F376270

General Info

Members Datasets Scaffolds Average Seq Length
269 177 538 173

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10695328|Ga0207648_106953282
Length 187
Sequence VTLPMDPGRRRRPGPPEGVPEVFVADEQSDVPVELDALAQLAEGVLREEGVRGACELSLYFVDEHTIAELNEKFLGGTGPTDVLAFPMDDDLVLPGRQPDQGGRGPGTTAEPGDPPTLLGDVVVCPSVAVRQAAERGVSADDELALLVVHGVLHLLDYDHAEHSEGVVMRRREQELLSRFRELEQRS

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
92 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
93 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
94 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
95 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.95
Nodule 0
Rhizoplane 15.99
Rhizosphere 78.07
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10695328 3300026089 Bacteria 942
2 Ga0070658_10769556 3300005327 Bacteria 836
3 Ga0070690_100305496 3300005330 Bacteria 1142
4 Ga0068868_100484551 3300005338 Bacteria 1081
5 Ga0070671_100000898 3300005355 Bacteria 21691
6 Ga0070671_100712418 3300005355 Bacteria 871
7 Ga0070688_100221653 3300005365 Bacteria 1333
8 Ga0070703_10094733 3300005406 Bacteria 1042
9 Ga0070713_100215614 3300005436 Bacteria 1740
10 Ga0070713_100274882 3300005436 Bacteria 1544
11 Ga0070713_100777467 3300005436 Bacteria 917
12 Ga0070700_101045688 3300005441 Bacteria 674
13 Ga0070694_100502609 3300005444 Bacteria 965
14 Ga0070708_100068293 3300005445 Bacteria 3194
15 Ga0070708_100131049 3300005445 Bacteria 2320
16 Ga0070708_100165129 3300005445 Bacteria 2065
17 Ga0070678_100252661 3300005456 Bacteria 1479
18 Ga0070681_10051496 3300005458 Bacteria 4107
19 Ga0070706_100070913 3300005467 Bacteria 3223
20 Ga0070707_100074172 3300005468 Bacteria 3281
21 Ga0070698_100318061 3300005471 Bacteria 1487
22 Ga0070699_101042957 3300005518 Bacteria 750
23 Ga0070679_100726507 3300005530 Bacteria 936
24 Ga0070684_100961778 3300005535 Bacteria 801
25 Ga0070697_100977741 3300005536 Bacteria 752
26 Ga0070686_100335050 3300005544 Bacteria 1132
27 Ga0070695_100037724 3300005545 Bacteria 3047
28 Ga0070695_100115333 3300005545 Bacteria 1830
29 Ga0070696_100358558 3300005546 Bacteria 1131
30 Ga0070693_100029410 3300005547 Bacteria 2997
31 Ga0070665_101012751 3300005548 Bacteria 843
32 Ga0070704_100034805 3300005549 Bacteria 3419
33 Ga0070704_100223020 3300005549 Bacteria 1534
34 Ga0068859_100668853 3300005617 Bacteria 1130
35 Ga0068866_10355716 3300005718 Bacteria 932
36 Ga0068861_100725912 3300005719 Bacteria 926
37 Ga0068858_100103441 3300005842 Bacteria 2657
38 Ga0068860_100865060 3300005843 Bacteria 919
39 Ga0068860_101745954 3300005843 Bacteria 644
40 Ga0081455_10350053 3300005937 Bacteria 1042
41 Ga0081539_10022365 3300005985 Bacteria 4186
42 Ga0075365_10010092 3300006038 Bacteria 5477
43 Ga0075365_10048287 3300006038 Bacteria 2801
44 Ga0075365_10136805 3300006038 Bacteria 1698
45 Ga0075365_10791449 3300006038 Bacteria 669
46 Ga0075363_100367357 3300006048 Bacteria 842
47 Ga0075364_10108016 3300006051 Bacteria 1855
48 Ga0075364_10218073 3300006051 Bacteria 1294
