300013105 Bacteria 3578
147 Ga0157378_10012434 3300013297 Bacteria 7454
148 Ga0157378_10809022 3300013297 Unclassified 963
149 Ga0157378_11018901 3300013297 Unclassified 863
150 Ga0163162_10225486 3300013306 Bacteria 2004
151 Ga0163162_10228672 3300013306 Unclassified 1990
152 Ga0163162_10888379 3300013306 Unclassified 1005
153 Ga0157372_10069846 3300013307 Bacteria 3951
154 Ga0157372_10368650 3300013307 Bacteria 1673
155 Ga0157375_10016566 3300013308 Bacteria 6626
156 Ga0157375_10080849 3300013308 Unclassified 3289
157 Ga0157380_10014429 3300014326 Bacteria 5779
158 Ga0157380_10030390 3300014326 Bacteria 4137
159 Ga0182008_10287084 3300014497 Unclassified 858
160 Ga0157377_10066010 3300014745 Bacteria 2080
161 Ga0157377_10072228 3300014745 Bacteria 1997
162 Ga0157376_10541151 3300014969 Bacteria 1151
163 Ga0157376_12717228 3300014969 Unclassified 535
164 Ga0163161_10000303 3300017792 Bacteria 42868
165 Ga0207697_10040660 3300025315 Bacteria 1909
166 Ga0207653_10073900 3300025885 Bacteria 1169
167 Ga0207682_10045879 3300025893 Bacteria 1795
168 Ga0207688_10112476 3300025901 Bacteria 1582
169 Ga0207647_10338723 3300025904 Unclassified 853
170 Ga0207699_10526832 3300025906 Bacteria 855
171 Ga0207645_10003190 3300025907 Bacteria 12548
172 Ga0207645_10131076 3300025907 Bacteria 1632
173 Ga0207643_10313905 3300025908 Unclassified 978
174 Ga0207705_10337251 3300025909 Bacteria 1160
175 Ga0207707_10020973 3300025912 Bacteria 5707
176 Ga0207707_10051051 3300025912 Unclassified 3601
177 Ga0207707_10071555 3300025912 Unclassified 3022
178 Ga0207707_10217332 3300025912 Bacteria 1664
179 Ga0207695_10289677 3300025913 Unclassified 1530
180 Ga0207695_10647375 3300025913 Bacteria 938
181 Ga0207671_10017454 3300025914 Bacteria 5532
182 Ga0207671_10152417 3300025914 Bacteria 1786
183 Ga0207660_10028387 3300025917 Bacteria 3826
184 Ga0207660_10045943 3300025917 Bacteria 3079
185 Ga0207660_10066060 3300025917 Bacteria 2616
186 Ga0207660_10335424 3300025917 Bacteria 1210
187 Ga0207662_10598463 3300025918 Bacteria 767
188 Ga0207657_10038181 3300025919 Unclassified 4279
189 Ga0207652_10251226 3300025921 Unclassified 1595
190 Ga0207646_10271520 3300025922 Bacteria 1533
191 Ga0207681_10710399 3300025923 Unclassified 836
192 Ga0207681_11054217 3300025923 Bacteria 682
193 Ga0207659_10649101 3300025926 Bacteria 902
194 Ga0207664_10304269 3300025929 Bacteria 1403
195 Ga0207644_10849789 3300025931 Bacteria 764
196 Ga0207690_10041350 3300025932 Bacteria 3020
197 Ga0207706_10032500 3300025933 Unclassified 4647
198 Ga0207706_10033176 3300025933 Unclassified 4596
199 Ga0207686_10000420 3300025934 Bacteria 28967
200 Ga0207686_10487046 3300025934 Bacteria 955
201 Ga0207686_10946240 3300025934 Unclassified 697
202 Ga0207709_11117819 3300025935 Unclassified 647
203 Ga0207704_10143211 3300025938 Bacteria 1675
204 Ga0207691_10042409 3300025940 Unclassified 4195
205 Ga0207689_10006848 3300025942 Bacteria 10024
206 Ga0207689_10702875 3300025942 Unclassified 852
207 Ga0207661_10734138 3300025944 Bacteria 909
208 Ga0207679_11121631 3300025945 Unclassified 722
209 Ga0207667_10469143 3300025949 Bacteria 1278
