F381665
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 277 | 168 | 277 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300005546|Ga0070696_100915498|Ga0070696_1009154982 |
| Length | 163 |
| Sequence | MSAGTQARRAAGAALVILALALPFAAAGLAGAQEPGAAAQVPATLYRRLGGYDSLAVLTDDFIGRLVRDPALARHFAAATAESRDRMRQHLLDQLCAASGGPCLYVGRDMKTAHRGLGIRESDWAATVGHLIASLDRRGLAQKEKDEILAIVAGLKRNIVEKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 141 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 142 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 145 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 146 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 147 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 148 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 149 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 150 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 151 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 152 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 153 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 154 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 157 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 158 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 159 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 160 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 161 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 168 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.36 |
| Nodule | 0 |
| Rhizoplane | 2.53 |
| Rhizosphere | 96.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10014034 | 3300003203 | Bacteria | 3416 |
| 2 | rootH2_10200480 | 3300003320 | Unclassified | 1359 |
| 3 | Ga0070658_10090727 | 3300005327 | Bacteria | 2518 |
| 4 | Ga0070676_10014990 | 3300005328 | Unclassified | 4268 |
| 5 | Ga0070683_100767665 | 3300005329 | Bacteria | 924 |
| 6 | Ga0070683_101975261 | 3300005329 | Unclassified | 560 |
| 7 | Ga0070690_101247646 | 3300005330 | Unclassified | 594 |
| 8 | Ga0070677_10057354 | 3300005333 | Viruses | 1596 |
| 9 | Ga0070677_10093230 | 3300005333 | Bacteria | 1314 |
| 10 | Ga0068869_100095604 | 3300005334 | Bacteria | 2242 |
| 11 | Ga0070680_100026084 | 3300005336 | Bacteria | 4674 |
| 12 | Ga0070680_100032548 | 3300005336 | Unclassified | 4197 |
| 13 | Ga0070680_100146727 | 3300005336 | Bacteria | 1980 |
| 14 | Ga0070680_100396861 | 3300005336 | Bacteria | 1175 |
| 15 | Ga0070680_101445475 | 3300005336 | Unclassified | 595 |
| 16 | Ga0070682_100074394 | 3300005337 | Bacteria | 2182 |
| 17 | Ga0068868_100155881 | 3300005338 | Unclassified | 1883 |
| 18 | Ga0070660_100010575 | 3300005339 | Bacteria | 6521 |
| 19 | Ga0070689_100752012 | 3300005340 | Unclassified | 854 |
| 20 | Ga0070691_10065294 | 3300005341 | Bacteria | 1757 |
| 21 | Ga0070691_10490999 | 3300005341 | Unclassified | 708 |
| 22 | Ga0070687_100318115 | 3300005343 | Unclassified | 993 |
| 23 | Ga0070687_100702171 | 3300005343 | Bacteria | 707 |
| 24 | Ga0070692_10137426 | 3300005345 | Bacteria | 1380 |
| 25 | Ga0070692_10193248 | 3300005345 | Bacteria | 1187 |
| 26 | Ga0070668_100370233 | 3300005347 | Bacteria | 1217 |
| 27 | Ga0070669_100063811 | 3300005353 | Viruses | 2711 |
| 28 | Ga0070669_100332411 | 3300005353 | Unclassified | 1229 |
| 29 | Ga0070669_100452692 | 3300005353 | Bacteria | 1058 |
| 30 | Ga0070675_100119747 | 3300005354 | Unclassified | 2236 |
| 31 | Ga0070671_100132935 | 3300005355 | Bacteria | 2096 |
| 32 | Ga0070674_100695221 | 3300005356 | Bacteria | 869 |
| 33 | Ga0070659_101511820 | 3300005366 | Unclassified | 598 |
| 34 | Ga0070667_100812934 | 3300005367 | Unclassified | 868 |
| 35 | Ga0070703_10079709 | 3300005406 | Bacteria | 1112 |
| 36 | Ga0070703_10278970 | 3300005406 | Unclassified | 689 |
| 37 | Ga0070705_100190676 | 3300005440 | Bacteria | 1397 |
| 38 | Ga0070705_100687771 | 3300005440 | Unclassified | 802 |
| 39 | Ga0070700_100002407 | 3300005441 | Bacteria | 9539 |
| 40 | Ga0070694_100038585 | 3300005444 | Bacteria | 3175 |
| 41 | Ga0070694_100050868 | 3300005444 | Unclassified | 2795 |
| 42 | Ga0070694_100112805 | 3300005444 | Unclassified | 1939 |
| 43 | Ga0070708_101579010 | 3300005445 | Bacteria | 611 |
| 44 | Ga0070678_100122739 | 3300005456 | Bacteria | 2051 |
| 45 | Ga0070678_101316893 | 3300005456 | Unclassified | 672 |
| 46 | Ga0070662_100044623 | 3300005457 | Bacteria | 3176 |
| 47 | Ga0070662_100147886 | 3300005457 | Bacteria | 1826 |
| 48 | Ga0070681_10052610 | 3300005458 | Bacteria | 4062 |
| 49 | Ga0070681_10069526 | 3300005458 | Unclassified | 3487 |
| 50 | Ga0070681_10222953 | 3300005458 | Bacteria | 1800 |
| 51 | Ga0070681_10247311 | 3300005458 | Bacteria | 1696 |
| 52 | Ga0068867_100103134 | 3300005459 | Unclassified | 2181 |
| 53 | Ga0068867_101058938 | 3300005459 | Unclassified | 738 |
| 54 | Ga0070706_100574793 | 3300005467 | Unclassified | 1048 |
| 55 | Ga0070707_101209895 | 3300005468 | Bacteria | 722 |
| 56 | Ga0070698_100018678 | 3300005471 | Bacteria | 7298 |
| 57 | Ga0070698_100147285 | 3300005471 | Bacteria | 2303 |