49 Ga0070716_100289119 3300006173 Bacteria 1135
50 Ga0070712_100339733 3300006175 Bacteria 1226
51 Ga0075434_100111904 3300006871 Bacteria 2741
52 Ga0068865_100748442 3300006881 Bacteria 839
53 Ga0097620_100668823 3300006931 Bacteria 1130
54 Ga0105240_10493467 3300009093 Bacteria 1363
55 Ga0111539_10151633 3300009094 Bacteria 2713
56 Ga0105245_10114519 3300009098 Bacteria 2512
57 Ga0105245_10203077 3300009098 Bacteria 1904
58 Ga0105245_10956189 3300009098 Bacteria 900
59 Ga0105247_10467639 3300009101 Bacteria 912
60 Ga0105247_10745110 3300009101 Bacteria 742
61 Ga0114129_11973559 3300009147 Bacteria 706
62 Ga0105243_10439589 3300009148 Bacteria 1221
63 Ga0105248_10630918 3300009177 Bacteria 1209
64 Ga0105249_10210816 3300009553 Bacteria 1906
65 Ga0105239_10123382 3300010375 Bacteria 2878
66 Ga0157378_10172103 3300013297 Bacteria 2031
67 Ga0157375_10876107 3300013308 Bacteria 1043
68 Ga0157375_11347343 3300013308 Bacteria 840
69 Ga0157375_12012147 3300013308 Bacteria 687
70 Ga0163163_10073385 3300014325 Bacteria 3412
71 Ga0157380_11494113 3300014326 Unclassified 728
72 Ga0157376_11441192 3300014969 Unclassified 721
73 Ga0163161_11018562 3300017792 Bacteria 708
74 Ga0206353_11483710 3300020082 Bacteria 790
75 Ga0207699_10040976 3300025906 Bacteria 2672
76 Ga0207705_10584487 3300025909 Bacteria 868
77 Ga0207684_10056000 3300025910 Bacteria 3345
78 Ga0207707_10044144 3300025912 Bacteria 3887
79 Ga0207693_10106560 3300025915 Bacteria 2199
80 Ga0207693_10537427 3300025915 Bacteria 912
81 Ga0207663_10057660 3300025916 Bacteria 2448
82 Ga0207652_10819027 3300025921 Bacteria 826
83 Ga0207687_10021612 3300025927 Bacteria 4276
84 Ga0207687_10050719 3300025927 Bacteria 2890
85 Ga0207687_10472480 3300025927 Bacteria 1043
86 Ga0207700_10095922 3300025928 Bacteria 2353
87 Ga0207700_10344930 3300025928 Bacteria 1295
88 Ga0207700_10565954 3300025928 Bacteria 1010
89 Ga0207644_10004446 3300025931 Bacteria 9104
90 Ga0207644_10244739 3300025931 Bacteria 1429
91 Ga0207686_10100074 3300025934 Bacteria 1933
92 Ga0207686_10128562 3300025934 Bacteria 1735
93 Ga0207704_10569344 3300025938 Bacteria 923
94 Ga0207704_10583134 3300025938 Bacteria 913
95 Ga0207665_10330173 3300025939 Bacteria 1147
96 Ga0207711_10617755 3300025941 Bacteria 1011
97 Ga0207667_10268557 3300025949 Bacteria 1744
98 Ga0207712_10281047 3300025961 Bacteria 1358
99 Ga0207658_10667882 3300025986 Bacteria 938
100 Ga0207677_10271533 3300026023 Bacteria 1387
101 Ga0207703_10049377 3300026035 Bacteria 3401
102 Ga0207702_10888521 3300026078 Bacteria 883
103 Ga0207675_100655397 3300026118 Bacteria 1056
104 Ga0207683_10309730 3300026121 Bacteria 1445
105 Ga0207683_10911570 3300026121 Bacteria 816
106 Ga0268266_10101125 3300028379 Bacteria 2541
107 Ga0268266_11045871 3300028379 Bacteria 790
108 Ga0268264_10760679 3300028381 Unclassified 966
109 Ga0265322_10156219 3300028654 Bacteria 652
110 Ga0265338_10001373 3300028800 Bacteria 39593
111 Ga0265330_10084736 3300031235 Bacteria 1364
112 Ga0265325_10011381 3300031241 Bacteria 5112
