F374970

General Info

Members Datasets Scaffolds Average Seq Length
267 188 534 121

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0126328|Ga0466969_0126328_236_664
Length 142
Sequence MISLPSPPAAAPRLDIAFPFQPDRRGRTAESGYDDHVREMIEQLLFTSPGERVMRPDYGCGLLDLVFSPNSPELASALTLSVQAALQRWRGDVIEIFSLSVTSGDSTVEVDLSYLIRPTGTVATEVFLASPTGSSTSTGSAA

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
183 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
184 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
185 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
186 2904699407
187 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
188 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0
Rhizoplane 3
Rhizosphere 92.88
Stem 0
Stem Tuber 0
Unclassified 10.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0126328 3300044656 Bacteria 1188
2 MBSR1b_contig_4579130 2162886012 Bacteria 1087
3 JGI25406J46586_10023980 3300003203 Bacteria 2400
4 JGI25404J52841_10082055 3300003659 Bacteria 674
5 Ga0065712_10175291 3300005290 Bacteria 1221
6 Ga0065715_10092794 3300005293 Bacteria 4935
7 Ga0065715_10105270 3300005293 Unclassified 2905
8 Ga0070658_10011873 3300005327 Bacteria 6995
9 Ga0070670_100667457 3300005331 Bacteria 933
10 Ga0068869_100113390 3300005334 Unclassified 2065
11 Ga0070680_101400956 3300005336 Viruses 605
12 Ga0070680_101949706 3300005336 Bacteria 509
13 Ga0068868_100094624 3300005338 Bacteria 2410
14 Ga0070689_100337539 3300005340 Bacteria 1262
15 Ga0070689_100388737 3300005340 Bacteria 1177
16 Ga0070689_100745580 3300005340 Bacteria 858
17 Ga0070687_100215097 3300005343 Unclassified 1173
18 Ga0070661_100104206 3300005344 Bacteria 2113
19 Ga0070692_10023635 3300005345 Unclassified 3013
20 Ga0070669_100000019 3300005353 Bacteria 186509
21 Ga0070675_101607578 3300005354 Bacteria 600
22 Ga0070671_100208771 3300005355 Bacteria 1656
23 Ga0070673_100065280 3300005364 Bacteria 2903
24 Ga0070673_100616744 3300005364 Bacteria 991
25 Ga0070688_100805812 3300005365 Bacteria 735
26 Ga0070659_100489633 3300005366 Bacteria 1047
27 Ga0070667_100030022 3300005367 Bacteria 4534
28 Ga0070667_101066013 3300005367 Bacteria 755
29 Ga0070703_10000004 3300005406 Bacteria 136572
30 Ga0070701_10101955 3300005438 Bacteria 1591
31 Ga0070705_100229134 3300005440 Bacteria 1291
32 Ga0070705_100320883 3300005440 Bacteria 1118
33 Ga0070705_100386094 3300005440 Unclassified 1032
34 Ga0070700_100587338 3300005441 Unclassified 871
35 Ga0070708_100031387 3300005445 Bacteria 4598
36 Ga0070708_100310168 3300005445 Bacteria 1486
37 Ga0070663_100197544 3300005455 Bacteria 1568
38 Ga0070678_100119338 3300005456 Bacteria 2077
39 Ga0070681_10076326 3300005458 Bacteria 3310
40 Ga0070681_10175666 3300005458 Bacteria 2064
41 Ga0070685_10150822 3300005466 Bacteria 1473
42 Ga0070707_100549387 3300005468 Bacteria 1117
43 Ga0070698_100696252 3300005471 Bacteria 958
44 Ga0070699_100000008 3300005518 Bacteria 295702
45 Ga0068853_100000427 3300005539 Bacteria 28683
46 Ga0068853_100003852 3300005539 Bacteria 11492
47 Ga0070672_100725387 3300005543 Bacteria 871
