F381432

General Info

Members Datasets Scaffolds Average Seq Length
276 139 552 546

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_7340_c1|nmdc:mga0n895_7340_c1_1693_3426
Length 577
Sequence LPDAHSPESRVRGIGGAVENQSGSRRKDIMFSPFSSRLFRKLGGIFLALSACSLSHAQRSTAPTASEDPVSIDESWRQASSKYDAERTALLKQVEAVDHQGPFRSDWESLQKYDVPEWYKDAKFGIFIHWGVYSVPAFGDEWYPRNMYREGSEEYKHHIATYGPQDKFGYKDYIPMFKAEHFDAAAWAQLFRKAGAKYVVPVAEHHDGFAMYDSGLSDWTAAKMGPHRDTTGELAKAVRAEGLHFGVSSHRVEHNFFFGPGRTIPSDVNDPQYAAFYGPAHAWLTNPLGTPVNNDFTYVSSKWADDWLARAAELVETYHPDIVYFDWWIGQPSIRPNLTRFAAFYYNRSLKYGDHVGVINYKDYAMQEHAAVLDLERGQLGDIRPLYWQTDTSVSNKSWGYIENDTFKSPEFVIHQLIDIVSKNGNLLMNIGPRSDGTIPDEVQRVLLDVGAWLNLNGEAIYGTRPWKVYGEGPTKVAAGPFHDVDTTNYTSEDFRFTTKGVVLYAIGLRWPTSGEVVIHSLAPTVGTEAVRSVALLGSDAKPRFEQRADGLHVQLPGPSPAKYAYVLHVTFGSILQ