113 Ga0265340_10262187 3300031247 Unclassified 769
114 Ga0265339_10019923 3300031249 Bacteria 3927
115 Ga0265327_10006979 3300031251 Bacteria 8860
116 Ga0265327_10060100 3300031251 Bacteria 1944
117 Ga0307412_10821288 3300031911 Bacteria 809
118 Ga0307415_100520392 3300032126 Bacteria 1044
119 Ga0373948_0012645 3300034817 Bacteria 1510
120 Ga0373928_0044428 3300035084 Bacteria 1031
121 Ga0373928_0113771 3300035084 Bacteria 718
122 Ga0373929_0000433 3300035085 Bacteria 7906
123 Ga0373932_0000047 3300035112 Bacteria 29179
124 Ga0373932_0072965 3300035112 Bacteria 1069
125 Ga0373941_0429048 3300035115 Bacteria 551
126 Ga0373931_0000001 3300035691 Bacteria 634029
127 Ga0373931_0000066 3300035691 Bacteria 53417
128 Ga0373931_0084769 3300035691 Bacteria 1755
129 Ga0373927_0504083 3300035695 Bacteria 800
130 Ga0373933_0827486 3300035724 Bacteria 609
131 Ga0373947_0257840 3300035725 Bacteria 1155
132 Ga0373937_0176828 3300036401 Bacteria 2004
133 Ga0373925_0269579 3300037068 Bacteria 1369
134 Ga0439434_0081663 3300042435 Unclassified 1026
135 Ga0466963_0405092 3300044694 Bacteria 962
136 Ga0466959_0161520 3300045049 Bacteria 1575
137 Ga0466958_0102484 3300045836 Bacteria 1781
138 Ga0466958_0244110 3300045836 Bacteria 1148
139 Ga0495629_0248294 3300046459 Bacteria 1225
140 Ga0495629_0529817 3300046459 Bacteria 792
141 Ga0495641_0239867 3300046461 Bacteria 814
142 Ga0495605_0158715 3300046474 Unclassified 1005
143 Ga0495639_0218822 3300046475 Bacteria 936
144 Ga0495664_0091189 3300046477 Bacteria 1832
145 Ga0495584_0012367 3300046491 Bacteria 4357
146 Ga0495584_0197072 3300046491 Bacteria 1024
147 Ga0495608_0341640 3300046511 Bacteria 922
148 Ga0495608_0591753 3300046511 Bacteria 666
149 Ga0495628_0210048 3300046516 Bacteria 1464
150 Ga0495630_0032092 3300046517 Bacteria 3911
151 Ga0495630_0064221 3300046517 Bacteria 2758
152 Ga0495630_0120623 3300046517 Bacteria 1989
153 Ga0495630_0291682 3300046517 Unclassified 1247
154 Ga0495630_0443913 3300046517 Bacteria 994
155 Ga0495630_0589251 3300046517 Bacteria 852
156 Ga0495640_0028250 3300046533 Bacteria 4040
157 Ga0495587_0129823 3300046536 Bacteria 1441
158 Ga0495667_0058262 3300046559 Bacteria 2538
159 Ga0495635_0180076 3300046663 Bacteria 1437
160 Ga0495635_0539386 3300046663 Bacteria 765
161 Ga0495635_0722229 3300046663 Bacteria 645
162 Ga0495659_0282731 3300046664 Bacteria 697
163 Ga0495599_0110942 3300046678 Bacteria 1709
164 Ga0495599_0399418 3300046678 Bacteria 819
165 Ga0495647_0339660 3300046681 Bacteria 682
166 Ga0495658_0220087 3300046683 Bacteria 1188
167 Ga0495658_0228399 3300046683 Bacteria 1167
168 Ga0495613_0121989 3300046689 Bacteria 1871
169 Ga0495613_0447262 3300046689 Bacteria 876
170 Ga0495624_0474949 3300046690 Bacteria 749
171 Ga0495589_0429958 3300046794 Bacteria 605
172 Ga0495604_0134290 3300047317 Bacteria 1775
173 Ga0495676_0027513 3300047321 Bacteria 4873
174 Ga0495676_0159359 3300047321 Bacteria 1598
175 Ga0495676_0164591 3300047321 Bacteria 1566
176 Ga0495680_0150641 3300047322 Bacteria 1696