210 Ga0207712_10207122 3300025961 Bacteria 1559
211 Ga0207668_10186344 3300025972 Bacteria 1641
212 Ga0207668_10187185 3300025972 Bacteria 1638
213 Ga0207640_10127117 3300025981 Bacteria 1837
214 Ga0207640_10131886 3300025981 Unclassified 1808
215 Ga0207640_10273121 3300025981 Bacteria 1323
216 Ga0207658_10432400 3300025986 Bacteria 1163
217 Ga0207658_11177977 3300025986 Unclassified 700
218 Ga0207677_10102584 3300026023 Unclassified 2110
219 Ga0207703_10040634 3300026035 Bacteria 3723
220 Ga0207703_10119898 3300026035 Unclassified 2257
221 Ga0207639_10028980 3300026041 Bacteria 4048
222 Ga0207639_10232718 3300026041 Bacteria 1598
223 Ga0207639_10457972 3300026041 Bacteria 1159
224 Ga0207708_10017385 3300026075 Bacteria 5413
225 Ga0207708_11392662 3300026075 Unclassified 615
226 Ga0207702_10317679 3300026078 Bacteria 1482
227 Ga0207641_10343514 3300026088 Bacteria 1421
228 Ga0207648_10178241 3300026089 Bacteria 1880
229 Ga0207676_10000011 3300026095 Bacteria 382648
230 Ga0207675_100092876 3300026118 Bacteria 2838
231 Ga0207683_10038831 3300026121 Unclassified 4152
232 Ga0207683_10701143 3300026121 Bacteria 938
233 Ga0207428_10245627 3300027907 Unclassified 1336
234 Ga0207428_10501320 3300027907 Unclassified 882
235 Ga0268265_10290263 3300028380 Bacteria 1468
236 Ga0268264_10227954 3300028381 Bacteria 1719
237 Ga0307405_10337314 3300031731 Bacteria 1158
238 Ga0307406_10021763 3300031901 Bacteria 3797
239 Ga0307406_10486606 3300031901 Bacteria 998
240 Ga0373944_0183301 3300035089 Unclassified 752
241 Ga0373937_0019205 3300036401 Bacteria 6119
242 Ga0242422_05629 3300038699 Unclassified 762
243 Ga0436365_0793666 3300039437 Bacteria 13342
244 Ga0436363_1209927 3300039450 Bacteria 689
245 Ga0439433_0115685 3300041999 Bacteria 673
246 Ga0439449_0415534 3300042007 Unclassified 511
247 Ga0453683_0028412 3300044673 Bacteria 3543
248 Ga0453683_0056555 3300044673 Bacteria 2455
249 Ga0466957_0000449 3300044842 Bacteria 20328
250 Ga0451576_0075138 3300045051 Bacteria 3516
251 Ga0451576_1159834 3300045051 Bacteria 807
252 Ga0496104_0774338 3300048907 Unclassified 866
253 Ga0496106_0796892 3300048909 Unclassified 749
254 Ga0496108_0284173 3300048911 Bacteria 1440
255 Ga0496109_0142497 3300048912 Bacteria 2242
256 Ga0496112_0100511 3300048915 Bacteria 2862
257 Ga0496112_0116401 3300048915 Bacteria 2644
258 Ga0496113_0128184 3300048916 Bacteria 1989
259 Ga0501293_028552 3300049516 Unclassified 586
260 Ga0501243_039762 3300049675 Unclassified 824
261 Ga0501273_013196 3300049770 Bacteria 1051
262 nmdc:mga05p37_213732_c1 3300050507 Unclassified 2330
263 nmdc:mga05p37_32459_c1 3300050507 Bacteria 6385
264 nmdc:mga05p37_610068_c1 3300050507 Bacteria 1230
265 nmdc:mga05p37_85996_c1 3300050507 Bacteria 3875
266 nmdc:mga08y16_601230_c1 3300050511 Unclassified 1109
267 nmdc:mga0n895_211007_c1 3300050512 Bacteria 1972
268 nmdc:mga0n895_237650_c1 3300050512 Unclassified 1849
269 nmdc:mga0n895_676775_c1 3300050512 Unclassified 1029
270 nmdc:mga0rr50_263259_c1 3300050513 Unclassified 1435
271 nmdc:mga0rr50_342459_c1 3300050513 Bacteria 1256
272 nmdc:mga0rr50_358453_c1 3300050513 Unclassified 1227