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.35
Rhizosphere 94.57
Stem 0
Stem Tuber 0
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_7340_c1 3300050512 Bacteria 9454
2 rootL2_10049824 3300003322 Bacteria 8230
3 Ga0065715_10005828 3300005293 Bacteria 3045
4 Ga0070676_10033519 3300005328 Bacteria 2947
5 Ga0070683_100026533 3300005329 Bacteria 5218
6 Ga0068869_100003231 3300005334 Bacteria 9959
7 Ga0070666_10031266 3300005335 Bacteria 3514
8 Ga0070680_100016691 3300005336 Bacteria 5780
9 Ga0068868_100025181 3300005338 Bacteria 4521
10 Ga0068868_100031051 3300005338 Bacteria 4100
11 Ga0068868_100039318 3300005338 Bacteria 3676
12 Ga0070691_10028873 3300005341 Unclassified 2594
13 Ga0070669_100081488 3300005353 Bacteria 2411
14 Ga0070703_10006513 3300005406 Bacteria 3273
15 Ga0070709_10000957 3300005434 Bacteria 16039
16 Ga0070709_10021606 3300005434 Unclassified 3751
17 Ga0070709_10045121 3300005434 Unclassified 2734
18 Ga0070709_10062060 3300005434 Bacteria 2382
19 Ga0070714_100000096 3300005435 Bacteria 74616
20 Ga0070713_100002072 3300005436 Bacteria 12960
21 Ga0070713_100002800 3300005436 Bacteria 11399
22 Ga0070713_100011349 3300005436 Bacteria 6485
23 Ga0070713_100023104 3300005436 Unclassified 4818
24 Ga0070713_100173605 3300005436 Bacteria 1932
25 Ga0070711_100000159 3300005439 Bacteria 36590
26 Ga0070711_100000227 3300005439 Bacteria 29664
27 Ga0070711_100004369 3300005439 Bacteria 8331
28 Ga0070711_100027179 3300005439 Unclassified 3755
29 Ga0070708_100001594 3300005445 Bacteria 17384
30 Ga0070708_100003952 3300005445 Bacteria 11636
31 Ga0070708_100034801 3300005445 Bacteria 4384
32 Ga0070708_100060689 3300005445 Bacteria 3376
33 Ga0070708_100172110 3300005445 Bacteria 2022
34 Ga0070663_100032688 3300005455 Bacteria 3588
35 Ga0070662_100018706 3300005457 Bacteria 4691
36 Ga0070681_10001340 3300005458 Bacteria 21492
37 Ga0070681_10045726 3300005458 Bacteria 4379
38 Ga0070685_10039227 3300005466 Bacteria 2689
39 Ga0070706_100002924 3300005467 Bacteria 17001
40 Ga0070706_100028436 3300005467 Bacteria 5146
41 Ga0070706_100133354 3300005467 Unclassified 2318
42 Ga0070707_100007144 3300005468 Bacteria 10351
43 Ga0070707_100019380 3300005468 Bacteria 6409
44 Ga0070698_100004292 3300005471 Bacteria 15671
45 Ga0070699_100000394 3300005518 Bacteria 42295
46 Ga0070699_100011800 3300005518 Bacteria 7540
47 Ga0070679_100106060 3300005530 Bacteria 2796
48 Ga0070679_100115144 3300005530 Bacteria 2674
49 Ga0070679_100191431 3300005530 Bacteria 2014
50 Ga0070684_100014347 3300005535 Bacteria 6414
51 Ga0070697_100000773 3300005536 Bacteria 23963
52 Ga0070697_100001045 3300005536 Bacteria 20921
53 Ga0070697_100004730 3300005536 Bacteria 10431
54 Ga0070697_100005194 3300005536 Bacteria 10000
55 Ga0068853_100060733 3300005539 Bacteria 3267
56 Ga0070695_100011841 3300005545 Bacteria 5220
57 Ga0070693_100000238 3300005547 Bacteria 25712
58 Ga0070693_100002339 3300005547 Bacteria 8711
59 Ga0070693_100057164 3300005547 Bacteria 2254
60 Ga0070665_100031260 3300005548 Bacteria 5358
61 Ga0070704_100001668 3300005549 Bacteria 12047
62 Ga0068855_100000401 3300005563 Bacteria 53514
63 Ga0068855_100002467 3300005563 Bacteria 22829
64 Ga0070664_100020689 3300005564 Bacteria 5420
65 Ga0068857_100019448 3300005577 Bacteria 5963
66 Ga0068854_100008152 3300005578 Bacteria 6719