177 Ga0495675_0322031 3300047444 Bacteria 914
178 Ga0495593_0392749 3300047673 Bacteria 694
179 Ga0495614_0314554 3300048089 Bacteria 725
180 Ga0496100_0085842 3300048903 Bacteria 2137
181 Ga0496101_0356884 3300048904 Bacteria 1149
182 Ga0496101_0492905 3300048904 Unclassified 968
183 Ga0496102_0075396 3300048905 Bacteria 3101
184 Ga0496102_0115811 3300048905 Bacteria 2501
185 Ga0496103_0043197 3300048906 Bacteria 2775
186 Ga0496103_0107351 3300048906 Bacteria 1771
187 Ga0496104_0180877 3300048907 Bacteria 2019
188 Ga0496104_0238476 3300048907 Bacteria 1730
189 Ga0496104_0345497 3300048907 Bacteria 1401
190 Ga0496104_0793981 3300048907 Bacteria 853
191 Ga0496104_1186345 3300048907 Bacteria 667
192 Ga0496105_0222240 3300048908 Bacteria 1537
193 Ga0496105_0242254 3300048908 Bacteria 1463
194 Ga0496105_0685933 3300048908 Bacteria 788
195 Ga0496105_1014895 3300048908 Bacteria 620
196 Ga0496106_0071047 3300048909 Bacteria 2660
197 Ga0496107_0095246 3300048910 Bacteria 2178
198 Ga0496108_0006729 3300048911 Bacteria 9309
199 Ga0496108_0096188 3300048911 Bacteria 2522
200 Ga0496108_0323319 3300048911 Bacteria 1345
201 Ga0496109_0002607 3300048912 Bacteria 15112
202 Ga0496109_0100467 3300048912 Bacteria 2684
203 Ga0496109_0180781 3300048912 Bacteria 1981
204 Ga0496109_0343842 3300048912 Bacteria 1409
205 Ga0496109_0675207 3300048912 Bacteria 970
206 Ga0496109_0897342 3300048912 Bacteria 824
207 Ga0496110_0256533 3300048913 Bacteria 1592
208 Ga0496110_0406611 3300048913 Bacteria 1241
209 Ga0496110_0589218 3300048913 Bacteria 1009
210 Ga0496110_0883701 3300048913 Bacteria 799
211 Ga0496110_0953745 3300048913 Bacteria 765
212 Ga0496111_0306339 3300048914 Bacteria 1177
213 Ga0496112_0003923 3300048915 Bacteria 12455
214 Ga0496112_0004455 3300048915 Bacteria 11871
215 Ga0496112_0701458 3300048915 Bacteria 940
216 Ga0496112_1100889 3300048915 Bacteria 713
217 Ga0496113_0036150 3300048916 Bacteria 3617
218 Ga0496113_0420689 3300048916 Bacteria 1073
219 Ga0496114_0054893 3300048917 Bacteria 3322
220 Ga0496114_0281128 3300048917 Bacteria 1467
221 Ga0496115_0070644 3300048918 Bacteria 2831
222 Ga0496115_0082889 3300048918 Bacteria 2613
223 Ga0501032_0269663 3300049569 Bacteria 1103
224 Ga0501034_0002631 3300049571 Bacteria 21286
225 Ga0501036_0041773 3300049572 Bacteria 3880
226 Ga0501038_0227286 3300049574 Bacteria 1487
227 Ga0501043_0266477 3300049579 Bacteria 1316
228 Ga0501046_0023530 3300049580 Bacteria 5066
229 Ga0501047_0064677 3300049581 Bacteria 3527
230 Ga0501047_0280790 3300049581 Bacteria 1510
231 Ga0501047_1090682 3300049581 Bacteria 612
232 Ga0501048_0184750 3300049582 Bacteria 1478
233 Ga0501068_0114421 3300049584 Bacteria 1679
234 Ga0501070_0031129 3300049586 Bacteria 4469
235 Ga0501072_0156727 3300049588 Bacteria 1816
236 Ga0501072_0997286 3300049588 Bacteria 653
237 Ga0501072_1232088 3300049588 Bacteria 581
238 Ga0501074_0778803 3300049590 Bacteria 674
239 Ga0501075_0268644 3300049591 Bacteria 1300
240 Ga0501079_0410959 3300049741 Bacteria 1062
241 Ga0501080_0591851 3300049742 Bacteria 985