| 58 | Ga0070698_100595351 | 3300005471 | Bacteria | 1046 |
| 59 | Ga0070699_100001157 | 3300005518 | Bacteria | 24482 |
| 60 | Ga0070679_100055858 | 3300005530 | Bacteria | 3933 |
| 61 | Ga0070679_101445818 | 3300005530 | Unclassified | 634 |
| 62 | Ga0070697_100146313 | 3300005536 | Unclassified | 1989 |
| 63 | Ga0068853_100030207 | 3300005539 | Unclassified | 4576 |
| 64 | Ga0068853_100407426 | 3300005539 | Bacteria | 1273 |
| 65 | Ga0068853_100557674 | 3300005539 | Bacteria | 1086 |
| 66 | Ga0070672_100055678 | 3300005543 | Bacteria | 3099 |
| 67 | Ga0070686_100137525 | 3300005544 | Bacteria | 1697 |
| 68 | Ga0070695_100019052 | 3300005545 | Bacteria | 4173 |
| 69 | Ga0070696_100025563 | 3300005546 | Bacteria | 4016 |
| 70 | Ga0070696_100373963 | 3300005546 | Bacteria | 1109 |
| 71 | Ga0070696_100717394 | 3300005546 | Bacteria | 816 |
| 72 | Ga0070696_100915498 | 3300005546 | Bacteria | 728 |
| 73 | Ga0070693_100123981 | 3300005547 | Bacteria | 1606 |
| 74 | Ga0070665_100473835 | 3300005548 | Bacteria | 1263 |
| 75 | Ga0070704_100126233 | 3300005549 | Bacteria | 1975 |
| 76 | Ga0070704_100144851 | 3300005549 | Unclassified | 1860 |
| 77 | Ga0070704_100275334 | 3300005549 | Bacteria | 1392 |
| 78 | Ga0070704_100504781 | 3300005549 | Unclassified | 1050 |
| 79 | Ga0068855_100026177 | 3300005563 | Bacteria | 6978 |
| 80 | Ga0068854_100286227 | 3300005578 | Bacteria | 1329 |
| 81 | Ga0068854_100620227 | 3300005578 | Unclassified | 925 |
| 82 | Ga0068854_101783496 | 3300005578 | Unclassified | 564 |
| 83 | Ga0068852_100036556 | 3300005616 | Unclassified | 4111 |
| 84 | Ga0068852_100057947 | 3300005616 | Viruses | 3353 |
| 85 | Ga0068859_100393195 | 3300005617 | Unclassified | 1482 |
| 86 | Ga0068859_100603456 | 3300005617 | Bacteria | 1191 |
| 87 | Ga0068859_100704430 | 3300005617 | Unclassified | 1100 |
| 88 | Ga0068864_100000008 | 3300005618 | Bacteria | 390035 |
| 89 | Ga0068864_101204537 | 3300005618 | Bacteria | 756 |
| 90 | Ga0068866_11058263 | 3300005718 | Unclassified | 579 |
| 91 | Ga0068861_100041204 | 3300005719 | Bacteria | 3458 |
| 92 | Ga0068861_101368873 | 3300005719 | Bacteria | 690 |
| 93 | Ga0068870_10049177 | 3300005840 | Bacteria | 2223 |
| 94 | Ga0068870_10317992 | 3300005840 | Unclassified | 988 |
| 95 | Ga0068870_10519087 | 3300005840 | Unclassified | 797 |
| 96 | Ga0068863_100467501 | 3300005841 | Bacteria | 1239 |
| 97 | Ga0068858_100097733 | 3300005842 | Bacteria | 2737 |
| 98 | Ga0068858_100234867 | 3300005842 | Bacteria | 1739 |
| 99 | Ga0068860_100123669 | 3300005843 | Unclassified | 2479 |
| 100 | Ga0068860_101618901 | 3300005843 | Unclassified | 669 |
| 101 | Ga0068862_100016526 | 3300005844 | Bacteria | 6143 |
| 102 | Ga0068862_100259578 | 3300005844 | Bacteria | 1586 |
| 103 | Ga0068862_100465446 | 3300005844 | Bacteria | 1194 |
| 104 | Ga0081539_10000318 | 3300005985 | Bacteria | 107294 |
| 105 | Ga0070717_10136376 | 3300006028 | Unclassified | 2114 |
| 106 | Ga0070716_100018846 | 3300006173 | Bacteria | 3599 |
| 107 | Ga0070716_100240178 | 3300006173 | Unclassified | 1228 |
| 108 | Ga0097621_100131121 | 3300006237 | Bacteria | 2134 |
| 109 | Ga0075428_100160276 | 3300006844 | Bacteria | 2442 |
| 110 | Ga0075433_10007337 | 3300006852 | Bacteria | 8749 |
| 111 | Ga0075433_10169548 | 3300006852 | Bacteria | 1943 |
| 112 | Ga0075433_10513802 | 3300006852 | Bacteria | 1054 |
| 113 | Ga0075434_100001699 | 3300006871 | Bacteria | 18839 |
| 114 | Ga0075434_100053176 | 3300006871 | Unclassified | 4024 |
| 115 | Ga0075434_100149542 | 3300006871 | Unclassified | 2355 |
| 116 | Ga0075434_100593028 | 3300006871 | Unclassified | 1127 |
| 117 | Ga0075434_100961303 | 3300006871 | Bacteria | 868 |
| 118 | Ga0075429_100152996 | 3300006880 | Bacteria | 2020 |
| 119 | Ga0075429_100511460 | 3300006880 | Bacteria | 1052 |
| 120 | Ga0068865_100072589 | 3300006881 | Bacteria | 2445 |
| 121 | Ga0075436_100158120 | 3300006914 | Unclassified | 1597 |
| 122 | Ga0097620_100393199 | 3300006931 | Unclassified | 1482 |
| 123 | Ga0097620_100603466 | 3300006931 | Bacteria | 1191 |
| 124 | Ga0097620_100704362 | 3300006931 | Unclassified | 1100 |
| 125 | Ga0075435_100070598 | 3300007076 | Unclassified | 2851 |
| 126 | Ga0075435_100781926 | 3300007076 | Unclassified | 831 |
| 127 | Ga0105240_10092048 | 3300009093 | Bacteria | 3703 |
| 128 | Ga0105240_10311039 | 3300009093 | Bacteria | 1799 |
| 129 | Ga0111539_10993657 | 3300009094 | Unclassified | 976 |
| 130 | Ga0114129_10144384 | 3300009147 | Unclassified | 3260 |
| 131 | Ga0114129_10201796 | 3300009147 | Bacteria | 2693 |
| 132 | Ga0114129_10687982 | 3300009147 | Unclassified | 1316 |
| 133 | Ga0114129_12604593 | 3300009147 | Unclassified | 603 |
| 134 | Ga0105243_10062457 | 3300009148 | Bacteria | 2982 |
| 135 | Ga0105241_10039408 | 3300009174 | Bacteria | 3564 |
| 136 | Ga0105242_10030113 | 3300009176 | Bacteria | 4333 |
| 137 | Ga0105242_10502858 | 3300009176 | Bacteria | 1153 |
| 138 | Ga0105237_10067012 | 3300009545 | Bacteria | 3584 |
| 139 | Ga0105237_10081062 | 3300009545 | Bacteria | 3235 |