67 Ga0068856_100001215 3300005614 Bacteria 27010
68 Ga0068856_100001597 3300005614 Bacteria 23684
69 Ga0068856_100002972 3300005614 Bacteria 17366
70 Ga0068856_100003033 3300005614 Bacteria 17203
71 Ga0068852_100002036 3300005616 Bacteria 13778
72 Ga0068859_100002046 3300005617 Bacteria 20602
73 Ga0068866_10018073 3300005718 Bacteria 3184
74 Ga0068863_100004414 3300005841 Bacteria 13871
75 Ga0068863_100029437 3300005841 Bacteria 5242
76 Ga0068863_100040859 3300005841 Bacteria 4409
77 Ga0068858_100001591 3300005842 Bacteria 23143
78 Ga0068858_100003314 3300005842 Bacteria 16035
79 Ga0068858_100118719 3300005842 Unclassified 2472
80 Ga0068860_100030761 3300005843 Bacteria 5162
81 Ga0068860_100092866 3300005843 Bacteria 2876
82 Ga0070717_10002348 3300006028 Bacteria 13333
83 Ga0070717_10024575 3300006028 Bacteria 4787
84 Ga0070716_100003792 3300006173 Bacteria 7167
85 Ga0070716_100075107 3300006173 Bacteria 1999
86 Ga0070712_100000754 3300006175 Bacteria 19137
87 Ga0070712_100001055 3300006175 Bacteria 16643
88 Ga0070712_100003433 3300006175 Bacteria 9748
89 Ga0070712_100006079 3300006175 Bacteria 7472
90 Ga0070712_100020256 3300006175 Bacteria 4351
91 Ga0070712_100034076 3300006175 Bacteria 3450
92 Ga0070712_100142318 3300006175 Bacteria 1832
93 Ga0097621_100000524 3300006237 Bacteria 26915
94 Ga0097621_100000689 3300006237 Bacteria 23667
95 Ga0097621_100003577 3300006237 Bacteria 10742
96 Ga0097621_100064691 3300006237 Bacteria 3008
97 Ga0097621_100074520 3300006237 Bacteria 2811
98 Ga0068871_100000014 3300006358 Bacteria 101648
99 Ga0068871_100000136 3300006358 Bacteria 47129
100 Ga0068871_100017418 3300006358 Bacteria 5437
101 Ga0075434_100013358 3300006871 Bacteria 7809
102 Ga0075434_100066389 3300006871 Bacteria 3593
103 Ga0068865_100003809 3300006881 Bacteria 9059
104 Ga0068865_100021759 3300006881 Bacteria 4174
105 Ga0068865_100058059 3300006881 Bacteria 2702
106 Ga0097620_100002046 3300006931 Bacteria 20602
107 Ga0105240_10018178 3300009093 Bacteria 9451
108 Ga0105240_10027147 3300009093 Bacteria 7501
109 Ga0105240_10033154 3300009093 Bacteria 6675
110 Ga0105240_10089349 3300009093 Bacteria 3768
111 Ga0105245_10015279 3300009098 Bacteria 6690
112 Ga0105247_10028686 3300009101 Bacteria 3368
113 Ga0105243_10078005 3300009148 Bacteria 2696
114 Ga0105241_10032627 3300009174 Bacteria 3905
115 Ga0105241_10044713 3300009174 Bacteria 3356
116 Ga0105242_10061984 3300009176 Bacteria 3077
117 Ga0105248_10001757 3300009177 Bacteria 24112
118 Ga0105248_10015511 3300009177 Bacteria 8400
119 Ga0105248_10168098 3300009177 Unclassified 2472
120 Ga0105237_10014369 3300009545 Bacteria 8283
121 Ga0105237_10065099 3300009545 Bacteria 3642
122 Ga0105237_10155735 3300009545 Bacteria 2282
123 Ga0105238_10004140 3300009551 Bacteria 14389
124 Ga0105238_10032841 3300009551 Bacteria 5282
125 Ga0105238_10077742 3300009551 Bacteria 3309
126 Ga0105249_10011304 3300009553 Bacteria 7837
127 Ga0105239_10040064 3300010375 Bacteria 5132
128 Ga0105239_10056376 3300010375 Bacteria 4310
129 Ga0157371_10006338 3300013102 Bacteria 9788
130 Ga0157369_10000034 3300013105 Bacteria 200710
131 Ga0157374_10000229 3300013296 Bacteria 51865
132 Ga0157374_10001457 3300013296 Bacteria 20006
133 Ga0157374_10002693 3300013296 Bacteria 14931
134 Ga0157374_10009705 3300013296 Bacteria 8264
135 Ga0157378_10000086 3300013297 Bacteria 86864