242 Ga0501081_0158277 3300049743 Bacteria 1631
243 Ga0501083_0437036 3300049744 Bacteria 851
244 Ga0501083_0477727 3300049744 Bacteria 811
245 Ga0501044_0104850 3300049823 Bacteria 2840
246 Ga0501044_0818821 3300049823 Bacteria 809
247 nmdc:mga03n38_690698_c1 3300050490 Bacteria 587
248 nmdc:mga00v17_230084_c1 3300050491 Bacteria 1201
249 nmdc:mga00v17_33105_c1 3300050491 Bacteria 1888
250 nmdc:mga0yw44_219_c1 3300050492 Bacteria 20235
251 nmdc:mga0yw44_4540_c2 3300050492 Bacteria 3714
252 nmdc:mga0yw44_462068_c1 3300050492 Bacteria 860
253 nmdc:mga0yw44_6558_c1 3300050492 Bacteria 5635
254 nmdc:mga05p37_1217155_c1 3300050507 Bacteria 776
255 nmdc:mga0n895_108594_c1 3300050512 Bacteria 2789
256 Ga0495601_0006817 3300053077 Bacteria 6690
257 Ga0495601_0171129 3300053077 Bacteria 1420
258 Ga0495601_0173212 3300053077 Bacteria 1411
259 Ga0495601_0216099 3300053077 Bacteria 1252
260 Ga0495612_0142084 3300053078 Bacteria 1042
261 Ga0495612_0424453 3300053078 Unclassified 606
262 Ga0495595_0439397 3300053084 Bacteria 663
263 Ga0495619_0022887 3300053085 Bacteria 4000
264 Ga0495619_0137801 3300053085 Bacteria 1679
265 Ga0495619_0346219 3300053085 Unclassified 1028
266 Ga0500566_0000188 3300053094 Bacteria 32092
267 Ga0500616_0007681 3300053153 Bacteria 6810
268 Ga0501084_0000073 3300054114 Bacteria 75652
269 Ga0501084_0238126 3300054114 Bacteria 1536
270 Ga0207648_10695328
271 Ga0070658_10769556
272 Ga0070690_100305496
273 Ga0068868_100484551
274 Ga0070671_100000898
275 Ga0070671_100712418
276 Ga0070688_100221653
277 Ga0070703_10094733
278 Ga0070713_100215614
279 Ga0070713_100274882
280 Ga0070713_100777467
281 Ga0070700_101045688
282 Ga0070694_100502609
283 Ga0070708_100068293
284 Ga0070708_100131049
285 Ga0070708_100165129
286 Ga0070678_100252661
287 Ga0070681_10051496
288 Ga0070706_100070913
289 Ga0070707_100074172
290 Ga0070698_100318061
291 Ga0070699_101042957
292 Ga0070679_100726507
293 Ga0070684_100961778
294 Ga0070697_100977741
295 Ga0070686_100335050
296 Ga0070695_100037724
297 Ga0070695_100115333
298 Ga0070696_100358558
299 Ga0070693_100029410
300 Ga0070665_101012751
301 Ga0070704_100034805
302 Ga0070704_100223020
303 Ga0068859_100668853
304 Ga0068866_10355716
305 Ga0068861_100725912
306 Ga0068858_100103441
307 Ga0068860_100865060
308 Ga0068860_101745954
309 Ga0081455_10350053
310 Ga0081539_10022365
311 Ga0075365_10010092
312 Ga0075365_10048287
313 Ga0075365_10136805
314 Ga0075365_10791449
315 Ga0075363_100367357
316 Ga0075364_10108016
317 Ga0075364_10218073
318 Ga0070716_100289119
319 Ga0070712_100339733
320 Ga0075434_100111904
321 Ga0068865_100748442
322 Ga0097620_100668823
323 Ga0105240_10493467
324 Ga0111539_10151633
325 Ga0105245_10114519
326 Ga0105245_10203077
327 Ga0105245_10956189
328 Ga0105247_10467639
329 Ga0105247_10745110
330 Ga0114129_11973559
331 Ga0105243_10439589
332 Ga0105248_10630918
333 Ga0105249_10210816
334 Ga0105239_10123382
335 Ga0157378_10172103
336 Ga0157375_10876107
337 Ga0157375_11347343
338 Ga0157375_12012147
339 Ga0163163_10073385