48 Ga0070672_100848305 3300005543 Bacteria 805
49 Ga0070672_101280748 3300005543 Bacteria 654
50 Ga0070695_100221195 3300005545 Unclassified 1364
51 Ga0070696_100001048 3300005546 Bacteria 17879
52 Ga0070696_100018140 3300005546 Bacteria 4754
53 Ga0070693_100003909 3300005547 Bacteria 6988
54 Ga0070665_100000365 3300005548 Bacteria 67635
55 Ga0070665_100038793 3300005548 Bacteria 4788
56 Ga0070704_100067136 3300005549 Bacteria 2589
57 Ga0070704_100502531 3300005549 Bacteria 1052
58 Ga0068855_100013419 3300005563 Bacteria 9879
59 Ga0070664_100017490 3300005564 Bacteria 5888
60 Ga0070664_100295325 3300005564 Bacteria 1463
61 Ga0070664_101203661 3300005564 Bacteria 715
62 Ga0070664_102184205 3300005564 Bacteria 525
63 Ga0068857_100069308 3300005577 Bacteria 3140
64 Ga0068857_100166312 3300005577 Bacteria 2003
65 Ga0068857_100391783 3300005577 Unclassified 1292
66 Ga0068857_100514105 3300005577 Bacteria 1125
67 Ga0068857_102184705 3300005577 Bacteria 543
68 Ga0068854_100014355 3300005578 Bacteria 5220
69 Ga0068854_100851334 3300005578 Unclassified 798
70 Ga0068856_100114766 3300005614 Bacteria 2693
71 Ga0068856_101078225 3300005614 Bacteria 821
72 Ga0068856_101176959 3300005614 Bacteria 783
73 Ga0068859_100000046 3300005617 Bacteria 142733
74 Ga0068859_100002758 3300005617 Bacteria 17812
75 Ga0068859_100084432 3300005617 Bacteria 3221
76 Ga0068859_100104729 3300005617 Bacteria 2888
77 Ga0068859_100264829 3300005617 Bacteria 1811
78 Ga0068864_100052563 3300005618 Bacteria 3512
79 Ga0068866_10054750 3300005718 Bacteria 2045
80 Ga0068861_101873635 3300005719 Bacteria 596
81 Ga0068870_10253790 3300005840 Bacteria 1091
82 Ga0068870_10401408 3300005840 Bacteria 892
83 Ga0068863_100100034 3300005841 Bacteria 2756
84 Ga0068863_100171040 3300005841 Bacteria 2084
85 Ga0068863_100213970 3300005841 Bacteria 1856
86 Ga0068858_100499871 3300005842 Bacteria 1175
87 Ga0068858_100970917 3300005842 Bacteria 832
88 Ga0068860_100271776 3300005843 Bacteria 1654
89 Ga0068862_100000932 3300005844 Bacteria 28214
90 Ga0081540_1002973 3300005983 Bacteria 13591
91 Ga0081539_10000772 3300005985 Bacteria 62952
92 Ga0070717_10063601 3300006028 Bacteria 3063
93 Ga0075368_10248057 3300006042 Bacteria 760
94 Ga0075364_10117301 3300006051 Bacteria 1780
95 Ga0070716_100023406 3300006173 Bacteria 3276
96 Ga0097621_100106336 3300006237 Bacteria 2367
97 Ga0068871_100745503 3300006358 Bacteria 900
98 Ga0075428_100015781 3300006844 Bacteria 8366
99 Ga0075433_10205157 3300006852 Bacteria 1752
100 Ga0075434_100077964 3300006871 Bacteria 3309
101 Ga0075434_100271643 3300006871 Bacteria 1714
102 Ga0068865_100048477 3300006881 Bacteria 2923
103 Ga0097620_100000046 3300006931 Bacteria 142733
104 Ga0097620_100002758 3300006931 Bacteria 17812
105 Ga0097620_100084432 3300006931 Bacteria 3221
106 Ga0097620_100104725 3300006931 Bacteria 2888
107 Ga0097620_100264842 3300006931 Bacteria 1811
108 Ga0075435_100403173 3300007076 Bacteria 1176
109 Ga0111539_10043958 3300009094 Bacteria 5354
110 Ga0105247_10185622 3300009101 Bacteria 1390