136 Ga0157378_10001253 3300013297 Bacteria 22864
137 Ga0157378_10007367 3300013297 Bacteria 9614
138 Ga0157378_10011038 3300013297 Bacteria 7906
139 Ga0157378_10073799 3300013297 Bacteria 3068
140 Ga0157378_10118812 3300013297 Bacteria 2434
141 Ga0163162_10000643 3300013306 Bacteria 32332
142 Ga0163162_10087056 3300013306 Bacteria 3202
143 Ga0163162_10093309 3300013306 Bacteria 3095
144 Ga0157372_10000059 3300013307 Bacteria 124697
145 Ga0157372_10000216 3300013307 Bacteria 63844
146 Ga0157375_10004045 3300013308 Bacteria 12722
147 Ga0157375_10049713 3300013308 Bacteria 4110
148 Ga0157375_10131074 3300013308 Bacteria 2626
149 Ga0163163_10122173 3300014325 Bacteria 2638
150 Ga0157379_10007811 3300014968 Bacteria 9264
151 Ga0157379_10090181 3300014968 Bacteria 2750
152 Ga0157376_10001140 3300014969 Bacteria 17446
153 Ga0157376_10037113 3300014969 Bacteria 3952
154 Ga0207692_10065288 3300025898 Bacteria 1898
155 Ga0207680_10002349 3300025903 Bacteria 8793
156 Ga0207647_10010404 3300025904 Bacteria 6570
157 Ga0207699_10005528 3300025906 Bacteria 6060
158 Ga0207645_10008945 3300025907 Bacteria 6954
159 Ga0207684_10000668 3300025910 Bacteria 40657
160 Ga0207684_10035225 3300025910 Bacteria 4251
161 Ga0207654_10019083 3300025911 Bacteria 3611
162 Ga0207707_10003988 3300025912 Bacteria 13103
163 Ga0207707_10063198 3300025912 Bacteria 3222
164 Ga0207695_10004831 3300025913 Bacteria 18191
165 Ga0207695_10013830 3300025913 Bacteria 9600
166 Ga0207695_10078394 3300025913 Bacteria 3352
167 Ga0207671_10013417 3300025914 Bacteria 6524
168 Ga0207693_10001450 3300025915 Bacteria 21001
169 Ga0207693_10003478 3300025915 Bacteria 13436
170 Ga0207693_10007001 3300025915 Bacteria 9315
171 Ga0207693_10007960 3300025915 Bacteria 8704
172 Ga0207693_10008329 3300025915 Bacteria 8484
173 Ga0207663_10002570 3300025916 Bacteria 8732
174 Ga0207663_10003892 3300025916 Bacteria 7376
175 Ga0207663_10005743 3300025916 Bacteria 6281
176 Ga0207663_10017238 3300025916 Bacteria 4020
177 Ga0207663_10105839 3300025916 Bacteria 1900
178 Ga0207657_10007124 3300025919 Bacteria 11481
179 Ga0207652_10005122 3300025921 Bacteria 10635
180 Ga0207652_10007182 3300025921 Bacteria 8986
181 Ga0207652_10017849 3300025921 Bacteria 5813
182 Ga0207652_10079302 3300025921 Bacteria 2868
183 Ga0207646_10000224 3300025922 Bacteria 77511
184 Ga0207646_10007009 3300025922 Bacteria 11545
185 Ga0207694_10007901 3300025924 Bacteria 8053
186 Ga0207687_10006388 3300025927 Bacteria 7790
187 Ga0207687_10012349 3300025927 Bacteria 5584
188 Ga0207687_10024049 3300025927 Bacteria 4066
189 Ga0207700_10000177 3300025928 Bacteria 38178
190 Ga0207700_10002187 3300025928 Bacteria 11212
191 Ga0207700_10002271 3300025928 Bacteria 11034
192 Ga0207700_10013852 3300025928 Bacteria 5265
193 Ga0207700_10069475 3300025928 Unclassified 2703
194 Ga0207700_10069978 3300025928 Bacteria 2696
195 Ga0207664_10000087 3300025929 Bacteria 88607
196 Ga0207664_10013234 3300025929 Bacteria 5913
197 Ga0207664_10059679 3300025929 Unclassified 3039
198 Ga0207706_10000597 3300025933 Bacteria 38406
199 Ga0207665_10000948 3300025939 Bacteria 19619
200 Ga0207665_10006590 3300025939 Bacteria 7699
201 Ga0207665_10021197 3300025939 Bacteria 4271
202 Ga0207665_10025262 3300025939 Bacteria 3918
203 Ga0207665_10036088 3300025939 Unclassified 3286