340 Ga0157380_11494113
341 Ga0157376_11441192
342 Ga0163161_11018562
343 Ga0206353_11483710
344 Ga0207699_10040976
345 Ga0207705_10584487
346 Ga0207684_10056000
347 Ga0207707_10044144
348 Ga0207693_10106560
349 Ga0207693_10537427
350 Ga0207663_10057660
351 Ga0207652_10819027
352 Ga0207687_10021612
353 Ga0207687_10050719
354 Ga0207687_10472480
355 Ga0207700_10095922
356 Ga0207700_10344930
357 Ga0207700_10565954
358 Ga0207644_10004446
359 Ga0207644_10244739
360 Ga0207686_10100074
361 Ga0207686_10128562
362 Ga0207704_10569344
363 Ga0207704_10583134
364 Ga0207665_10330173
365 Ga0207711_10617755
366 Ga0207667_10268557
367 Ga0207712_10281047
368 Ga0207658_10667882
369 Ga0207677_10271533
370 Ga0207703_10049377
371 Ga0207702_10888521
372 Ga0207675_100655397
373 Ga0207683_10309730
374 Ga0207683_10911570
375 Ga0268266_10101125
376 Ga0268266_11045871
377 Ga0268264_10760679
378 Ga0265322_10156219
379 Ga0265338_10001373
380 Ga0265330_10084736
381 Ga0265325_10011381
382 Ga0265340_10262187
383 Ga0265339_10019923
384 Ga0265327_10006979
385 Ga0265327_10060100
386 Ga0307412_10821288
387 Ga0307415_100520392
388 Ga0373948_0012645
389 Ga0373928_0044428
390 Ga0373928_0113771
391 Ga0373929_0000433
392 Ga0373932_0000047
393 Ga0373932_0072965
394 Ga0373941_0429048
395 Ga0373931_0000001
396 Ga0373931_0000066
397 Ga0373931_0084769
398 Ga0373927_0504083
399 Ga0373933_0827486
400 Ga0373947_0257840
401 Ga0373937_0176828
402 Ga0373925_0269579
403 Ga0439434_0081663
404 Ga0466963_0405092
405 Ga0466959_0161520
406 Ga0466958_0102484
407 Ga0466958_0244110
408 Ga0495629_0248294
409 Ga0495629_0529817
410 Ga0495641_0239867
411 Ga0495605_0158715
412 Ga0495639_0218822
413 Ga0495664_0091189
414 Ga0495584_0012367
415 Ga0495584_0197072
416 Ga0495608_0341640
417 Ga0495608_0591753
418 Ga0495628_0210048
419 Ga0495630_0032092
420 Ga0495630_0064221
421 Ga0495630_0120623
422 Ga0495630_0291682
423 Ga0495630_0443913
424 Ga0495630_0589251
425 Ga0495640_0028250
426 Ga0495587_0129823
427 Ga0495667_0058262
428 Ga0495635_0180076
429 Ga0495635_0539386
430 Ga0495635_0722229
431 Ga0495659_0282731
432 Ga0495599_0110942
433 Ga0495599_0399418
434 Ga0495647_0339660
435 Ga0495658_0220087
436 Ga0495658_0228399
437 Ga0495613_0121989
438 Ga0495613_0447262
439 Ga0495624_0474949
440 Ga0495589_0429958
441 Ga0495604_0134290
442 Ga0495676_0027513
443 Ga0495676_0159359
444 Ga0495676_0164591
445 Ga0495680_0150641
446 Ga0495675_0322031
447 Ga0495593_0392749
448 Ga0495614_0314554
449 Ga0496100_0085842
450 Ga0496101_0356884
451 Ga0496101_0492905
452 Ga0496102_0075396
453 Ga0496102_0115811
454 Ga0496103_0043197
455 Ga0496103_0107351
456 Ga0496104_0180877
457 Ga0496104_0238476
458 Ga0496104_0345497
459 Ga0496104_0793981
460 Ga0496104_1186345
461 Ga0496105_0222240
462 Ga0496105_0242254
463 Ga0496105_0685933
464 Ga0496105_1014895
465 Ga0496106_0071047
466 Ga0496107_0095246
467 Ga0496108_0006729
468 Ga0496108_0096188
469 Ga0496108_0323319
470 Ga0496109_0002607
471 Ga0496109_0100467
472 Ga0496109_0180781
473 Ga0496109_0343842
474 Ga0496109_0675207