| 140 | Ga0105249_11657435 | 3300009553 | Unclassified | 712 |
| 141 | Ga0105239_10014210 | 3300010375 | Bacteria | 8836 |
| 142 | Ga0105239_10861364 | 3300010375 | Unclassified | 1039 |
| 143 | Ga0105246_10141611 | 3300011119 | Unclassified | 1809 |
| 144 | Ga0105246_11921457 | 3300011119 | Unclassified | 569 |
| 145 | Ga0157370_10368406 | 3300013104 | Bacteria | 1324 |
| 146 | Ga0157369_10076901 | 3300013105 | Bacteria | 3578 |
| 147 | Ga0157378_10012434 | 3300013297 | Bacteria | 7454 |
| 148 | Ga0157378_10809022 | 3300013297 | Unclassified | 963 |
| 149 | Ga0157378_11018901 | 3300013297 | Unclassified | 863 |
| 150 | Ga0163162_10225486 | 3300013306 | Bacteria | 2004 |
| 151 | Ga0163162_10228672 | 3300013306 | Unclassified | 1990 |
| 152 | Ga0163162_10888379 | 3300013306 | Unclassified | 1005 |
| 153 | Ga0157372_10069846 | 3300013307 | Bacteria | 3951 |
| 154 | Ga0157372_10368650 | 3300013307 | Bacteria | 1673 |
| 155 | Ga0157375_10016566 | 3300013308 | Bacteria | 6626 |
| 156 | Ga0157375_10080849 | 3300013308 | Unclassified | 3289 |
| 157 | Ga0157380_10014429 | 3300014326 | Bacteria | 5779 |
| 158 | Ga0157380_10030390 | 3300014326 | Bacteria | 4137 |
| 159 | Ga0182008_10287084 | 3300014497 | Unclassified | 858 |
| 160 | Ga0157377_10066010 | 3300014745 | Bacteria | 2080 |
| 161 | Ga0157377_10072228 | 3300014745 | Bacteria | 1997 |
| 162 | Ga0157376_10541151 | 3300014969 | Bacteria | 1151 |
| 163 | Ga0157376_12717228 | 3300014969 | Unclassified | 535 |
| 164 | Ga0163161_10000303 | 3300017792 | Bacteria | 42868 |
| 165 | Ga0207697_10040660 | 3300025315 | Bacteria | 1909 |
| 166 | Ga0207653_10073900 | 3300025885 | Bacteria | 1169 |
| 167 | Ga0207682_10045879 | 3300025893 | Bacteria | 1795 |
| 168 | Ga0207688_10112476 | 3300025901 | Bacteria | 1582 |
| 169 | Ga0207647_10338723 | 3300025904 | Unclassified | 853 |
| 170 | Ga0207699_10526832 | 3300025906 | Bacteria | 855 |
| 171 | Ga0207645_10003190 | 3300025907 | Bacteria | 12548 |
| 172 | Ga0207645_10131076 | 3300025907 | Bacteria | 1632 |
| 173 | Ga0207643_10313905 | 3300025908 | Unclassified | 978 |
| 174 | Ga0207705_10337251 | 3300025909 | Bacteria | 1160 |
| 175 | Ga0207707_10020973 | 3300025912 | Bacteria | 5707 |
| 176 | Ga0207707_10051051 | 3300025912 | Unclassified | 3601 |
| 177 | Ga0207707_10071555 | 3300025912 | Unclassified | 3022 |
| 178 | Ga0207707_10217332 | 3300025912 | Bacteria | 1664 |
| 179 | Ga0207695_10289677 | 3300025913 | Unclassified | 1530 |
| 180 | Ga0207695_10647375 | 3300025913 | Bacteria | 938 |
| 181 | Ga0207671_10017454 | 3300025914 | Bacteria | 5532 |
| 182 | Ga0207671_10152417 | 3300025914 | Bacteria | 1786 |
| 183 | Ga0207660_10028387 | 3300025917 | Bacteria | 3826 |
| 184 | Ga0207660_10045943 | 3300025917 | Bacteria | 3079 |
| 185 | Ga0207660_10066060 | 3300025917 | Bacteria | 2616 |
| 186 | Ga0207660_10335424 | 3300025917 | Bacteria | 1210 |
| 187 | Ga0207662_10598463 | 3300025918 | Bacteria | 767 |
| 188 | Ga0207657_10038181 | 3300025919 | Unclassified | 4279 |
| 189 | Ga0207652_10251226 | 3300025921 | Unclassified | 1595 |
| 190 | Ga0207646_10271520 | 3300025922 | Bacteria | 1533 |
| 191 | Ga0207681_10710399 | 3300025923 | Unclassified | 836 |
| 192 | Ga0207681_11054217 | 3300025923 | Bacteria | 682 |
| 193 | Ga0207659_10649101 | 3300025926 | Bacteria | 902 |
| 194 | Ga0207664_10304269 | 3300025929 | Bacteria | 1403 |
| 195 | Ga0207644_10849789 | 3300025931 | Bacteria | 764 |
| 196 | Ga0207690_10041350 | 3300025932 | Bacteria | 3020 |
| 197 | Ga0207706_10032500 | 3300025933 | Unclassified | 4647 |
| 198 | Ga0207706_10033176 | 3300025933 | Unclassified | 4596 |
| 199 | Ga0207686_10000420 | 3300025934 | Bacteria | 28967 |
| 200 | Ga0207686_10487046 | 3300025934 | Bacteria | 955 |
| 201 | Ga0207686_10946240 | 3300025934 | Unclassified | 697 |
| 202 | Ga0207709_11117819 | 3300025935 | Unclassified | 647 |
| 203 | Ga0207704_10143211 | 3300025938 | Bacteria | 1675 |
| 204 | Ga0207691_10042409 | 3300025940 | Unclassified | 4195 |
| 205 | Ga0207689_10006848 | 3300025942 | Bacteria | 10024 |
| 206 | Ga0207689_10702875 | 3300025942 | Unclassified | 852 |
| 207 | Ga0207661_10734138 | 3300025944 | Bacteria | 909 |
| 208 | Ga0207679_11121631 | 3300025945 | Unclassified | 722 |
| 209 | Ga0207667_10469143 | 3300025949 | Bacteria | 1278 |
| 210 | Ga0207712_10207122 | 3300025961 | Bacteria | 1559 |
| 211 | Ga0207668_10186344 | 3300025972 | Bacteria | 1641 |
| 212 | Ga0207668_10187185 | 3300025972 | Bacteria | 1638 |
| 213 | Ga0207640_10127117 | 3300025981 | Bacteria | 1837 |
| 214 | Ga0207640_10131886 | 3300025981 | Unclassified | 1808 |
| 215 | Ga0207640_10273121 | 3300025981 | Bacteria | 1323 |
| 216 | Ga0207658_10432400 | 3300025986 | Bacteria | 1163 |
| 217 | Ga0207658_11177977 | 3300025986 | Unclassified | 700 |
| 218 | Ga0207677_10102584 | 3300026023 | Unclassified | 2110 |
| 219 | Ga0207703_10040634 | 3300026035 | Bacteria | 3723 |
| 220 | Ga0207703_10119898 | 3300026035 | Unclassified | 2257 |
| 221 | Ga0207639_10028980 | 3300026041 | Bacteria | 4048 |