111 Ga0105242_10685628 3300009176 Bacteria 1000
112 Ga0105242_11711406 3300009176 Unclassified 665
113 Ga0105248_10057108 3300009177 Bacteria 4380
114 Ga0105248_10318341 3300009177 Bacteria 1752
115 Ga0105248_13350155 3300009177 Bacteria 509
116 Ga0105237_10072932 3300009545 Bacteria 3426
117 Ga0105237_10177760 3300009545 Bacteria 2129
118 Ga0105238_10008975 3300009551 Bacteria 10008
119 Ga0105249_11265859 3300009553 Unclassified 809
120 Ga0105239_10016911 3300010375 Bacteria 8061
121 Ga0105239_10099477 3300010375 Bacteria 3215
122 Ga0105239_10230435 3300010375 Bacteria 2078
123 Ga0157373_10000982 3300013100 Bacteria 22058
124 Ga0157370_10002744 3300013104 Bacteria 21055
125 Ga0157372_10786323 3300013307 Bacteria 1106
126 Ga0157372_11126509 3300013307 Bacteria 908
127 Ga0157372_13240186 3300013307 Bacteria 519
128 Ga0157375_12082887 3300013308 Bacteria 675
129 Ga0163163_10244356 3300014325 Bacteria 1845
130 Ga0163163_10802481 3300014325 Unclassified 1005
131 Ga0157377_10364959 3300014745 Bacteria 973
132 Ga0157376_11019181 3300014969 Bacteria 851
133 Ga0209051_1016463 3300025303 Bacteria 3344
134 Ga0207710_10131491 3300025900 Bacteria 1202
135 Ga0207710_10427189 3300025900 Unclassified 682
136 Ga0207643_10364701 3300025908 Bacteria 908
137 Ga0207705_10113411 3300025909 Bacteria 2004
138 Ga0207654_10293544 3300025911 Bacteria 1103
139 Ga0207654_10535271 3300025911 Unclassified 831
140 Ga0207707_10117624 3300025912 Unclassified 2323
141 Ga0207660_11729380 3300025917 Unclassified 503
142 Ga0207649_10098710 3300025920 Bacteria 1928
143 Ga0207646_10142406 3300025922 Bacteria 2160
144 Ga0207646_10780332 3300025922 Bacteria 852
145 Ga0207681_10000110 3300025923 Bacteria 69649
146 Ga0207681_10156002 3300025923 Bacteria 1716
147 Ga0207681_11636359 3300025923 Bacteria 539
148 Ga0207694_10293611 3300025924 Bacteria 1337
149 Ga0207659_10051049 3300025926 Bacteria 2940
150 Ga0207687_10432067 3300025927 Bacteria 1089
151 Ga0207644_10190958 3300025931 Bacteria 1610
152 Ga0207690_10375508 3300025932 Bacteria 1129
153 Ga0207686_11110970 3300025934 Unclassified 645
154 Ga0207670_10531025 3300025936 Bacteria 959
155 Ga0207704_10031995 3300025938 Bacteria 2971
156 Ga0207665_10050919 3300025939 Bacteria 2786
157 Ga0207691_10660462 3300025940 Bacteria 883
158 Ga0207691_10931770 3300025940 Bacteria 726
159 Ga0207691_11747350 3300025940 Bacteria 502
160 Ga0207711_10046695 3300025941 Bacteria 3701
161 Ga0207711_10577354 3300025941 Bacteria 1049
162 Ga0207689_10420880 3300025942 Unclassified 1115
163 Ga0207679_10008411 3300025945 Bacteria 6575
164 Ga0207679_10021982 3300025945 Bacteria 4336
165 Ga0207679_10936021 3300025945 Bacteria 793
166 Ga0207667_10012068 3300025949 Bacteria 9992
167 Ga0207651_10042770 3300025960 Bacteria 3018
168 Ga0207651_10553380 3300025960 Bacteria 1001
169 Ga0207712_10459489 3300025961 Unclassified 1081
170 Ga0207668_10082544 3300025972 Bacteria 2335
171 Ga0207640_10138412 3300025981 Bacteria 1771
172 Ga0207658_10298021 3300025986 Bacteria 1388
173 Ga0207677_10097872 3300026023 Bacteria 2151