475 Ga0496109_0897342
476 Ga0496110_0256533
477 Ga0496110_0406611
478 Ga0496110_0589218
479 Ga0496110_0883701
480 Ga0496110_0953745
481 Ga0496111_0306339
482 Ga0496112_0003923
483 Ga0496112_0004455
484 Ga0496112_0701458
485 Ga0496112_1100889
486 Ga0496113_0036150
487 Ga0496113_0420689
488 Ga0496114_0054893
489 Ga0496114_0281128
490 Ga0496115_0070644
491 Ga0496115_0082889
492 Ga0501032_0269663
493 Ga0501034_0002631
494 Ga0501036_0041773
495 Ga0501038_0227286
496 Ga0501043_0266477
497 Ga0501046_0023530
498 Ga0501047_0064677
499 Ga0501047_0280790
500 Ga0501047_1090682
501 Ga0501048_0184750
502 Ga0501068_0114421
503 Ga0501070_0031129
504 Ga0501072_0156727
505 Ga0501072_0997286
506 Ga0501072_1232088
507 Ga0501074_0778803
508 Ga0501075_0268644
509 Ga0501079_0410959
510 Ga0501080_0591851
511 Ga0501081_0158277
512 Ga0501083_0437036
513 Ga0501083_0477727
514 Ga0501044_0104850
515 Ga0501044_0818821
516 nmdc:mga03n38_690698_c1
517 nmdc:mga00v17_230084_c1
518 nmdc:mga00v17_33105_c1
519 nmdc:mga0yw44_219_c1
520 nmdc:mga0yw44_4540_c2
521 nmdc:mga0yw44_462068_c1
522 nmdc:mga0yw44_6558_c1
523 nmdc:mga05p37_1217155_c1
524 nmdc:mga0n895_108594_c1
525 Ga0495601_0006817
526 Ga0495601_0171129
527 Ga0495601_0173212
528 Ga0495601_0216099
529 Ga0495612_0142084
530 Ga0495612_0424453
531 Ga0495595_0439397
532 Ga0495619_0022887
533 Ga0495619_0137801
534 Ga0495619_0346219
535 Ga0500566_0000188
536 Ga0500616_0007681
537 Ga0501084_0000073
538 Ga0501084_0238126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02130

YbeY

Endoribonuclease YbeY

29

180

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.8641 4 164
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.8607 4 162
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.8266 4 162
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.8258 1 164
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.7947 4 164
ID Description Score Start End Superfamily
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8702 5 176 3.40.390.30
1oz9A00 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8607 4 162 3.40.390.30
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8445 5 176 3.40.390.30
af_Q2FY02_5_155_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8389 8 164 3.40.390.30
af_A0A0R0GDI7_137_270_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8277 29 164 3.40.390.30
ID Description Score Start End GO Terms
AF-A0A522YH06-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9316 1 164 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A2N6ALM0-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9305 2 167 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A2H0LJB5-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9297 1 162 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A0T6APV5-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9272 5 171 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A520XNX9-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9251 4 165 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270

Map