273 nmdc:mga08x19_164030_c1 3300050514 Bacteria 1510
274 nmdc:mga0a205_14170_c1 3300050515 Bacteria 7436
275 nmdc:mga0a205_30569_c1 3300050515 Bacteria 5158
276 Ga0500568_0103487 3300053139 Bacteria 1067
277 Ga0501084_0493442 3300054114 Bacteria 1035

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_101579010 Ga0070708_1015790101 130
2 3300006852 Ga0075433_10007337 Ga0075433_1000733711 132
3 3300006871 Ga0075434_100001699 Ga0075434_10000169911 132
4 3300050513 nmdc:mga0rr50_358453_c1 nmdc:mga0rr50_358453_c1_749_1201 132
5 3300050515 nmdc:mga0a205_14170_c1 nmdc:mga0a205_14170_c1_2146_2598 132
6 3300009147 Ga0114129_10144384 Ga0114129_101443842 134
7 3300050507 nmdc:mga05p37_32459_c1 nmdc:mga05p37_32459_c1_5839_6273 134
8 3300050507 nmdc:mga05p37_610068_c1 nmdc:mga05p37_610068_c1_766_1203 134
9 3300050511 nmdc:mga08y16_601230_c1 nmdc:mga08y16_601230_c1_319_756 134
10 3300050515 nmdc:mga0a205_30569_c1 nmdc:mga0a205_30569_c1_3013_3447 134
11 3300009176 Ga0105242_10502858 Ga0105242_105028582 135
12 3300025934 Ga0207686_10946240 Ga0207686_109462401 135
13 3300031731 Ga0307405_10337314 Ga0307405_103373142 135
14 3300005840 Ga0068870_10317992 Ga0068870_103179922 137
15 3300025908 Ga0207643_10313905 Ga0207643_103139052 137
16 3300036401 Ga0373937_0019205 Ga0373937_0019205_2738_3202 138
17 3300005336 Ga0070680_100026084 Ga0070680_1000260842 139
18 3300006852 Ga0075433_10513802 Ga0075433_105138021 139
19 3300006871 Ga0075434_100593028 Ga0075434_1005930282 139
20 3300006880 Ga0075429_100511460 Ga0075429_1005114602 139
21 3300009147 Ga0114129_10201796 Ga0114129_102017961 139
22 3300009176 Ga0105242_10030113 Ga0105242_100301135 139
23 3300025934 Ga0207686_10000420 Ga0207686_1000042010 139
24 3300026118 Ga0207675_100092876 Ga0207675_1000928762 139
25 3300045051 Ga0451576_0075138 Ga0451576_0075138_1876_2358 139
26 3300050507 nmdc:mga05p37_85996_c1 nmdc:mga05p37_85996_c1_1210_1650 139
27 3300050512 nmdc:mga0n895_676775_c1 nmdc:mga0n895_676775_c1_352_795 139
28 3300054114 Ga0501084_0493442 Ga0501084_0493442_373_801 139
29 3300005329 Ga0070683_100767665 Ga0070683_1007676652 140
30 3300005329 Ga0070683_101975261 Ga0070683_1019752611 140
31 3300005330 Ga0070690_101247646 Ga0070690_1012476461 140
32 3300005336 Ga0070680_100146727 Ga0070680_1001467273 140
33 3300005336 Ga0070680_101445475 Ga0070680_1014454751 140
34 3300005343 Ga0070687_100318115 Ga0070687_1003181151 140
35 3300005353 Ga0070669_100332411 Ga0070669_1003324112 140
36 3300005355 Ga0070671_100132935 Ga0070671_1001329352 140
37 3300005458 Ga0070681_10247311 Ga0070681_102473111 140
38 3300005530 Ga0070679_100055858 Ga0070679_1000558583 140
39 3300005539 Ga0068853_100030207 Ga0068853_1000302072 140
40 3300005546 Ga0070696_100717394 Ga0070696_1007173942 140
41 3300005616 Ga0068852_100036556 Ga0068852_1000365563 140
42 3300005617 Ga0068859_100393195 Ga0068859_1003931952 140
43 3300005617 Ga0068859_100704430 Ga0068859_1007044302 140
44 3300005719 Ga0068861_100041204 Ga0068861_1000412043 140
45 3300005719 Ga0068861_101368873 Ga0068861_1013688731 140
46 3300005842 Ga0068858_100097733 Ga0068858_1000977332 140