174 Ga0207703_10457806 3300026035 Bacteria 1193
175 Ga0207639_10000936 3300026041 Bacteria 19751
176 Ga0207639_10007150 3300026041 Bacteria 7608
177 Ga0207639_10602856 3300026041 Bacteria 1013
178 Ga0207678_10141699 3300026067 Bacteria 2052
179 Ga0207678_10216914 3300026067 Bacteria 1637
180 Ga0207708_10222027 3300026075 Unclassified 1514
181 Ga0207641_10011198 3300026088 Bacteria 7358
182 Ga0207641_10389529 3300026088 Bacteria 1336
183 Ga0207676_10306859 3300026095 Bacteria 1451
184 Ga0207676_10321737 3300026095 Bacteria 1420
185 Ga0207674_10005017 3300026116 Bacteria 15817
186 Ga0207674_10187275 3300026116 Unclassified 2020
187 Ga0207674_11211229 3300026116 Bacteria 725
188 Ga0207675_101043828 3300026118 Bacteria 836
189 Ga0207698_10634093 3300026142 Bacteria 1057
190 Ga0268266_10000252 3300028379 Bacteria 90702
191 Ga0268266_11389432 3300028379 Bacteria 678
192 Ga0268265_10000351 3300028380 Bacteria 49884
193 Ga0268264_10603839 3300028381 Bacteria 1082
194 Ga0268264_10631536 3300028381 Bacteria 1058
195 Ga0268264_11227014 3300028381 Bacteria 760
196 Ga0265319_1020525 3300028563 Bacteria 2446
197 Ga0265318_10093008 3300028577 Unclassified 1110
198 Ga0265332_10189492 3300031238 Unclassified 856
199 Ga0265331_10018205 3300031250 Bacteria 3648
200 Ga0265316_10002748 3300031344 Bacteria 18031
201 Ga0316579_10018905 3300031691 Bacteria 3038
202 Ga0265314_10244962 3300031711 Unclassified 1032
203 Ga0316576_10167103 3300031727 Bacteria 1660
204 Ga0307410_10474734 3300031852 Bacteria 1025
205 Ga0307416_100790418 3300032002 Bacteria 1044
206 Ga0373950_0035216 3300034818 Bacteria 941
207 Ga0373939_0044604 3300035114 Bacteria 1350
208 Ga0373956_0381688 3300035119 Bacteria 672
209 Ga0373935_0089201 3300035692 Bacteria 2016
210 Ga0373933_0074937 3300035724 Bacteria 2065
211 Ga0373947_0126186 3300035725 Bacteria 1630
212 Ga0373937_0001923 3300036401 Bacteria 17365
213 Ga0316584_0173161 3300036712 Bacteria 1600
214 Ga0395899_0025086 3300037312 Bacteria 4502
215 Ga0395905_0653948 3300037471 Bacteria 953
216 Ga0451795_1715316 3300041456 Bacteria 612
217 Ga0466967_1865319 3300045976 Bacteria 598
218 Ga0495592_0054424 3300046454 Bacteria 2965
219 Ga0495603_0145812 3300046455 Bacteria 1376
220 Ga0495638_0470694 3300046460 Unclassified 638
221 Ga0495651_0000416 3300046462 Bacteria 32979
222 Ga0495651_0044707 3300046462 Bacteria 3432
223 Ga0495653_0089198 3300046463 Bacteria 2260
224 Ga0495664_0381154 3300046477 Bacteria 848
225 Ga0495618_0239902 3300046514 Bacteria 1140
226 Ga0495628_0024973 3300046516 Bacteria 4887
227 Ga0495652_0001061 3300046529 Bacteria 31217
228 Ga0495587_0063049 3300046536 Bacteria 2169
229 Ga0495667_0000715 3300046559 Bacteria 21273
230 Ga0495634_0393118 3300046642 Bacteria 825
231 Ga0495625_0431097 3300046660 Bacteria 818
232 Ga0495625_0730942 3300046660 Bacteria 582
233 Ga0495635_0002992 3300046663 Bacteria 11597
234 Ga0495635_0526729 3300046663 Bacteria 776
235 Ga0495649_0214780 3300046694 Bacteria 996
236 Ga0495600_0053077 3300046809 Bacteria 2647
237 Ga0495600_0095115 3300046809 Bacteria 1942