204 Ga0207665_10036769 3300025939 Bacteria 3258
205 Ga0207665_10066699 3300025939 Bacteria 2449
206 Ga0207711_10002146 3300025941 Bacteria 17771
207 Ga0207711_10007793 3300025941 Bacteria 8953
208 Ga0207689_10022486 3300025942 Bacteria 5302
209 Ga0207661_10018155 3300025944 Bacteria 5226
210 Ga0207661_10032761 3300025944 Bacteria 4030
211 Ga0207667_10001756 3300025949 Bacteria 27273
212 Ga0207667_10005311 3300025949 Bacteria 15694
213 Ga0207667_10008343 3300025949 Bacteria 12315
214 Ga0207667_10029010 3300025949 Bacteria 6006
215 Ga0207640_10078543 3300025981 Bacteria 2247
216 Ga0207677_10001241 3300026023 Bacteria 13750
217 Ga0207677_10025294 3300026023 Bacteria 3701
218 Ga0207703_10004725 3300026035 Bacteria 11114
219 Ga0207678_10003115 3300026067 Bacteria 15007
220 Ga0207702_10001747 3300026078 Bacteria 21380
221 Ga0207702_10005619 3300026078 Bacteria 10941
222 Ga0207641_10027849 3300026088 Bacteria 4668
223 Ga0207641_10098583 3300026088 Bacteria 2570
224 Ga0207648_10010985 3300026089 Bacteria 8553
225 Ga0207648_10052795 3300026089 Bacteria 3554
226 Ga0207674_10027041 3300026116 Bacteria 6078
227 Ga0207698_10042930 3300026142 Bacteria 3384
228 Ga0265354_1000464 3300028016 Bacteria 7041
229 Ga0268266_10017988 3300028379 Bacteria 6026
230 Ga0268264_10054930 3300028381 Bacteria 3327
231 Ga0268264_10082782 3300028381 Bacteria 2747
232 Ga0265338_10002193 3300028800 Bacteria 29914
233 Ga0265338_10007634 3300028800 Bacteria 13347
234 Ga0265338_10042140 3300028800 Bacteria 4257
235 Ga0265330_10004234 3300031235 Bacteria 7316
236 Ga0265316_10000652 3300031344 Bacteria 38558
237 Ga0265316_10000858 3300031344 Bacteria 33524
238 Ga0265316_10012190 3300031344 Bacteria 7714
239 Ga0265314_10000572 3300031711 Bacteria 46833
240 Ga0265314_10007595 3300031711 Bacteria 9387
241 Ga0316212_1005651 3300033547 Bacteria 1816
242 Ga0373954_0020470 3300035118 Unclassified 2993
243 Ga0373943_0011778 3300035170 Unclassified 3936
244 Ga0373931_0039017 3300035691 Bacteria 2487
245 Ga0373935_0099942 3300035692 Bacteria 1911
246 Ga0373947_0058282 3300035725 Unclassified 2340
247 Ga0373937_0030909 3300036401 Bacteria 4849
248 Ga0373925_0127185 3300037068 Unclassified 1983
249 Ga0395905_0000554 3300037471 Bacteria 51115
250 Ga0436364_0277543 3300037853 Unclassified 3563
251 Ga0466963_0047880 3300044694 Bacteria 2823
252 Ga0495580_0001649 3300046472 Bacteria 19642
253 Ga0495580_0001911 3300046472 Bacteria 18315
254 Ga0495580_0012819 3300046472 Bacteria 6424
255 Ga0495580_0014261 3300046472 Bacteria 6033
256 Ga0495580_0064293 3300046472 Bacteria 2572
257 Ga0495664_0024784 3300046477 Unclassified 3488
258 Ga0495587_0008210 3300046536 Bacteria 6726
259 Ga0495674_0016710 3300047319 Bacteria 6846
260 Ga0495674_0082728 3300047319 Bacteria 2752
261 Ga0496100_0005443 3300048903 Bacteria 6857
262 Ga0496100_0052492 3300048903 Bacteria 2651
263 Ga0496102_0002272 3300048905 Bacteria 16435
264 Ga0496102_0039898 3300048905 Bacteria 4244
265 Ga0496103_0006834 3300048906 Bacteria 6810
266 Ga0496104_0070405 3300048907 Bacteria 3325
267 Ga0496107_0059434 3300048910 Bacteria 2766
268 Ga0496112_0005746 3300048915 Bacteria 10784
269 Ga0496112_0006357 3300048915 Bacteria 10370
270 Ga0496112_0042162 3300048915 Bacteria 4465
271 Ga0496115_0017075 3300048918 Bacteria 5536
272 Ga0496115_0172409 3300048918 Bacteria 1789
273 nmdc:mga0n895_45579_c1 3300050512 Bacteria 4279