47 3300005843 Ga0068860_101618901 Ga0068860_1016189011 140
48 3300006931 Ga0097620_100393199 Ga0097620_1003931992 140
49 3300006931 Ga0097620_100704362 Ga0097620_1007043622 140
50 3300009093 Ga0105240_10092048 Ga0105240_100920483 140
51 3300009174 Ga0105241_10039408 Ga0105241_100394082 140
52 3300009545 Ga0105237_10081062 Ga0105237_100810621 140
53 3300010375 Ga0105239_10861364 Ga0105239_108613641 140
54 3300011119 Ga0105246_11921457 Ga0105246_119214572 140
55 3300013104 Ga0157370_10368406 Ga0157370_103684062 140
56 3300013105 Ga0157369_10076901 Ga0157369_100769012 140
57 3300013297 Ga0157378_10809022 Ga0157378_108090222 140
58 3300013306 Ga0163162_10228672 Ga0163162_102286722 140
59 3300013307 Ga0157372_10368650 Ga0157372_103686502 140
60 3300013308 Ga0157375_10016566 Ga0157375_100165663 140
61 3300014969 Ga0157376_12717228 Ga0157376_127172281 140
62 3300017792 Ga0163161_10000303 Ga0163161_100003039 140
63 3300025912 Ga0207707_10020973 Ga0207707_100209732 140
64 3300025913 Ga0207695_10289677 Ga0207695_102896771 140
65 3300025914 Ga0207671_10017454 Ga0207671_100174545 140
66 3300025917 Ga0207660_10028387 Ga0207660_100283875 140
67 3300025921 Ga0207652_10251226 Ga0207652_102512262 140
68 3300025923 Ga0207681_10710399 Ga0207681_107103991 140
69 3300025931 Ga0207644_10849789 Ga0207644_108497891 140
70 3300025944 Ga0207661_10734138 Ga0207661_107341382 140
71 3300025945 Ga0207679_11121631 Ga0207679_111216312 140
72 3300025981 Ga0207640_10127117 Ga0207640_101271171 140
73 3300026035 Ga0207703_10040634 Ga0207703_100406342 140
74 3300026041 Ga0207639_10028980 Ga0207639_100289803 140
75 3300031901 Ga0307406_10021763 Ga0307406_100217634 140
76 3300039450 Ga0436363_1209927 Ga0436363_1209927_87_533 140
77 3300041999 Ga0439433_0115685 Ga0439433_0115685_61_498 140
78 3300042007 Ga0439449_0415534 Ga0439449_0415534_43_501 140
79 3300044673 Ga0453683_0028412 Ga0453683_0028412_383_820 140
80 3300053139 Ga0500568_0103487 Ga0500568_0103487_450_905 140
81 3300003203 JGI25406J46586_10014034 JGI25406J46586_100140344 141
82 3300003320 rootH2_10200480 rootH2_102004802 141
83 3300005327 Ga0070658_10090727 Ga0070658_100907272 141
84 3300005328 Ga0070676_10014990 Ga0070676_100149902 141
85 3300005333 Ga0070677_10057354 Ga0070677_100573542 141
86 3300005333 Ga0070677_10093230 Ga0070677_100932301 141
87 3300005334 Ga0068869_100095604 Ga0068869_1000956042 141
88 3300005336 Ga0070680_100032548 Ga0070680_1000325484 141
89 3300005336 Ga0070680_100396861 Ga0070680_1003968612 141
90 3300005337 Ga0070682_100074394 Ga0070682_1000743942 141
91 3300005338 Ga0068868_100155881 Ga0068868_1001558812 141
92 3300005339 Ga0070660_100010575 Ga0070660_1000105753 141
93 3300005340 Ga0070689_100752012 Ga0070689_1007520121 141
94 3300005341 Ga0070691_10065294 Ga0070691_100652941 141
95 3300005341 Ga0070691_10490999 Ga0070691_104909991 141
96 3300005343 Ga0070687_100702171 Ga0070687_1007021712 141
97 3300005345 Ga0070692_10137426 Ga0070692_101374261 141
98 3300005345 Ga0070692_10193248 Ga0070692_101932482 141
99 3300005347 Ga0070668_100370233 Ga0070668_1003702332 141
100 3300005353 Ga0070669_100063811 Ga0070669_1000638113 141