238 Ga0495581_0455092 3300047315 Bacteria 745
239 Ga0495684_0031501 3300047471 Bacteria 4072
240 Ga0496100_0728585 3300048903 Bacteria 775
241 Ga0496104_1305005 3300048907 Unclassified 629
242 Ga0496110_0896402 3300048913 Bacteria 793
243 Ga0496114_1066503 3300048917 Bacteria 692
244 Ga0496114_1239813 3300048917 Bacteria 632
245 Ga0496115_0481760 3300048918 Bacteria 999
246 Ga0496115_0488924 3300048918 Bacteria 990
247 Ga0501033_0000524 3300049570 Bacteria 35901
248 Ga0501040_0544854 3300049576 Bacteria 837
249 Ga0501068_0123694 3300049584 Unclassified 1614
250 Ga0501044_0347632 3300049823 Bacteria 1403
251 nmdc:mga06r32_1616092_c1 3300050510 Bacteria 586
252 nmdc:mga08y16_33441_c1 3300050511 Bacteria 5400
253 nmdc:mga0n895_260409_c1 3300050512 Bacteria 1760
254 nmdc:mga0rr50_368289_c1 3300050513 Bacteria 1210
255 nmdc:mga0rr50_545299_c1 3300050513 Bacteria 987
256 nmdc:mga0a205_122306_c1 3300050515 Bacteria 2502
257 nmdc:mga0a205_295924_c1 3300050515 Bacteria 1492
258 nmdc:mga0a205_898391_c1 3300050515 Unclassified 733
259 Ga0495612_0107589 3300053078 Bacteria 1191
260 Ga0500610_0000167 3300053079 Bacteria 19606
261 Ga0500651_0000196 3300053093 Bacteria 38629
262 Ga0500651_0501684 3300053093 Bacteria 669
263 Ga0500588_0076645 3300053146 Bacteria 1109
264 2738713849 2738541276 Bacteria 4690596
265 2904700861
266 2906635132 2906626472 Bacteria 8826946
267 2913945703 2913939268 Bacteria 8559644
268 Ga0466969_0126328
269 MBSR1b_contig_4579130
270 JGI25406J46586_10023980
271 JGI25404J52841_10082055
272 Ga0065712_10175291
273 Ga0065715_10092794
274 Ga0065715_10105270
275 Ga0070658_10011873
276 Ga0070670_100667457
277 Ga0068869_100113390
278 Ga0070680_101400956
279 Ga0070680_101949706
280 Ga0068868_100094624
281 Ga0070689_100337539
282 Ga0070689_100388737
283 Ga0070689_100745580
284 Ga0070687_100215097
285 Ga0070661_100104206
286 Ga0070692_10023635
287 Ga0070669_100000019
288 Ga0070675_101607578
289 Ga0070671_100208771
290 Ga0070673_100065280
291 Ga0070673_100616744
292 Ga0070688_100805812
293 Ga0070659_100489633
294 Ga0070667_100030022
295 Ga0070667_101066013
296 Ga0070703_10000004
297 Ga0070701_10101955
298 Ga0070705_100229134
299 Ga0070705_100320883
300 Ga0070705_100386094
301 Ga0070700_100587338
302 Ga0070708_100031387
303 Ga0070708_100310168
304 Ga0070663_100197544
305 Ga0070678_100119338
306 Ga0070681_10076326
307 Ga0070681_10175666
308 Ga0070685_10150822
309 Ga0070707_100549387
310 Ga0070698_100696252
311 Ga0070699_100000008
312 Ga0068853_100000427
313 Ga0068853_100003852
314 Ga0070672_100725387
315 Ga0070672_100848305
316 Ga0070672_101280748
317 Ga0070695_100221195
318 Ga0070696_100001048
319 Ga0070696_100018140
320 Ga0070693_100003909
321 Ga0070665_100000365
322 Ga0070665_100038793
323 Ga0070704_100067136
324 Ga0070704_100502531
325 Ga0068855_100013419
326 Ga0070664_100017490
327 Ga0070664_100295325
328 Ga0070664_101203661
329 Ga0070664_102184205
330 Ga0068857_100069308
331 Ga0068857_100166312
332 Ga0068857_100391783
333 Ga0068857_100514105
334 Ga0068857_102184705
335 Ga0068854_100014355
336 Ga0068854_100851334