274 nmdc:mga0rr50_17341_c1 3300050513 Bacteria 4805
275 nmdc:mga08x19_17578_c1 3300050514 Bacteria 4378
276 nmdc:mga0a205_167916_c1 3300050515 Bacteria 2090
277 nmdc:mga0n895_7340_c1
278 rootL2_10049824
279 Ga0065715_10005828
280 Ga0070676_10033519
281 Ga0070683_100026533
282 Ga0068869_100003231
283 Ga0070666_10031266
284 Ga0070680_100016691
285 Ga0068868_100025181
286 Ga0068868_100031051
287 Ga0068868_100039318
288 Ga0070691_10028873
289 Ga0070669_100081488
290 Ga0070703_10006513
291 Ga0070709_10000957
292 Ga0070709_10021606
293 Ga0070709_10045121
294 Ga0070709_10062060
295 Ga0070714_100000096
296 Ga0070713_100002072
297 Ga0070713_100002800
298 Ga0070713_100011349
299 Ga0070713_100023104
300 Ga0070713_100173605
301 Ga0070711_100000159
302 Ga0070711_100000227
303 Ga0070711_100004369
304 Ga0070711_100027179
305 Ga0070708_100001594
306 Ga0070708_100003952
307 Ga0070708_100034801
308 Ga0070708_100060689
309 Ga0070708_100172110
310 Ga0070663_100032688
311 Ga0070662_100018706
312 Ga0070681_10001340
313 Ga0070681_10045726
314 Ga0070685_10039227
315 Ga0070706_100002924
316 Ga0070706_100028436
317 Ga0070706_100133354
318 Ga0070707_100007144
319 Ga0070707_100019380
320 Ga0070698_100004292
321 Ga0070699_100000394
322 Ga0070699_100011800
323 Ga0070679_100106060
324 Ga0070679_100115144
325 Ga0070679_100191431
326 Ga0070684_100014347
327 Ga0070697_100000773
328 Ga0070697_100001045
329 Ga0070697_100004730
330 Ga0070697_100005194
331 Ga0068853_100060733
332 Ga0070695_100011841
333 Ga0070693_100000238
334 Ga0070693_100002339
335 Ga0070693_100057164
336 Ga0070665_100031260
337 Ga0070704_100001668
338 Ga0068855_100000401
339 Ga0068855_100002467
340 Ga0070664_100020689
341 Ga0068857_100019448
342 Ga0068854_100008152
343 Ga0068856_100001215
344 Ga0068856_100001597
345 Ga0068856_100002972
346 Ga0068856_100003033
347 Ga0068852_100002036
348 Ga0068859_100002046
349 Ga0068866_10018073
350 Ga0068863_100004414
351 Ga0068863_100029437
352 Ga0068863_100040859
353 Ga0068858_100001591
354 Ga0068858_100003314
355 Ga0068858_100118719
356 Ga0068860_100030761
357 Ga0068860_100092866
358 Ga0070717_10002348
359 Ga0070717_10024575
360 Ga0070716_100003792
361 Ga0070716_100075107
362 Ga0070712_100000754
363 Ga0070712_100001055
364 Ga0070712_100003433
365 Ga0070712_100006079
366 Ga0070712_100020256
367 Ga0070712_100034076
368 Ga0070712_100142318
369 Ga0097621_100000524
370 Ga0097621_100000689
371 Ga0097621_100003577
372 Ga0097621_100064691
373 Ga0097621_100074520
374 Ga0068871_100000014
375 Ga0068871_100000136
376 Ga0068871_100017418
377 Ga0075434_100013358
378 Ga0075434_100066389
379 Ga0068865_100003809
380 Ga0068865_100021759
381 Ga0068865_100058059
382 Ga0097620_100002046
383 Ga0105240_10018178
384 Ga0105240_10027147
385 Ga0105240_10033154
386 Ga0105240_10089349
387 Ga0105245_10015279
388 Ga0105247_10028686
389 Ga0105243_10078005
390 Ga0105241_10032627
391 Ga0105241_10044713
392 Ga0105242_10061984
393 Ga0105248_10001757
394 Ga0105248_10015511
395 Ga0105248_10168098
396 Ga0105237_10014369
397 Ga0105237_10065099
398 Ga0105237_10155735
399 Ga0105238_10004140
400 Ga0105238_10032841
401 Ga0105238_10077742
402 Ga0105249_10011304
403 Ga0105239_10040064
404 Ga0105239_10056376
405 Ga0157371_10006338
406 Ga0157369_10000034
407 Ga0157374_10000229
408 Ga0157374_10001457
409 Ga0157374_10002693