101 3300005353 Ga0070669_100452692 Ga0070669_1004526922 141
102 3300005354 Ga0070675_100119747 Ga0070675_1001197473 141
103 3300005356 Ga0070674_100695221 Ga0070674_1006952212 141
104 3300005366 Ga0070659_101511820 Ga0070659_1015118201 141
105 3300005367 Ga0070667_100812934 Ga0070667_1008129342 141
106 3300005406 Ga0070703_10079709 Ga0070703_100797092 141
107 3300005406 Ga0070703_10278970 Ga0070703_102789701 141
108 3300005440 Ga0070705_100190676 Ga0070705_1001906762 141
109 3300005440 Ga0070705_100687771 Ga0070705_1006877711 141
110 3300005441 Ga0070700_100002407 Ga0070700_1000024078 141
111 3300005444 Ga0070694_100038585 Ga0070694_1000385854 141
112 3300005444 Ga0070694_100050868 Ga0070694_1000508681 141
113 3300005444 Ga0070694_100112805 Ga0070694_1001128052 141
114 3300005456 Ga0070678_100122739 Ga0070678_1001227392 141
115 3300005456 Ga0070678_101316893 Ga0070678_1013168932 141
116 3300005457 Ga0070662_100044623 Ga0070662_1000446233 141
117 3300005457 Ga0070662_100147886 Ga0070662_1001478863 141
118 3300005458 Ga0070681_10052610 Ga0070681_100526102 141
119 3300005458 Ga0070681_10069526 Ga0070681_100695263 141
120 3300005458 Ga0070681_10222953 Ga0070681_102229532 141
121 3300005459 Ga0068867_100103134 Ga0068867_1001031343 141
122 3300005459 Ga0068867_101058938 Ga0068867_1010589382 141
123 3300005467 Ga0070706_100574793 Ga0070706_1005747932 141
124 3300005468 Ga0070707_101209895 Ga0070707_1012098952 141
125 3300005471 Ga0070698_100018678 Ga0070698_1000186784 141
126 3300005471 Ga0070698_100147285 Ga0070698_1001472852 141
127 3300005471 Ga0070698_100595351 Ga0070698_1005953512 141
128 3300005518 Ga0070699_100001157 Ga0070699_10000115727 141
129 3300005530 Ga0070679_101445818 Ga0070679_1014458182 141
130 3300005536 Ga0070697_100146313 Ga0070697_1001463131 141
131 3300005539 Ga0068853_100407426 Ga0068853_1004074262 141
132 3300005539 Ga0068853_100557674 Ga0068853_1005576742 141
133 3300005543 Ga0070672_100055678 Ga0070672_1000556783 141
134 3300005544 Ga0070686_100137525 Ga0070686_1001375252 141
135 3300005545 Ga0070695_100019052 Ga0070695_1000190524 141
136 3300005546 Ga0070696_100025563 Ga0070696_1000255632 141
137 3300005546 Ga0070696_100373963 Ga0070696_1003739632 141
138 3300005546 Ga0070696_100915498 Ga0070696_1009154982 141
139 3300005547 Ga0070693_100123981 Ga0070693_1001239811 141
140 3300005548 Ga0070665_100473835 Ga0070665_1004738352 141
141 3300005549 Ga0070704_100126233 Ga0070704_1001262333 141
142 3300005549 Ga0070704_100144851 Ga0070704_1001448512 141
143 3300005549 Ga0070704_100275334 Ga0070704_1002753343 141
144 3300005549 Ga0070704_100504781 Ga0070704_1005047812 141
145 3300005563 Ga0068855_100026177 Ga0068855_1000261775 141
146 3300005578 Ga0068854_100286227 Ga0068854_1002862273 141
147 3300005578 Ga0068854_100620227 Ga0068854_1006202272 141
148 3300005578 Ga0068854_101783496 Ga0068854_1017834961 141
149 3300005616 Ga0068852_100057947 Ga0068852_1000579472 141
150 3300005617 Ga0068859_100603456 Ga0068859_1006034562 141
151 3300005618 Ga0068864_100000008 Ga0068864_10000000834 141
152 3300005618 Ga0068864_101204537 Ga0068864_1012045371 141