| 222 | Ga0207639_10232718 | 3300026041 | Bacteria | 1598 |
| 223 | Ga0207639_10457972 | 3300026041 | Bacteria | 1159 |
| 224 | Ga0207708_10017385 | 3300026075 | Bacteria | 5413 |
| 225 | Ga0207708_11392662 | 3300026075 | Unclassified | 615 |
| 226 | Ga0207702_10317679 | 3300026078 | Bacteria | 1482 |
| 227 | Ga0207641_10343514 | 3300026088 | Bacteria | 1421 |
| 228 | Ga0207648_10178241 | 3300026089 | Bacteria | 1880 |
| 229 | Ga0207676_10000011 | 3300026095 | Bacteria | 382648 |
| 230 | Ga0207675_100092876 | 3300026118 | Bacteria | 2838 |
| 231 | Ga0207683_10038831 | 3300026121 | Unclassified | 4152 |
| 232 | Ga0207683_10701143 | 3300026121 | Bacteria | 938 |
| 233 | Ga0207428_10245627 | 3300027907 | Unclassified | 1336 |
| 234 | Ga0207428_10501320 | 3300027907 | Unclassified | 882 |
| 235 | Ga0268265_10290263 | 3300028380 | Bacteria | 1468 |
| 236 | Ga0268264_10227954 | 3300028381 | Bacteria | 1719 |
| 237 | Ga0307405_10337314 | 3300031731 | Bacteria | 1158 |
| 238 | Ga0307406_10021763 | 3300031901 | Bacteria | 3797 |
| 239 | Ga0307406_10486606 | 3300031901 | Bacteria | 998 |
| 240 | Ga0373944_0183301 | 3300035089 | Unclassified | 752 |
| 241 | Ga0373937_0019205 | 3300036401 | Bacteria | 6119 |
| 242 | Ga0242422_05629 | 3300038699 | Unclassified | 762 |
| 243 | Ga0436365_0793666 | 3300039437 | Bacteria | 13342 |
| 244 | Ga0436363_1209927 | 3300039450 | Bacteria | 689 |
| 245 | Ga0439433_0115685 | 3300041999 | Bacteria | 673 |
| 246 | Ga0439449_0415534 | 3300042007 | Unclassified | 511 |
| 247 | Ga0453683_0028412 | 3300044673 | Bacteria | 3543 |
| 248 | Ga0453683_0056555 | 3300044673 | Bacteria | 2455 |
| 249 | Ga0466957_0000449 | 3300044842 | Bacteria | 20328 |
| 250 | Ga0451576_0075138 | 3300045051 | Bacteria | 3516 |
| 251 | Ga0451576_1159834 | 3300045051 | Bacteria | 807 |
| 252 | Ga0496104_0774338 | 3300048907 | Unclassified | 866 |
| 253 | Ga0496106_0796892 | 3300048909 | Unclassified | 749 |
| 254 | Ga0496108_0284173 | 3300048911 | Bacteria | 1440 |
| 255 | Ga0496109_0142497 | 3300048912 | Bacteria | 2242 |
| 256 | Ga0496112_0100511 | 3300048915 | Bacteria | 2862 |
| 257 | Ga0496112_0116401 | 3300048915 | Bacteria | 2644 |
| 258 | Ga0496113_0128184 | 3300048916 | Bacteria | 1989 |
| 259 | Ga0501293_028552 | 3300049516 | Unclassified | 586 |
| 260 | Ga0501243_039762 | 3300049675 | Unclassified | 824 |
| 261 | Ga0501273_013196 | 3300049770 | Bacteria | 1051 |
| 262 | nmdc:mga05p37_213732_c1 | 3300050507 | Unclassified | 2330 |
| 263 | nmdc:mga05p37_32459_c1 | 3300050507 | Bacteria | 6385 |
| 264 | nmdc:mga05p37_610068_c1 | 3300050507 | Bacteria | 1230 |
| 265 | nmdc:mga05p37_85996_c1 | 3300050507 | Bacteria | 3875 |
| 266 | nmdc:mga08y16_601230_c1 | 3300050511 | Unclassified | 1109 |
| 267 | nmdc:mga0n895_211007_c1 | 3300050512 | Bacteria | 1972 |
| 268 | nmdc:mga0n895_237650_c1 | 3300050512 | Unclassified | 1849 |
| 269 | nmdc:mga0n895_676775_c1 | 3300050512 | Unclassified | 1029 |
| 270 | nmdc:mga0rr50_263259_c1 | 3300050513 | Unclassified | 1435 |
| 271 | nmdc:mga0rr50_342459_c1 | 3300050513 | Bacteria | 1256 |
| 272 | nmdc:mga0rr50_358453_c1 | 3300050513 | Unclassified | 1227 |
| 273 | nmdc:mga08x19_164030_c1 | 3300050514 | Bacteria | 1510 |
| 274 | nmdc:mga0a205_14170_c1 | 3300050515 | Bacteria | 7436 |
| 275 | nmdc:mga0a205_30569_c1 | 3300050515 | Bacteria | 5158 |
| 276 | Ga0500568_0103487 | 3300053139 | Bacteria | 1067 |
| 277 | Ga0501084_0493442 | 3300054114 | Bacteria | 1035 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_101579010 | Ga0070708_1015790101 | 130 |
| 2 | 3300006852 | Ga0075433_10007337 | Ga0075433_1000733711 | 132 |
| 3 | 3300006871 | Ga0075434_100001699 | Ga0075434_10000169911 | 132 |
| 4 | 3300050513 | nmdc:mga0rr50_358453_c1 | nmdc:mga0rr50_358453_c1_749_1201 | 132 |
| 5 | 3300050515 | nmdc:mga0a205_14170_c1 | nmdc:mga0a205_14170_c1_2146_2598 | 132 |
| 6 | 3300009147 | Ga0114129_10144384 | Ga0114129_101443842 | 134 |
| 7 | 3300050507 | nmdc:mga05p37_32459_c1 | nmdc:mga05p37_32459_c1_5839_6273 | 134 |
| 8 | 3300050507 | nmdc:mga05p37_610068_c1 | nmdc:mga05p37_610068_c1_766_1203 | 134 |
| 9 | 3300050511 | nmdc:mga08y16_601230_c1 | nmdc:mga08y16_601230_c1_319_756 | 134 |
| 10 | 3300050515 | nmdc:mga0a205_30569_c1 | nmdc:mga0a205_30569_c1_3013_3447 | 134 |
| 11 | 3300009176 | Ga0105242_10502858 | Ga0105242_105028582 | 135 |
| 12 | 3300025934 | Ga0207686_10946240 | Ga0207686_109462401 | 135 |
| 13 | 3300031731 | Ga0307405_10337314 | Ga0307405_103373142 | 135 |
| 14 | 3300005840 | Ga0068870_10317992 | Ga0068870_103179922 | 137 |
| 15 | 3300025908 | Ga0207643_10313905 | Ga0207643_103139052 | 137 |
| 16 | 3300036401 | Ga0373937_0019205 | Ga0373937_0019205_2738_3202 | 138 |
| 17 | 3300005336 | Ga0070680_100026084 | Ga0070680_1000260842 | 139 |
| 18 | 3300006852 | Ga0075433_10513802 | Ga0075433_105138021 | 139 |
| 19 | 3300006871 | Ga0075434_100593028 | Ga0075434_1005930282 | 139 |
| 20 | 3300006880 | Ga0075429_100511460 | Ga0075429_1005114602 | 139 |
| 21 | 3300009147 | Ga0114129_10201796 | Ga0114129_102017961 | 139 |