410 Ga0157374_10009705
411 Ga0157378_10000086
412 Ga0157378_10001253
413 Ga0157378_10007367
414 Ga0157378_10011038
415 Ga0157378_10073799
416 Ga0157378_10118812
417 Ga0163162_10000643
418 Ga0163162_10087056
419 Ga0163162_10093309
420 Ga0157372_10000059
421 Ga0157372_10000216
422 Ga0157375_10004045
423 Ga0157375_10049713
424 Ga0157375_10131074
425 Ga0163163_10122173
426 Ga0157379_10007811
427 Ga0157379_10090181
428 Ga0157376_10001140
429 Ga0157376_10037113
430 Ga0207692_10065288
431 Ga0207680_10002349
432 Ga0207647_10010404
433 Ga0207699_10005528
434 Ga0207645_10008945
435 Ga0207684_10000668
436 Ga0207684_10035225
437 Ga0207654_10019083
438 Ga0207707_10003988
439 Ga0207707_10063198
440 Ga0207695_10004831
441 Ga0207695_10013830
442 Ga0207695_10078394
443 Ga0207671_10013417
444 Ga0207693_10001450
445 Ga0207693_10003478
446 Ga0207693_10007001
447 Ga0207693_10007960
448 Ga0207693_10008329
449 Ga0207663_10002570
450 Ga0207663_10003892
451 Ga0207663_10005743
452 Ga0207663_10017238
453 Ga0207663_10105839
454 Ga0207657_10007124
455 Ga0207652_10005122
456 Ga0207652_10007182
457 Ga0207652_10017849
458 Ga0207652_10079302
459 Ga0207646_10000224
460 Ga0207646_10007009
461 Ga0207694_10007901
462 Ga0207687_10006388
463 Ga0207687_10012349
464 Ga0207687_10024049
465 Ga0207700_10000177
466 Ga0207700_10002187
467 Ga0207700_10002271
468 Ga0207700_10013852
469 Ga0207700_10069475
470 Ga0207700_10069978
471 Ga0207664_10000087
472 Ga0207664_10013234
473 Ga0207664_10059679
474 Ga0207706_10000597
475 Ga0207665_10000948
476 Ga0207665_10006590
477 Ga0207665_10021197
478 Ga0207665_10025262
479 Ga0207665_10036088
480 Ga0207665_10036769
481 Ga0207665_10066699
482 Ga0207711_10002146
483 Ga0207711_10007793
484 Ga0207689_10022486
485 Ga0207661_10018155
486 Ga0207661_10032761
487 Ga0207667_10001756
488 Ga0207667_10005311
489 Ga0207667_10008343
490 Ga0207667_10029010
491 Ga0207640_10078543
492 Ga0207677_10001241
493 Ga0207677_10025294
494 Ga0207703_10004725
495 Ga0207678_10003115
496 Ga0207702_10001747
497 Ga0207702_10005619
498 Ga0207641_10027849
499 Ga0207641_10098583
500 Ga0207648_10010985
501 Ga0207648_10052795
502 Ga0207674_10027041
503 Ga0207698_10042930
504 Ga0265354_1000464
505 Ga0268266_10017988
506 Ga0268264_10054930
507 Ga0268264_10082782
508 Ga0265338_10002193
509 Ga0265338_10007634
510 Ga0265338_10042140
511 Ga0265330_10004234
512 Ga0265316_10000652
513 Ga0265316_10000858
514 Ga0265316_10012190
515 Ga0265314_10000572
516 Ga0265314_10007595
517 Ga0316212_1005651
518 Ga0373954_0020470
519 Ga0373943_0011778
520 Ga0373931_0039017
521 Ga0373935_0099942
522 Ga0373947_0058282
523 Ga0373937_0030909
524 Ga0373925_0127185
525 Ga0395905_0000554
526 Ga0436364_0277543
527 Ga0466963_0047880
528 Ga0495580_0001649
529 Ga0495580_0001911
530 Ga0495580_0012819
531 Ga0495580_0014261
532 Ga0495580_0064293
533 Ga0495664_0024784
534 Ga0495587_0008210
535 Ga0495674_0016710
536 Ga0495674_0082728
537 Ga0496100_0005443
538 Ga0496100_0052492
539 Ga0496102_0002272
540 Ga0496102_0039898
541 Ga0496103_0006834
542 Ga0496104_0070405
543 Ga0496107_0059434
544 Ga0496112_0005746
545 Ga0496112_0006357
546 Ga0496112_0042162
547 Ga0496115_0017075
548 Ga0496115_0172409
549 nmdc:mga0n895_45579_c1
550 nmdc:mga0rr50_17341_c1
551 nmdc:mga08x19_17578_c1
552 nmdc:mga0a205_167916_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01120