153 3300005718 Ga0068866_11058263 Ga0068866_110582631 141
154 3300005840 Ga0068870_10049177 Ga0068870_100491774 141
155 3300005840 Ga0068870_10519087 Ga0068870_105190872 141
156 3300005841 Ga0068863_100467501 Ga0068863_1004675013 141
157 3300005842 Ga0068858_100234867 Ga0068858_1002348671 141
158 3300005843 Ga0068860_100123669 Ga0068860_1001236693 141
159 3300005844 Ga0068862_100016526 Ga0068862_1000165267 141
160 3300005844 Ga0068862_100259578 Ga0068862_1002595782 141
161 3300005844 Ga0068862_100465446 Ga0068862_1004654462 141
162 3300005985 Ga0081539_10000318 Ga0081539_1000031849 141
163 3300006028 Ga0070717_10136376 Ga0070717_101363762 141
164 3300006173 Ga0070716_100018846 Ga0070716_1000188464 141
165 3300006173 Ga0070716_100240178 Ga0070716_1002401782 141
166 3300006237 Ga0097621_100131121 Ga0097621_1001311212 141
167 3300006844 Ga0075428_100160276 Ga0075428_1001602762 141
168 3300006852 Ga0075433_10169548 Ga0075433_101695482 141
169 3300006871 Ga0075434_100053176 Ga0075434_1000531763 141
170 3300006871 Ga0075434_100149542 Ga0075434_1001495422 141
171 3300006871 Ga0075434_100961303 Ga0075434_1009613032 141
172 3300006880 Ga0075429_100152996 Ga0075429_1001529962 141
173 3300006881 Ga0068865_100072589 Ga0068865_1000725893 141
174 3300006914 Ga0075436_100158120 Ga0075436_1001581202 141
175 3300006931 Ga0097620_100603466 Ga0097620_1006034662 141
176 3300007076 Ga0075435_100070598 Ga0075435_1000705982 141
177 3300007076 Ga0075435_100781926 Ga0075435_1007819262 141
178 3300009093 Ga0105240_10311039 Ga0105240_103110392 141
179 3300009094 Ga0111539_10993657 Ga0111539_109936572 141
180 3300009147 Ga0114129_10687982 Ga0114129_106879822 141
181 3300009147 Ga0114129_12604593 Ga0114129_126045932 141
182 3300009148 Ga0105243_10062457 Ga0105243_100624572 141
183 3300009545 Ga0105237_10067012 Ga0105237_100670122 141
184 3300009553 Ga0105249_11657435 Ga0105249_116574351 141
185 3300010375 Ga0105239_10014210 Ga0105239_100142108 141
186 3300011119 Ga0105246_10141611 Ga0105246_101416112 141
187 3300013297 Ga0157378_10012434 Ga0157378_100124345 141
188 3300013297 Ga0157378_11018901 Ga0157378_110189012 141
189 3300013306 Ga0163162_10225486 Ga0163162_102254862 141
190 3300013306 Ga0163162_10888379 Ga0163162_108883792 141
191 3300013307 Ga0157372_10069846 Ga0157372_100698463 141
192 3300013308 Ga0157375_10080849 Ga0157375_100808494 141
193 3300014326 Ga0157380_10014429 Ga0157380_100144292 141
194 3300014326 Ga0157380_10030390 Ga0157380_100303904 141
195 3300014497 Ga0182008_10287084 Ga0182008_102870842 141
196 3300014745 Ga0157377_10066010 Ga0157377_100660103 141
197 3300014745 Ga0157377_10072228 Ga0157377_100722282 141
198 3300014969 Ga0157376_10541151 Ga0157376_105411513 141
199 3300025315 Ga0207697_10040660 Ga0207697_100406602 141
200 3300025885 Ga0207653_10073900 Ga0207653_100739002 141
201 3300025893 Ga0207682_10045879 Ga0207682_100458794 141
202 3300025901 Ga0207688_10112476 Ga0207688_101124761 141
203 3300025904 Ga0207647_10338723 Ga0207647_103387232 141
204 3300025906 Ga0207699_10526832 Ga0207699_105268322 141
205 3300025907 Ga0207645_10003190 Ga0207645_1000319011 141