337 Ga0068856_100114766
338 Ga0068856_101078225
339 Ga0068856_101176959
340 Ga0068859_100000046
341 Ga0068859_100002758
342 Ga0068859_100084432
343 Ga0068859_100104729
344 Ga0068859_100264829
345 Ga0068864_100052563
346 Ga0068866_10054750
347 Ga0068861_101873635
348 Ga0068870_10253790
349 Ga0068870_10401408
350 Ga0068863_100100034
351 Ga0068863_100171040
352 Ga0068863_100213970
353 Ga0068858_100499871
354 Ga0068858_100970917
355 Ga0068860_100271776
356 Ga0068862_100000932
357 Ga0081540_1002973
358 Ga0081539_10000772
359 Ga0070717_10063601
360 Ga0075368_10248057
361 Ga0075364_10117301
362 Ga0070716_100023406
363 Ga0097621_100106336
364 Ga0068871_100745503
365 Ga0075428_100015781
366 Ga0075433_10205157
367 Ga0075434_100077964
368 Ga0075434_100271643
369 Ga0068865_100048477
370 Ga0097620_100000046
371 Ga0097620_100002758
372 Ga0097620_100084432
373 Ga0097620_100104725
374 Ga0097620_100264842
375 Ga0075435_100403173
376 Ga0111539_10043958
377 Ga0105247_10185622
378 Ga0105242_10685628
379 Ga0105242_11711406
380 Ga0105248_10057108
381 Ga0105248_10318341
382 Ga0105248_13350155
383 Ga0105237_10072932
384 Ga0105237_10177760
385 Ga0105238_10008975
386 Ga0105249_11265859
387 Ga0105239_10016911
388 Ga0105239_10099477
389 Ga0105239_10230435
390 Ga0157373_10000982
391 Ga0157370_10002744
392 Ga0157372_10786323
393 Ga0157372_11126509
394 Ga0157372_13240186
395 Ga0157375_12082887
396 Ga0163163_10244356
397 Ga0163163_10802481
398 Ga0157377_10364959
399 Ga0157376_11019181
400 Ga0209051_1016463
401 Ga0207710_10131491
402 Ga0207710_10427189
403 Ga0207643_10364701
404 Ga0207705_10113411
405 Ga0207654_10293544
406 Ga0207654_10535271
407 Ga0207707_10117624
408 Ga0207660_11729380
409 Ga0207649_10098710
410 Ga0207646_10142406
411 Ga0207646_10780332
412 Ga0207681_10000110
413 Ga0207681_10156002
414 Ga0207681_11636359
415 Ga0207694_10293611
416 Ga0207659_10051049
417 Ga0207687_10432067
418 Ga0207644_10190958
419 Ga0207690_10375508
420 Ga0207686_11110970
421 Ga0207670_10531025
422 Ga0207704_10031995
423 Ga0207665_10050919
424 Ga0207691_10660462
425 Ga0207691_10931770
426 Ga0207691_11747350
427 Ga0207711_10046695
428 Ga0207711_10577354
429 Ga0207689_10420880
430 Ga0207679_10008411
431 Ga0207679_10021982
432 Ga0207679_10936021
433 Ga0207667_10012068
434 Ga0207651_10042770
435 Ga0207651_10553380
436 Ga0207712_10459489
437 Ga0207668_10082544
438 Ga0207640_10138412
439 Ga0207658_10298021
440 Ga0207677_10097872
441 Ga0207703_10457806
442 Ga0207639_10000936
443 Ga0207639_10007150
444 Ga0207639_10602856
445 Ga0207678_10141699
446 Ga0207678_10216914
447 Ga0207708_10222027
448 Ga0207641_10011198
449 Ga0207641_10389529
450 Ga0207676_10306859
451 Ga0207676_10321737
452 Ga0207674_10005017
453 Ga0207674_10187275
454 Ga0207674_11211229
455 Ga0207675_101043828
456 Ga0207698_10634093
457 Ga0268266_10000252
458 Ga0268266_11389432
459 Ga0268265_10000351
460 Ga0268264_10603839
461 Ga0268264_10631536
462 Ga0268264_11227014
463 Ga0265319_1020525
464 Ga0265318_10093008
465 Ga0265332_10189492
466 Ga0265331_10018205
467 Ga0265316_10002748