Alpha_L_fucos

Alpha-L-fucosidase

90

459

0.9

PF16757

Fucosidase_C

Alpha-L-fucosidase C-terminal domain

488

571

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lk7-assembly1.cif.gz_A structure of the exo-alpha-l-galactosidase bpgh29 from bacteroides plebeius in complex with l-galactose 0.9227 72 541
7lnp-assembly2.cif.gz_C structure of the exo-alpha-l-galactosidase bpgh29 (d264n mutant) from bacteroides plebeius in complex with paranitrophenyl-alpha-l-galactopyranoside 0.9161 72 539
7lnp-assembly3.cif.gz_D structure of the exo-alpha-l-galactosidase bpgh29 (d264n mutant) from bacteroides plebeius in complex with paranitrophenyl-alpha-l-galactopyranoside 0.9072 74 539
7lnp-assembly4.cif.gz_E structure of the exo-alpha-l-galactosidase bpgh29 (d264n mutant) from bacteroides plebeius in complex with paranitrophenyl-alpha-l-galactopyranoside 0.906 74 539
7snk-assembly1.cif.gz_A structure of bacple_01702, a gh29 family glycoside hydrolase 0.898 74 541
ID Description Score Start End Superfamily
af_Q99LJ1_352_452_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8338 430 542 2.60.40.1180
af_Q99LJ1_352_452_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8268 430 542 2.60.40.1180
4pspA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8219 74 434 3.20.20.80
4pspA02 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8115 436 541 2.60.40.1180
af_P04066_33_365_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8111 73 429 3.20.20.80
ID Description Score Start End GO Terms
AF-X0YNS7-F1-model_v4 Alpha-L-fucosidase C-terminal domain-containing protein 0.9574 379 542 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-A0A369ULU6-F1-model_v4 Alpha-L-fucosidase 0.9415 39 541 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-G7TBU2-F1-model_v4 Alpha-L-fucosidase 0.9402 39 541 GO:0004560
GO:0005764
GO:0006004
GO:0016139
AF-H8FAK6-F1-model_v4 deleted 0.9379 39 541
AF-A0A075JV43-F1-model_v4 Alpha-L-fucosidase 0.9378 40 542 GO:0004560
GO:0005764
GO:0006004
GO:0016139

Map