206 3300025907 Ga0207645_10131076 Ga0207645_101310763 141
207 3300025909 Ga0207705_10337251 Ga0207705_103372512 141
208 3300025912 Ga0207707_10051051 Ga0207707_100510512 141
209 3300025912 Ga0207707_10071555 Ga0207707_100715553 141
210 3300025912 Ga0207707_10217332 Ga0207707_102173322 141
211 3300025913 Ga0207695_10647375 Ga0207695_106473751 141
212 3300025914 Ga0207671_10152417 Ga0207671_101524172 141
213 3300025917 Ga0207660_10045943 Ga0207660_100459432 141
214 3300025917 Ga0207660_10066060 Ga0207660_100660603 141
215 3300025917 Ga0207660_10335424 Ga0207660_103354242 141
216 3300025918 Ga0207662_10598463 Ga0207662_105984632 141
217 3300025919 Ga0207657_10038181 Ga0207657_100381813 141
218 3300025922 Ga0207646_10271520 Ga0207646_102715202 141
219 3300025923 Ga0207681_11054217 Ga0207681_110542171 141
220 3300025926 Ga0207659_10649101 Ga0207659_106491012 141
221 3300025929 Ga0207664_10304269 Ga0207664_103042691 141
222 3300025932 Ga0207690_10041350 Ga0207690_100413503 141
223 3300025933 Ga0207706_10032500 Ga0207706_100325005 141
224 3300025933 Ga0207706_10033176 Ga0207706_100331763 141
225 3300025934 Ga0207686_10487046 Ga0207686_104870461 141
226 3300025935 Ga0207709_11117819 Ga0207709_111178191 141
227 3300025938 Ga0207704_10143211 Ga0207704_101432112 141
228 3300025940 Ga0207691_10042409 Ga0207691_100424093 141
229 3300025942 Ga0207689_10006848 Ga0207689_100068484 141
230 3300025942 Ga0207689_10702875 Ga0207689_107028751 141
231 3300025949 Ga0207667_10469143 Ga0207667_104691432 141
232 3300025961 Ga0207712_10207122 Ga0207712_102071221 141
233 3300025972 Ga0207668_10186344 Ga0207668_101863442 141
234 3300025972 Ga0207668_10187185 Ga0207668_101871852 141
235 3300025981 Ga0207640_10131886 Ga0207640_101318862 141
236 3300025981 Ga0207640_10273121 Ga0207640_102731212 141
237 3300025986 Ga0207658_10432400 Ga0207658_104324002 141
238 3300025986 Ga0207658_11177977 Ga0207658_111779772 141
239 3300026023 Ga0207677_10102584 Ga0207677_101025842 141
240 3300026035 Ga0207703_10119898 Ga0207703_101198982 141
241 3300026041 Ga0207639_10232718 Ga0207639_102327181 141
242 3300026041 Ga0207639_10457972 Ga0207639_104579722 141
243 3300026075 Ga0207708_10017385 Ga0207708_100173854 141
244 3300026075 Ga0207708_11392662 Ga0207708_113926621 141
245 3300026078 Ga0207702_10317679 Ga0207702_103176792 141
246 3300026088 Ga0207641_10343514 Ga0207641_103435141 141
247 3300026089 Ga0207648_10178241 Ga0207648_101782412 141
248 3300026095 Ga0207676_10000011 Ga0207676_10000011300 141
249 3300026121 Ga0207683_10038831 Ga0207683_100388312 141
250 3300026121 Ga0207683_10701143 Ga0207683_107011432 141
251 3300027907 Ga0207428_10245627 Ga0207428_102456272 141
252 3300027907 Ga0207428_10501320 Ga0207428_105013202 141
253 3300028380 Ga0268265_10290263 Ga0268265_102902632 141
254 3300028381 Ga0268264_10227954 Ga0268264_102279543 141
255 3300031901 Ga0307406_10486606 Ga0307406_104866062 141
256 3300035089 Ga0373944_0183301 Ga0373944_0183301_13_486 141
257 3300038699 Ga0242422_05629 Ga0242422_05629_267_698 141
258 3300039437 Ga0436365_0793666 Ga0436365_0793666_9245_9703 141