| 22 | 3300009176 | Ga0105242_10030113 | Ga0105242_100301135 | 139 |
| 23 | 3300025934 | Ga0207686_10000420 | Ga0207686_1000042010 | 139 |
| 24 | 3300026118 | Ga0207675_100092876 | Ga0207675_1000928762 | 139 |
| 25 | 3300045051 | Ga0451576_0075138 | Ga0451576_0075138_1876_2358 | 139 |
| 26 | 3300050507 | nmdc:mga05p37_85996_c1 | nmdc:mga05p37_85996_c1_1210_1650 | 139 |
| 27 | 3300050512 | nmdc:mga0n895_676775_c1 | nmdc:mga0n895_676775_c1_352_795 | 139 |
| 28 | 3300054114 | Ga0501084_0493442 | Ga0501084_0493442_373_801 | 139 |
| 29 | 3300005329 | Ga0070683_100767665 | Ga0070683_1007676652 | 140 |
| 30 | 3300005329 | Ga0070683_101975261 | Ga0070683_1019752611 | 140 |
| 31 | 3300005330 | Ga0070690_101247646 | Ga0070690_1012476461 | 140 |
| 32 | 3300005336 | Ga0070680_100146727 | Ga0070680_1001467273 | 140 |
| 33 | 3300005336 | Ga0070680_101445475 | Ga0070680_1014454751 | 140 |
| 34 | 3300005343 | Ga0070687_100318115 | Ga0070687_1003181151 | 140 |
| 35 | 3300005353 | Ga0070669_100332411 | Ga0070669_1003324112 | 140 |
| 36 | 3300005355 | Ga0070671_100132935 | Ga0070671_1001329352 | 140 |
| 37 | 3300005458 | Ga0070681_10247311 | Ga0070681_102473111 | 140 |
| 38 | 3300005530 | Ga0070679_100055858 | Ga0070679_1000558583 | 140 |
| 39 | 3300005539 | Ga0068853_100030207 | Ga0068853_1000302072 | 140 |
| 40 | 3300005546 | Ga0070696_100717394 | Ga0070696_1007173942 | 140 |
| 41 | 3300005616 | Ga0068852_100036556 | Ga0068852_1000365563 | 140 |
| 42 | 3300005617 | Ga0068859_100393195 | Ga0068859_1003931952 | 140 |
| 43 | 3300005617 | Ga0068859_100704430 | Ga0068859_1007044302 | 140 |
| 44 | 3300005719 | Ga0068861_100041204 | Ga0068861_1000412043 | 140 |
| 45 | 3300005719 | Ga0068861_101368873 | Ga0068861_1013688731 | 140 |
| 46 | 3300005842 | Ga0068858_100097733 | Ga0068858_1000977332 | 140 |
| 47 | 3300005843 | Ga0068860_101618901 | Ga0068860_1016189011 | 140 |
| 48 | 3300006931 | Ga0097620_100393199 | Ga0097620_1003931992 | 140 |
| 49 | 3300006931 | Ga0097620_100704362 | Ga0097620_1007043622 | 140 |
| 50 | 3300009093 | Ga0105240_10092048 | Ga0105240_100920483 | 140 |
| 51 | 3300009174 | Ga0105241_10039408 | Ga0105241_100394082 | 140 |
| 52 | 3300009545 | Ga0105237_10081062 | Ga0105237_100810621 | 140 |
| 53 | 3300010375 | Ga0105239_10861364 | Ga0105239_108613641 | 140 |
| 54 | 3300011119 | Ga0105246_11921457 | Ga0105246_119214572 | 140 |
| 55 | 3300013104 | Ga0157370_10368406 | Ga0157370_103684062 | 140 |
| 56 | 3300013105 | Ga0157369_10076901 | Ga0157369_100769012 | 140 |
| 57 | 3300013297 | Ga0157378_10809022 | Ga0157378_108090222 | 140 |
| 58 | 3300013306 | Ga0163162_10228672 | Ga0163162_102286722 | 140 |
| 59 | 3300013307 | Ga0157372_10368650 | Ga0157372_103686502 | 140 |
| 60 | 3300013308 | Ga0157375_10016566 | Ga0157375_100165663 | 140 |
| 61 | 3300014969 | Ga0157376_12717228 | Ga0157376_127172281 | 140 |
| 62 | 3300017792 | Ga0163161_10000303 | Ga0163161_100003039 | 140 |
| 63 | 3300025912 | Ga0207707_10020973 | Ga0207707_100209732 | 140 |
| 64 | 3300025913 | Ga0207695_10289677 | Ga0207695_102896771 | 140 |
| 65 | 3300025914 | Ga0207671_10017454 | Ga0207671_100174545 | 140 |
| 66 | 3300025917 | Ga0207660_10028387 | Ga0207660_100283875 | 140 |
| 67 | 3300025921 | Ga0207652_10251226 | Ga0207652_102512262 | 140 |
| 68 | 3300025923 | Ga0207681_10710399 | Ga0207681_107103991 | 140 |
| 69 | 3300025931 | Ga0207644_10849789 | Ga0207644_108497891 | 140 |
| 70 | 3300025944 | Ga0207661_10734138 | Ga0207661_107341382 | 140 |
| 71 | 3300025945 | Ga0207679_11121631 | Ga0207679_111216312 | 140 |
| 72 | 3300025981 | Ga0207640_10127117 | Ga0207640_101271171 | 140 |
| 73 | 3300026035 | Ga0207703_10040634 | Ga0207703_100406342 | 140 |
| 74 | 3300026041 | Ga0207639_10028980 | Ga0207639_100289803 | 140 |
| 75 | 3300031901 | Ga0307406_10021763 | Ga0307406_100217634 | 140 |
| 76 | 3300039450 | Ga0436363_1209927 | Ga0436363_1209927_87_533 | 140 |
| 77 | 3300041999 | Ga0439433_0115685 | Ga0439433_0115685_61_498 | 140 |
| 78 | 3300042007 | Ga0439449_0415534 | Ga0439449_0415534_43_501 | 140 |
| 79 | 3300044673 | Ga0453683_0028412 | Ga0453683_0028412_383_820 | 140 |
| 80 | 3300053139 | Ga0500568_0103487 | Ga0500568_0103487_450_905 | 140 |
| 81 | 3300003203 | JGI25406J46586_10014034 | JGI25406J46586_100140344 | 141 |
| 82 | 3300003320 | rootH2_10200480 | rootH2_102004802 | 141 |
| 83 | 3300005327 | Ga0070658_10090727 | Ga0070658_100907272 | 141 |
| 84 | 3300005328 | Ga0070676_10014990 | Ga0070676_100149902 | 141 |
| 85 | 3300005333 | Ga0070677_10057354 | Ga0070677_100573542 | 141 |
| 86 | 3300005333 | Ga0070677_10093230 | Ga0070677_100932301 | 141 |
| 87 | 3300005334 | Ga0068869_100095604 | Ga0068869_1000956042 | 141 |
| 88 | 3300005336 | Ga0070680_100032548 | Ga0070680_1000325484 | 141 |
| 89 | 3300005336 | Ga0070680_100396861 | Ga0070680_1003968612 | 141 |
| 90 | 3300005337 | Ga0070682_100074394 | Ga0070682_1000743942 | 141 |
| 91 | 3300005338 | Ga0068868_100155881 | Ga0068868_1001558812 | 141 |
| 92 | 3300005339 | Ga0070660_100010575 | Ga0070660_1000105753 | 141 |
| 93 | 3300005340 | Ga0070689_100752012 | Ga0070689_1007520121 | 141 |