468 Ga0316579_10018905
469 Ga0265314_10244962
470 Ga0316576_10167103
471 Ga0307410_10474734
472 Ga0307416_100790418
473 Ga0373950_0035216
474 Ga0373939_0044604
475 Ga0373956_0381688
476 Ga0373935_0089201
477 Ga0373933_0074937
478 Ga0373947_0126186
479 Ga0373937_0001923
480 Ga0316584_0173161
481 Ga0395899_0025086
482 Ga0395905_0653948
483 Ga0451795_1715316
484 Ga0466967_1865319
485 Ga0495592_0054424
486 Ga0495603_0145812
487 Ga0495638_0470694
488 Ga0495651_0000416
489 Ga0495651_0044707
490 Ga0495653_0089198
491 Ga0495664_0381154
492 Ga0495618_0239902
493 Ga0495628_0024973
494 Ga0495652_0001061
495 Ga0495587_0063049
496 Ga0495667_0000715
497 Ga0495634_0393118
498 Ga0495625_0431097
499 Ga0495625_0730942
500 Ga0495635_0002992
501 Ga0495635_0526729
502 Ga0495649_0214780
503 Ga0495600_0053077
504 Ga0495600_0095115
505 Ga0495581_0455092
506 Ga0495684_0031501
507 Ga0496100_0728585
508 Ga0496104_1305005
509 Ga0496110_0896402
510 Ga0496114_1066503
511 Ga0496114_1239813
512 Ga0496115_0481760
513 Ga0496115_0488924
514 Ga0501033_0000524
515 Ga0501040_0544854
516 Ga0501068_0123694
517 Ga0501044_0347632
518 nmdc:mga06r32_1616092_c1
519 nmdc:mga08y16_33441_c1
520 nmdc:mga0n895_260409_c1
521 nmdc:mga0rr50_368289_c1
522 nmdc:mga0rr50_545299_c1
523 nmdc:mga0a205_122306_c1
524 nmdc:mga0a205_295924_c1
525 nmdc:mga0a205_898391_c1
526 Ga0495612_0107589
527 Ga0500610_0000167
528 Ga0500651_0000196
529 Ga0500651_0501684
530 Ga0500588_0076645
531 2738713849
532 2904700861
533 2906635132
534 2913945703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04965

GPW_gp25

Baseplate wedge protein gp25

31

121

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7n4d-assembly2.cif.gz_B translation initiation factor eif-5a family protein from naegleria fowleri atcc 30863 0.8545 81 114
2ia7-assembly1.cif.gz_A crystal structure of putative tail lysozyme (np_952040.1) from geobacter sulfurreducens at 1.44 a resolution 0.8495 20 120
6enu-assembly1.cif.gz_w polyproline-stalled ribosome in the presence of elongation-factor p (ef-p) 0.8481 81 114
1yby-assembly1.cif.gz_B conserved hypothetical protein cth-95 from clostridium thermocellum 0.8472 81 114
1bkb-assembly1.cif.gz_A initiation factor 5a from archebacterium pyrobaculum aerophilum 0.8422 81 114
ID Description Score Start End Superfamily
af_A0A0P0V197_32_95_3.10.450.700 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8718 80 120 3.10.450.700
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.869 81 115 2.30.30.30
1ybyA01 Mainly Beta;Roll;SH3 type barrels.; 0.8561 81 114 2.30.30.30
2ia7A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8424 20 120 3.10.450.40
1bkbA01 Mainly Beta;Roll;SH3 type barrels.; 0.8422 81 114 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A1P8YPY5-F1-model_v4 Lysozyme family protein 0.9592 15 116
AF-A0A2S9XIG4-F1-model_v4 Gene 25-like lysozyme 0.9522 21 117
AF-A0A519DRW4-F1-model_v4 deleted 0.9514 29 115
AF-A0A7V4G7W4-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9438 23 120
AF-A0A0C2D3V1-F1-model_v4 Uncharacterized protein 0.9425 71 118

Map