259 3300044673 Ga0453683_0056555 Ga0453683_0056555_1135_1590 141
260 3300044842 Ga0466957_0000449 Ga0466957_0000449_4975_5436 141
261 3300045051 Ga0451576_1159834 Ga0451576_1159834_110_589 141
262 3300048907 Ga0496104_0774338 Ga0496104_0774338_70_549 141
263 3300048909 Ga0496106_0796892 Ga0496106_0796892_141_572 141
264 3300048911 Ga0496108_0284173 Ga0496108_0284173_131_562 141
265 3300048912 Ga0496109_0142497 Ga0496109_0142497_1275_1754 141
266 3300048915 Ga0496112_0100511 Ga0496112_0100511_1283_1714 141
267 3300048915 Ga0496112_0116401 Ga0496112_0116401_1362_1793 141
268 3300048916 Ga0496113_0128184 Ga0496113_0128184_1251_1730 141
269 3300049516 Ga0501293_028552 Ga0501293_028552_16_447 141
270 3300049675 Ga0501243_039762 Ga0501243_039762_104_535 141
271 3300049770 Ga0501273_013196 Ga0501273_013196_251_682 141
272 3300050507 nmdc:mga05p37_213732_c1 nmdc:mga05p37_213732_c1_1684_2157 141
273 3300050512 nmdc:mga0n895_211007_c1 nmdc:mga0n895_211007_c1_1374_1853 141
274 3300050512 nmdc:mga0n895_237650_c1 nmdc:mga0n895_237650_c1_780_1259 141
275 3300050513 nmdc:mga0rr50_263259_c1 nmdc:mga0rr50_263259_c1_387_866 141
276 3300050513 nmdc:mga0rr50_342459_c1 nmdc:mga0rr50_342459_c1_279_752 141
277 3300050514 nmdc:mga08x19_164030_c1 nmdc:mga08x19_164030_c1_228_707 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01152

Bac_globin

Bacterial-like globin

44

161

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tt9-assembly1.cif.gz_D crystal structure of shewanella benthica group 1 truncated hemoglobin c51s c71s y34f variant 0.9393 23 139
1uvy-assembly1.cif.gz_A heme-ligand tunneling in group i truncated hemoglobins 0.9301 23 141
5ab8-assembly1.cif.gz_A-2 high resolution x-ray structure of the n-terminal truncated form (residues 1-11) of mycobacterium tuberculosis hbn 0.9252 22 140
3aq6-assembly2.cif.gz_B crystal structure of truncated hemoglobin from tetrahymena pyriformis, fe(iii) form 0.924 22 141
3aq7-assembly1.cif.gz_A crystal structure of truncated hemoglobin from tetrahymena pyriformis, y25f mutant, fe(iii) form 0.9228 22 141
ID Description Score Start End Superfamily
1uvyA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9301 23 141 1.10.490.10
5ab8A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9252 22 140 1.10.490.10
3aq5A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9245 22 141 1.10.490.10
1uvyA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9226 23 141 1.10.490.10
3aq5A00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.9172 22 141 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A1G0PFH4-F1-model_v4 Globin 0.9902 38 141 GO:0019825
GO:0020037
GO:0046872
AF-A0A2V8RB65-F1-model_v4 Group 1 truncated hemoglobin 0.9872 20 141 GO:0019825
GO:0020037
GO:0046872
AF-A0A2V9B3V4-F1-model_v4 SnoaL-like domain-containing protein 0.9862 20 141 GO:0019825
GO:0020037
GO:0046872
AF-A0A1V5ATM7-F1-model_v4 Bacterial-like globin 0.9862 20 140 GO:0019825
GO:0020037
AF-A0A537KAD2-F1-model_v4 Group 1 truncated hemoglobin 0.9862 20 140 GO:0015671
GO:0019825
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.39 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map