| 94 | 3300005341 | Ga0070691_10065294 | Ga0070691_100652941 | 141 |
| 95 | 3300005341 | Ga0070691_10490999 | Ga0070691_104909991 | 141 |
| 96 | 3300005343 | Ga0070687_100702171 | Ga0070687_1007021712 | 141 |
| 97 | 3300005345 | Ga0070692_10137426 | Ga0070692_101374261 | 141 |
| 98 | 3300005345 | Ga0070692_10193248 | Ga0070692_101932482 | 141 |
| 99 | 3300005347 | Ga0070668_100370233 | Ga0070668_1003702332 | 141 |
| 100 | 3300005353 | Ga0070669_100063811 | Ga0070669_1000638113 | 141 |
| 101 | 3300005353 | Ga0070669_100452692 | Ga0070669_1004526922 | 141 |
| 102 | 3300005354 | Ga0070675_100119747 | Ga0070675_1001197473 | 141 |
| 103 | 3300005356 | Ga0070674_100695221 | Ga0070674_1006952212 | 141 |
| 104 | 3300005366 | Ga0070659_101511820 | Ga0070659_1015118201 | 141 |
| 105 | 3300005367 | Ga0070667_100812934 | Ga0070667_1008129342 | 141 |
| 106 | 3300005406 | Ga0070703_10079709 | Ga0070703_100797092 | 141 |
| 107 | 3300005406 | Ga0070703_10278970 | Ga0070703_102789701 | 141 |
| 108 | 3300005440 | Ga0070705_100190676 | Ga0070705_1001906762 | 141 |
| 109 | 3300005440 | Ga0070705_100687771 | Ga0070705_1006877711 | 141 |
| 110 | 3300005441 | Ga0070700_100002407 | Ga0070700_1000024078 | 141 |
| 111 | 3300005444 | Ga0070694_100038585 | Ga0070694_1000385854 | 141 |
| 112 | 3300005444 | Ga0070694_100050868 | Ga0070694_1000508681 | 141 |
| 113 | 3300005444 | Ga0070694_100112805 | Ga0070694_1001128052 | 141 |
| 114 | 3300005456 | Ga0070678_100122739 | Ga0070678_1001227392 | 141 |
| 115 | 3300005456 | Ga0070678_101316893 | Ga0070678_1013168932 | 141 |
| 116 | 3300005457 | Ga0070662_100044623 | Ga0070662_1000446233 | 141 |
| 117 | 3300005457 | Ga0070662_100147886 | Ga0070662_1001478863 | 141 |
| 118 | 3300005458 | Ga0070681_10052610 | Ga0070681_100526102 | 141 |
| 119 | 3300005458 | Ga0070681_10069526 | Ga0070681_100695263 | 141 |
| 120 | 3300005458 | Ga0070681_10222953 | Ga0070681_102229532 | 141 |
| 121 | 3300005459 | Ga0068867_100103134 | Ga0068867_1001031343 | 141 |
| 122 | 3300005459 | Ga0068867_101058938 | Ga0068867_1010589382 | 141 |
| 123 | 3300005467 | Ga0070706_100574793 | Ga0070706_1005747932 | 141 |
| 124 | 3300005468 | Ga0070707_101209895 | Ga0070707_1012098952 | 141 |
| 125 | 3300005471 | Ga0070698_100018678 | Ga0070698_1000186784 | 141 |
| 126 | 3300005471 | Ga0070698_100147285 | Ga0070698_1001472852 | 141 |
| 127 | 3300005471 | Ga0070698_100595351 | Ga0070698_1005953512 | 141 |
| 128 | 3300005518 | Ga0070699_100001157 | Ga0070699_10000115727 | 141 |
| 129 | 3300005530 | Ga0070679_101445818 | Ga0070679_1014458182 | 141 |
| 130 | 3300005536 | Ga0070697_100146313 | Ga0070697_1001463131 | 141 |
| 131 | 3300005539 | Ga0068853_100407426 | Ga0068853_1004074262 | 141 |
| 132 | 3300005539 | Ga0068853_100557674 | Ga0068853_1005576742 | 141 |
| 133 | 3300005543 | Ga0070672_100055678 | Ga0070672_1000556783 | 141 |
| 134 | 3300005544 | Ga0070686_100137525 | Ga0070686_1001375252 | 141 |
| 135 | 3300005545 | Ga0070695_100019052 | Ga0070695_1000190524 | 141 |
| 136 | 3300005546 | Ga0070696_100025563 | Ga0070696_1000255632 | 141 |
| 137 | 3300005546 | Ga0070696_100373963 | Ga0070696_1003739632 | 141 |
| 138 | 3300005546 | Ga0070696_100915498 | Ga0070696_1009154982 | 141 |
| 139 | 3300005547 | Ga0070693_100123981 | Ga0070693_1001239811 | 141 |
| 140 | 3300005548 | Ga0070665_100473835 | Ga0070665_1004738352 | 141 |
| 141 | 3300005549 | Ga0070704_100126233 | Ga0070704_1001262333 | 141 |
| 142 | 3300005549 | Ga0070704_100144851 | Ga0070704_1001448512 | 141 |
| 143 | 3300005549 | Ga0070704_100275334 | Ga0070704_1002753343 | 141 |
| 144 | 3300005549 | Ga0070704_100504781 | Ga0070704_1005047812 | 141 |
| 145 | 3300005563 | Ga0068855_100026177 | Ga0068855_1000261775 | 141 |
| 146 | 3300005578 | Ga0068854_100286227 | Ga0068854_1002862273 | 141 |
| 147 | 3300005578 | Ga0068854_100620227 | Ga0068854_1006202272 | 141 |
| 148 | 3300005578 | Ga0068854_101783496 | Ga0068854_1017834961 | 141 |
| 149 | 3300005616 | Ga0068852_100057947 | Ga0068852_1000579472 | 141 |
| 150 | 3300005617 | Ga0068859_100603456 | Ga0068859_1006034562 | 141 |
| 151 | 3300005618 | Ga0068864_100000008 | Ga0068864_10000000834 | 141 |
| 152 | 3300005618 | Ga0068864_101204537 | Ga0068864_1012045371 | 141 |
| 153 | 3300005718 | Ga0068866_11058263 | Ga0068866_110582631 | 141 |
| 154 | 3300005840 | Ga0068870_10049177 | Ga0068870_100491774 | 141 |
| 155 | 3300005840 | Ga0068870_10519087 | Ga0068870_105190872 | 141 |
| 156 | 3300005841 | Ga0068863_100467501 | Ga0068863_1004675013 | 141 |
| 157 | 3300005842 | Ga0068858_100234867 | Ga0068858_1002348671 | 141 |
| 158 | 3300005843 | Ga0068860_100123669 | Ga0068860_1001236693 | 141 |
| 159 | 3300005844 | Ga0068862_100016526 | Ga0068862_1000165267 | 141 |
| 160 | 3300005844 | Ga0068862_100259578 | Ga0068862_1002595782 | 141 |
| 161 | 3300005844 | Ga0068862_100465446 | Ga0068862_1004654462 | 141 |
| 162 | 3300005985 | Ga0081539_10000318 | Ga0081539_1000031849 | 141 |
| 163 | 3300006028 | Ga0070717_10136376 | Ga0070717_101363762 | 141 |
| 164 | 3300006173 | Ga0070716_100018846 | Ga0070716_1000188464 | 141 |
| 165 | 3300006173 | Ga0070716_100240178 | Ga0070716_1002401782 | 141 |
| 166 | 3300006237 | Ga0097621_100131121 | Ga0097621_1001311212 | 141 |
| 167 | 3300006844 | Ga0075428_100160276 | Ga0075428_1001602762 | 141 |
| 168 | 3300006852 | Ga0075433_10169548 | Ga0075433_101695482 | 141 |
| 169 | 3300006871 | Ga0075434_100053176 | Ga0075434_1000531763 | 141 |
| 170 | 3300006871 | Ga0075434_100149542 | Ga0075434_1001495422 | 141 |
| 171 | 3300006871 | Ga0075434_100961303 | Ga0075434_1009613032 | 141 |
| 172 | 3300006880 | Ga0075429_100152996 | Ga0075429_1001529962 | 141 |
| 173 | 3300006881 | Ga0068865_100072589 | Ga0068865_1000725893 | 141 |
| 174 | 3300006914 | Ga0075436_100158120 | Ga0075436_1001581202 | 141 |
| 175 | 3300006931 | Ga0097620_100603466 | Ga0097620_1006034662 | 141 |
| 176 | 3300007076 | Ga0075435_100070598 | Ga0075435_1000705982 | 141 |
| 177 | 3300007076 | Ga0075435_100781926 | Ga0075435_1007819262 | 141 |
| 178 | 3300009093 | Ga0105240_10311039 | Ga0105240_103110392 | 141 |
| 179 | 3300009094 | Ga0111539_10993657 | Ga0111539_109936572 | 141 |
| 180 | 3300009147 | Ga0114129_10687982 | Ga0114129_106879822 | 141 |
| 181 | 3300009147 | Ga0114129_12604593 | Ga0114129_126045932 | 141 |
| 182 | 3300009148 | Ga0105243_10062457 | Ga0105243_100624572 | 141 |
| 183 | 3300009545 | Ga0105237_10067012 | Ga0105237_100670122 | 141 |
| 184 | 3300009553 | Ga0105249_11657435 | Ga0105249_116574351 | 141 |
| 185 | 3300010375 | Ga0105239_10014210 | Ga0105239_100142108 | 141 |
| 186 | 3300011119 | Ga0105246_10141611 | Ga0105246_101416112 | 141 |
| 187 | 3300013297 | Ga0157378_10012434 | Ga0157378_100124345 | 141 |
| 188 | 3300013297 | Ga0157378_11018901 | Ga0157378_110189012 | 141 |
| 189 | 3300013306 | Ga0163162_10225486 | Ga0163162_102254862 | 141 |
| 190 | 3300013306 | Ga0163162_10888379 | Ga0163162_108883792 | 141 |
| 191 | 3300013307 | Ga0157372_10069846 | Ga0157372_100698463 | 141 |
| 192 | 3300013308 | Ga0157375_10080849 | Ga0157375_100808494 | 141 |
| 193 | 3300014326 | Ga0157380_10014429 | Ga0157380_100144292 | 141 |
| 194 | 3300014326 | Ga0157380_10030390 | Ga0157380_100303904 | 141 |
| 195 | 3300014497 | Ga0182008_10287084 | Ga0182008_102870842 | 141 |
| 196 | 3300014745 | Ga0157377_10066010 | Ga0157377_100660103 | 141 |
| 197 | 3300014745 | Ga0157377_10072228 | Ga0157377_100722282 | 141 |
| 198 | 3300014969 | Ga0157376_10541151 | Ga0157376_105411513 | 141 |
| 199 | 3300025315 | Ga0207697_10040660 | Ga0207697_100406602 | 141 |
| 200 | 3300025885 | Ga0207653_10073900 | Ga0207653_100739002 | 141 |
| 201 | 3300025893 | Ga0207682_10045879 | Ga0207682_100458794 | 141 |
| 202 | 3300025901 | Ga0207688_10112476 | Ga0207688_101124761 | 141 |
| 203 | 3300025904 | Ga0207647_10338723 | Ga0207647_103387232 | 141 |
| 204 | 3300025906 | Ga0207699_10526832 | Ga0207699_105268322 | 141 |
| 205 | 3300025907 | Ga0207645_10003190 | Ga0207645_1000319011 | 141 |
| 206 | 3300025907 | Ga0207645_10131076 | Ga0207645_101310763 | 141 |
| 207 | 3300025909 | Ga0207705_10337251 | Ga0207705_103372512 | 141 |
| 208 | 3300025912 | Ga0207707_10051051 | Ga0207707_100510512 | 141 |
| 209 | 3300025912 | Ga0207707_10071555 | Ga0207707_100715553 | 141 |
| 210 | 3300025912 | Ga0207707_10217332 | Ga0207707_102173322 | 141 |
| 211 | 3300025913 | Ga0207695_10647375 | Ga0207695_106473751 | 141 |
| 212 | 3300025914 | Ga0207671_10152417 | Ga0207671_101524172 | 141 |
| 213 | 3300025917 | Ga0207660_10045943 | Ga0207660_100459432 | 141 |
| 214 | 3300025917 | Ga0207660_10066060 | Ga0207660_100660603 | 141 |
| 215 | 3300025917 | Ga0207660_10335424 | Ga0207660_103354242 | 141 |
| 216 | 3300025918 | Ga0207662_10598463 | Ga0207662_105984632 | 141 |
| 217 | 3300025919 | Ga0207657_10038181 | Ga0207657_100381813 | 141 |
| 218 | 3300025922 | Ga0207646_10271520 | Ga0207646_102715202 | 141 |
| 219 | 3300025923 | Ga0207681_11054217 | Ga0207681_110542171 | 141 |
| 220 | 3300025926 | Ga0207659_10649101 | Ga0207659_106491012 | 141 |
| 221 | 3300025929 | Ga0207664_10304269 | Ga0207664_103042691 | 141 |
| 222 | 3300025932 | Ga0207690_10041350 | Ga0207690_100413503 | 141 |
| 223 | 3300025933 | Ga0207706_10032500 | Ga0207706_100325005 | 141 |
| 224 | 3300025933 | Ga0207706_10033176 | Ga0207706_100331763 | 141 |
| 225 | 3300025934 | Ga0207686_10487046 | Ga0207686_104870461 | 141 |
| 226 | 3300025935 | Ga0207709_11117819 | Ga0207709_111178191 | 141 |
| 227 | 3300025938 | Ga0207704_10143211 | Ga0207704_101432112 | 141 |
| 228 | 3300025940 | Ga0207691_10042409 | Ga0207691_100424093 | 141 |
| 229 | 3300025942 | Ga0207689_10006848 | Ga0207689_100068484 | 141 |
| 230 | 3300025942 | Ga0207689_10702875 | Ga0207689_107028751 | 141 |
| 231 | 3300025949 | Ga0207667_10469143 | Ga0207667_104691432 | 141 |
| 232 | 3300025961 | Ga0207712_10207122 | Ga0207712_102071221 | 141 |
| 233 | 3300025972 | Ga0207668_10186344 | Ga0207668_101863442 | 141 |
| 234 | 3300025972 | Ga0207668_10187185 | Ga0207668_101871852 | 141 |
| 235 | 3300025981 | Ga0207640_10131886 | Ga0207640_101318862 | 141 |
| 236 | 3300025981 | Ga0207640_10273121 | Ga0207640_102731212 | 141 |
| 237 | 3300025986 | Ga0207658_10432400 | Ga0207658_104324002 | 141 |
| 238 | 3300025986 | Ga0207658_11177977 | Ga0207658_111779772 | 141 |
| 239 | 3300026023 | Ga0207677_10102584 | Ga0207677_101025842 | 141 |
| 240 | 3300026035 | Ga0207703_10119898 | Ga0207703_101198982 | 141 |
| 241 | 3300026041 | Ga0207639_10232718 | Ga0207639_102327181 | 141 |
| 242 | 3300026041 | Ga0207639_10457972 | Ga0207639_104579722 | 141 |
| 243 | 3300026075 | Ga0207708_10017385 | Ga0207708_100173854 | 141 |
| 244 | 3300026075 | Ga0207708_11392662 | Ga0207708_113926621 | 141 |
| 245 | 3300026078 | Ga0207702_10317679 | Ga0207702_103176792 | 141 |
| 246 | 3300026088 | Ga0207641_10343514 | Ga0207641_103435141 | 141 |
| 247 | 3300026089 | Ga0207648_10178241 | Ga0207648_101782412 | 141 |
| 248 | 3300026095 | Ga0207676_10000011 | Ga0207676_10000011300 | 141 |
| 249 | 3300026121 | Ga0207683_10038831 | Ga0207683_100388312 | 141 |
| 250 | 3300026121 | Ga0207683_10701143 | Ga0207683_107011432 | 141 |
| 251 | 3300027907 | Ga0207428_10245627 | Ga0207428_102456272 | 141 |
| 252 | 3300027907 | Ga0207428_10501320 | Ga0207428_105013202 | 141 |
| 253 | 3300028380 | Ga0268265_10290263 | Ga0268265_102902632 | 141 |
| 254 | 3300028381 | Ga0268264_10227954 | Ga0268264_102279543 | 141 |
| 255 | 3300031901 | Ga0307406_10486606 | Ga0307406_104866062 | 141 |
| 256 | 3300035089 | Ga0373944_0183301 | Ga0373944_0183301_13_486 | 141 |
| 257 | 3300038699 | Ga0242422_05629 | Ga0242422_05629_267_698 | 141 |
| 258 | 3300039437 | Ga0436365_0793666 | Ga0436365_0793666_9245_9703 | 141 |
| 259 | 3300044673 | Ga0453683_0056555 | Ga0453683_0056555_1135_1590 | 141 |
| 260 | 3300044842 | Ga0466957_0000449 | Ga0466957_0000449_4975_5436 | 141 |
| 261 | 3300045051 | Ga0451576_1159834 | Ga0451576_1159834_110_589 | 141 |
| 262 | 3300048907 | Ga0496104_0774338 | Ga0496104_0774338_70_549 | 141 |
| 263 | 3300048909 | Ga0496106_0796892 | Ga0496106_0796892_141_572 | 141 |
| 264 | 3300048911 | Ga0496108_0284173 | Ga0496108_0284173_131_562 | 141 |
| 265 | 3300048912 | Ga0496109_0142497 | Ga0496109_0142497_1275_1754 | 141 |
| 266 | 3300048915 | Ga0496112_0100511 | Ga0496112_0100511_1283_1714 | 141 |
| 267 | 3300048915 | Ga0496112_0116401 | Ga0496112_0116401_1362_1793 | 141 |
| 268 | 3300048916 | Ga0496113_0128184 | Ga0496113_0128184_1251_1730 | 141 |
| 269 | 3300049516 | Ga0501293_028552 | Ga0501293_028552_16_447 | 141 |
| 270 | 3300049675 | Ga0501243_039762 | Ga0501243_039762_104_535 | 141 |
| 271 | 3300049770 | Ga0501273_013196 | Ga0501273_013196_251_682 | 141 |
| 272 | 3300050507 | nmdc:mga05p37_213732_c1 | nmdc:mga05p37_213732_c1_1684_2157 | 141 |
| 273 | 3300050512 | nmdc:mga0n895_211007_c1 | nmdc:mga0n895_211007_c1_1374_1853 | 141 |
| 274 | 3300050512 | nmdc:mga0n895_237650_c1 | nmdc:mga0n895_237650_c1_780_1259 | 141 |
| 275 | 3300050513 | nmdc:mga0rr50_263259_c1 | nmdc:mga0rr50_263259_c1_387_866 | 141 |
| 276 | 3300050513 | nmdc:mga0rr50_342459_c1 | nmdc:mga0rr50_342459_c1_279_752 | 141 |
| 277 | 3300050514 | nmdc:mga08x19_164030_c1 | nmdc:mga08x19_164030_c1_228_707 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tt9-assembly1.cif.gz_D | crystal structure of shewanella benthica group 1 truncated hemoglobin c51s c71s y34f variant | 0.9393 | 23 | 139 |
| 1uvy-assembly1.cif.gz_A | heme-ligand tunneling in group i truncated hemoglobins | 0.9301 | 23 | 141 |
| 5ab8-assembly1.cif.gz_A-2 | high resolution x-ray structure of the n-terminal truncated form (residues 1-11) of mycobacterium tuberculosis hbn | 0.9252 | 22 | 140 |
| 3aq6-assembly2.cif.gz_B | crystal structure of truncated hemoglobin from tetrahymena pyriformis, fe(iii) form | 0.924 | 22 | 141 |
| 3aq7-assembly1.cif.gz_A | crystal structure of truncated hemoglobin from tetrahymena pyriformis, y25f mutant, fe(iii) form | 0.9228 | 22 | 141 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1uvyA00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9301 | 23 | 141 | 1.10.490.10 |
| 5ab8A00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9252 | 22 | 140 | 1.10.490.10 |
| 3aq5A00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9245 | 22 | 141 | 1.10.490.10 |
| 1uvyA00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9226 | 23 | 141 | 1.10.490.10 |
| 3aq5A00 | Mainly Alpha;Orthogonal Bundle;Globin-like;Globins | 0.9172 | 22 | 141 | 1.10.490.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0PFH4-F1-model_v4 | Globin | 0.9902 | 38 | 141 |
GO:0019825
GO:0020037 GO:0046872 |
| AF-A0A2V8RB65-F1-model_v4 | Group 1 truncated hemoglobin | 0.9872 | 20 | 141 |
GO:0019825
GO:0020037 GO:0046872 |
| AF-A0A2V9B3V4-F1-model_v4 | SnoaL-like domain-containing protein | 0.9862 | 20 | 141 |
GO:0019825
GO:0020037 GO:0046872 |
| AF-A0A1V5ATM7-F1-model_v4 | Bacterial-like globin | 0.9862 | 20 | 140 |
GO:0019825
GO:0020037 |
| AF-A0A537KAD2-F1-model_v4 | Group 1 truncated hemoglobin | 0.9862 | 20 | 140 |
GO:0015671
GO:0019825 GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar