F374666

General Info

Members Datasets Scaffolds Average Seq Length
267 147 534 248

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10077607|Ga0070717_100776072
Length 288
Sequence MVSEEAIKNRVRHKLLHPHSQNFIPIVMLRSVVLLTTMLAIAASLADAQDNYEIQVYSYDTVAPGHTMIELHSNFTVNGSKTVVEGVQPTNHAEHETVEITQGVNDWFETGFYIFTTIQPDGGWKWVGDHIRPRVRVPESWHWPVGVSLSNEIGYQRAAFSADTWTWEIRPIVDRKLGRWYLSFNPTLDRSWHGPSVDKGVEFSPNAKVSLDFTKRIAGGLEYYASYGPLTGFDPLREQQQQIFPSVDIDFGPQWEFNFGVGVGMTGSTDHLIVKCIVGRRFDWKRKN

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3
Rhizosphere 95.88
Stem 0
Stem Tuber 0
Unclassified 22.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10077607 3300006028 Bacteria 2782
2 Ga0070683_100153956 3300005329 Bacteria 2180
3 Ga0070683_100417141 3300005329 Bacteria 1280
4 Ga0068869_100108263 3300005334 Unclassified 2111
5 Ga0070680_100012625 3300005336 Bacteria 6567
6 Ga0068868_100014907 3300005338 Bacteria 5739
7 Ga0068868_100277729 3300005338 Unclassified 1417
8 Ga0070689_100223279 3300005340 Bacteria 1546
9 Ga0070661_100145985 3300005344 Unclassified 1786
10 Ga0070675_100149727 3300005354 Unclassified 2000
11 Ga0070673_100006393 3300005364 Bacteria 7657
12 Ga0070709_10043602 3300005434 Bacteria 2774
13 Ga0070709_10092594 3300005434 Bacteria 1997
14 Ga0070714_100007491 3300005435 Bacteria 8494
15 Ga0070714_100094199 3300005435 Unclassified 2629
16 Ga0070714_100152817 3300005435 Bacteria 2081
17 Ga0070713_100001051 3300005436 Bacteria 17657
18 Ga0070713_100037964 3300005436 Bacteria 3898
19 Ga0070713_100040460 3300005436 Bacteria 3789
20 Ga0070713_100342280 3300005436 Unclassified 1386
21 Ga0070713_100370331 3300005436 Unclassified 1333
22 Ga0070711_100014896 3300005439 Bacteria 4911
23 Ga0070711_100059375 3300005439 Bacteria 2655
24 Ga0070705_100176864 3300005440 Bacteria 1442
25 Ga0070705_100487390 3300005440 Bacteria 933
26 Ga0070708_100009010 3300005445 Bacteria 8043
27 Ga0070708_100017082 3300005445 Bacteria 6042
28 Ga0070678_100429472 3300005456 Unclassified 1153
29 Ga0070681_10001281 3300005458 Bacteria 21916
30 Ga0070681_10015289 3300005458 Bacteria 7635
31 Ga0068867_100133317 3300005459 Bacteria 1933
32 Ga0070706_100005014 3300005467 Bacteria 12659
33 Ga0070706_100022631 3300005467 Bacteria 5788
34 Ga0070707_100065902 3300005468 Bacteria 3480
35 Ga0070707_100130331 3300005468 Bacteria 2445
36 Ga0070707_100409433 3300005468 Bacteria 1316
37 Ga0070698_100202397 3300005471 Bacteria 1921
38 Ga0070699_100049658 3300005518 Bacteria 3631
39 Ga0070679_100011797 3300005530 Bacteria 8334
40 Ga0070679_100116218 3300005530 Unclassified 2660
41 Ga0070684_100054209 3300005535 Bacteria 3493
42 Ga0070684_100294306 3300005535 Bacteria 1489
43 Ga0070697_100000177 3300005536 Bacteria 52281
44 Ga0070697_100091871 3300005536 Bacteria 2510
45 Ga0068853_100006439 3300005539 Bacteria 9331
46 Ga0068853_100520080 3300005539 Unclassified 1125
47 Ga0070672_100486452 3300005543 Bacteria 1066
48 Ga0070686_100319482 3300005544 Unclassified 1157
49 Ga0068855_100004299 3300005563 Bacteria 17411
50 Ga0068855_100004457 3300005563 Bacteria 17113
51 Ga0068855_100025332 3300005563 Bacteria 7098
52 Ga0068855_100062444 3300005563 Bacteria 4349
53 Ga0070664_100000381 3300005564 Bacteria 32970
54 Ga0070664_100518491 3300005564 Bacteria 1100
55 Ga0068857_100000707 3300005577 Bacteria 24853
56 Ga0068857_100049954 3300005577 Unclassified 3711
57 Ga0068854_100056031 3300005578 Unclassified 2840
58 Ga0068856_100000109 3300005614 Bacteria 81443
59 Ga0068856_100002628 3300005614 Bacteria 18449
60 Ga0068856_100003736 3300005614 Bacteria 15254
61 Ga0068852_100035399 3300005616 Bacteria 4165
62 Ga0068852_100262403 3300005616 Bacteria 1659
63 Ga0068852_100606879 3300005616 Bacteria 1099
64 Ga0068859_100003932 3300005617 Bacteria 15176
65 Ga0068861_100076454 3300005719 Unclassified 2609
66 Ga0068870_10359747 3300005840 Bacteria 936
67 Ga0068863_100008766 3300005841 Bacteria 9874
68 Ga0068863_100027528 3300005841 Bacteria 5423
69 Ga0068858_100010020 3300005842 Bacteria 9000
70 Ga0068858_100041167 3300005842 Bacteria 4285
71 Ga0068858_100083595 3300005842 Unclassified 2969
72 Ga0068858_100144955 3300005842 Bacteria 2230
73 Ga0068860_100064839 3300005843 Unclassified 3469
74 Ga0070717_10010079 3300006028 Bacteria 7115
75 Ga0070717_10016694 3300006028 Bacteria 5697
76 Ga0070717_10054616 3300006028 Bacteria 3294
77 Ga0070717_10524467 3300006028 Unclassified 1072
78 Ga0070716_100064870 3300006173 Bacteria 2125
79 Ga0070712_100045925 3300006175 Bacteria 3018
80 Ga0070712_100090031 3300006175 Bacteria 2246
81 Ga0097621_100000513 3300006237 Bacteria 27134
82 Ga0097621_100001550 3300006237 Bacteria 15707
83 Ga0097621_100097132 3300006237 Unclassified 2473
84 Ga0068871_100000407 3300006358 Bacteria 29709
85 Ga0068871_100000451 3300006358 Bacteria 28258
86 Ga0068871_100065589 3300006358 Unclassified 2974
87 Ga0075434_100019403 3300006871 Bacteria 6580
88 Ga0075434_100045626 3300006871 Bacteria 4348
89 Ga0068865_100286618 3300006881 Unclassified 1313
90 Ga0075436_100005196 3300006914 Bacteria 8960
91 Ga0075436_100035781 3300006914 Bacteria 3425
92 Ga0075436_100106444 3300006914 Bacteria 1956
93 Ga0097620_100003932 3300006931 Bacteria 15176
94 Ga0075435_100030073 3300007076 Bacteria 4268
95 Ga0105240_10002219 3300009093 Bacteria 31647
96 Ga0105240_10014252 3300009093 Bacteria 10860
97 Ga0105240_10118734 3300009093 Bacteria 3187
98 Ga0105241_10022927 3300009174 Unclassified 4628
99 Ga0105242_10274147 3300009176 Bacteria 1529
100 Ga0105248_10022825 3300009177 Bacteria 6947
101 Ga0105237_10020633 3300009545 Bacteria 6789
102 Ga0105238_10000511 3300009551 Bacteria 40758
103 Ga0105238_10038108 3300009551 Bacteria 4883
104 Ga0105239_10129059 3300010375 Bacteria 2811
105 Ga0105239_10385596 3300010375 Bacteria 1585
106 Ga0157371_10223658 3300013102 Unclassified 1352
107 Ga0157370_10189371 3300013104 Unclassified 1910
108 Ga0157369_10002613 3300013105 Bacteria 21537
109 Ga0157369_10004029 3300013105 Bacteria 17414
110 Ga0157369_10125407 3300013105 Bacteria 2723
111 Ga0157374_10000095 3300013296 Bacteria 83560
112 Ga0157374_10000211 3300013296 Bacteria 53466
113 Ga0157374_10001813 3300013296 Bacteria 17983
114 Ga0157378_10000123 3300013297 Bacteria 75054
115 Ga0157378_10000143 3300013297 Bacteria 67028
116 Ga0157378_10005289 3300013297 Bacteria 11336
117 Ga0157378_10017375 3300013297 Bacteria 6313
118 Ga0157378_10065394 3300013297 Bacteria 3255
119 Ga0157378_10433668 3300013297 Viruses 1301
120 Ga0157378_10850077 3300013297 Bacteria 941
121 Ga0157372_10000957 3300013307 Bacteria 31459
122 Ga0157372_10002550 3300013307 Bacteria 19754
123 Ga0157372_10011928 3300013307 Bacteria 9260
124 Ga0157372_10018343 3300013307 Bacteria 7521
125 Ga0157372_10042301 3300013307 Bacteria 5039
126 Ga0157372_10046388 3300013307 Bacteria 4824
127 Ga0157372_10216925 3300013307 Unclassified 2217
128 Ga0157375_10154729 3300013308 Bacteria 2431
129 Ga0157375_10417232 3300013308 Unclassified 1508
130 Ga0157375_10611977 3300013308 Bacteria 1248
131 Ga0157379_10037222 3300014968 Bacteria 4338
132 Ga0157376_10005125 3300014969 Bacteria 9134
133 Ga0213876_10091609 3300021384 Bacteria 1610
134 Ga0228598_1000080 3300024227 Bacteria 14893
135 Ga0228598_1001149 3300024227 Bacteria 5831
136 Ga0207692_10192741 3300025898 Bacteria 1194
137 Ga0207642_10114771 3300025899 Bacteria 1378
138 Ga0207680_10058295 3300025903 Bacteria 2340
139 Ga0207647_10073110 3300025904 Unclassified 2067
140 Ga0207647_10185273 3300025904 Unclassified 1207
141 Ga0207684_10000519 3300025910 Bacteria 47857
142 Ga0207684_10122461 3300025910 Bacteria 2230
143 Ga0207654_10033328 3300025911 Unclassified 2854
144 Ga0207707_10000521 3300025912 Bacteria 39383
145 Ga0207707_10003826 3300025912 Bacteria 13336
146 Ga0207707_10365226 3300025912 Unclassified 1242
147 Ga0207695_10017696 3300025913 Bacteria 8278
148 Ga0207695_10018136 3300025913 Bacteria 8146
149 Ga0207695_10253099 3300025913 Bacteria 1660
150 Ga0207693_10023971 3300025915 Bacteria 4845
151 Ga0207693_10087120 3300025915 Unclassified 2447
152 Ga0207693_10275935 3300025915 Bacteria 1317
153 Ga0207693_10303268 3300025915 Bacteria 1251
154 Ga0207663_10070205 3300025916 Bacteria 2256
155 Ga0207660_10056259 3300025917 Unclassified 2814
156 Ga0207649_10188460 3300025920 Bacteria 1449
157 Ga0207652_10015075 3300025921 Bacteria 6271
158 Ga0207646_10137113 3300025922 Bacteria 2203
159 Ga0207694_10000867 3300025924 Bacteria 26939
160 Ga0207650_10071493 3300025925 Bacteria 2610
161 Ga0207659_10249769 3300025926 Bacteria 1439
162 Ga0207700_10009135 3300025928 Bacteria 6174
163 Ga0207700_10302995 3300025928 Unclassified 1380
164 Ga0207700_10310023 3300025928 Unclassified 1365
165 Ga0207700_10318579 3300025928 Unclassified 1347
166 Ga0207700_10754635 3300025928 Unclassified 869
167 Ga0207664_10000852 3300025929 Bacteria 20647
168 Ga0207664_10059000 3300025929 Bacteria 3055
169 Ga0207664_10069020 3300025929 Unclassified 2841
170 Ga0207664_10564195 3300025929 Unclassified 1022
171 Ga0207686_10147760 3300025934 Bacteria 1632
172 Ga0207711_10071709 3300025941 Bacteria 3006
173 Ga0207711_10113008 3300025941 Unclassified 2418
174 Ga0207689_10342710 3300025942 Bacteria 1242
175 Ga0207661_10027393 3300025944 Bacteria 4353
176 Ga0207661_10028279 3300025944 Bacteria 4292
177 Ga0207661_10232679 3300025944 Bacteria 1632
178 Ga0207679_10009497 3300025945 Bacteria 6235
179 Ga0207667_10001938 3300025949 Bacteria 25950
180 Ga0207667_10006470 3300025949 Bacteria 14174
181 Ga0207667_10006996 3300025949 Bacteria 13627
182 Ga0207667_10053446 3300025949 Bacteria 4250
183 Ga0207651_10170159 3300025960 Unclassified 1717
184 Ga0207640_10021837 3300025981 Unclassified 3821
185 Ga0207677_10023288 3300026023 Bacteria 3823
186 Ga0207677_10225737 3300026023 Unclassified 1505
187 Ga0207703_10024229 3300026035 Unclassified 4775
188 Ga0207703_10061686 3300026035 Unclassified 3070
189 Ga0207703_10094482 3300026035 Bacteria 2521
190 Ga0207703_10112892 3300026035 Bacteria 2322
191 Ga0207639_10006650 3300026041 Bacteria 7862
192 Ga0207702_10000417 3300026078 Bacteria 48644
193 Ga0207702_10004506 3300026078 Bacteria 12361
194 Ga0207702_10004896 3300026078 Bacteria 11786
195 Ga0207641_10001208 3300026088 Bacteria 25851
196 Ga0207641_10051460 3300026088 Unclassified 3488
197 Ga0207648_10125357 3300026089 Bacteria 2259
198 Ga0207674_10002110 3300026116 Bacteria 25159
199 Ga0207674_10618856 3300026116 Unclassified 1046
200 Ga0207698_10397049 3300026142 Unclassified 1317
201 Ga0268266_10075826 3300028379 Bacteria 2921
202 Ga0268264_10012221 3300028381 Bacteria 7064
203 Ga0268264_10070405 3300028381 Unclassified 2961
204 Ga0265320_10001179 3300031240 Bacteria 19255
205 Ga0265340_10018603 3300031247 Bacteria 3583
206 Ga0265339_10024191 3300031249 Bacteria 3503
207 Ga0265331_10018094 3300031250 Bacteria 3660
208 Ga0265331_10099387 3300031250 Bacteria 1340
209 Ga0265316_10004197 3300031344 Bacteria 14404
210 Ga0265316_10008612 3300031344 Bacteria 9449
211 Ga0307508_10004997 3300031616 Bacteria 12747
212 Ga0265314_10008372 3300031711 Bacteria 8863
213 Ga0316215_1002017 3300033544 Bacteria 1923
214 Ga0373926_0082799 3300035083 Bacteria 1188
215 Ga0373934_0009573 3300035086 Unclassified 3632
216 Ga0373936_0024458 3300035113 Bacteria 2358
217 Ga0373954_0000433 3300035118 Bacteria 15623
218 Ga0373957_0007518 3300035120 Bacteria 3488
219 Ga0373931_0248843 3300035691 Unclassified 1080
220 Ga0373935_0404215 3300035692 Unclassified 981
221 Ga0373935_0471731 3300035692 Unclassified 908
222 Ga0373933_0020616 3300035724 Bacteria 3738
223 Ga0373937_0000216 3300036401 Bacteria 55804
224 Ga0373937_0032115 3300036401 Bacteria 4761
225 Ga0373937_0473234 3300036401 Bacteria 1190
226 Ga0373925_0238592 3300037068 Bacteria 1455
227 Ga0453683_0175941 3300044673 Bacteria 1356
228 Ga0466961_0011342 3300044693 Bacteria 5698
229 Ga0451576_0022077 3300045051 Bacteria 6906
230 Ga0451576_0158584 3300045051 Bacteria 2360
231 Ga0451576_0429326 3300045051 Unclassified 1387
232 Ga0466967_0681702 3300045976 Unclassified 1017
233 Ga0495592_0342073 3300046454 Unclassified 961
234 Ga0495653_0026945 3300046463 Bacteria 4604
235 Ga0495580_0009678 3300046472 Bacteria 7565
236 Ga0495580_0011713 3300046472 Bacteria 6776
237 Ga0495580_0013615 3300046472 Bacteria 6203
238 Ga0495580_0018941 3300046472 Bacteria 5120
239 Ga0495580_0076157 3300046472 Bacteria 2340
240 Ga0495608_0021248 3300046511 Bacteria 4455
241 Ga0495587_0005938 3300046536 Bacteria 7964
242 Ga0495635_0148005 3300046663 Bacteria 1599
243 Ga0495623_0142296 3300046679 Bacteria 1425
244 Ga0495669_0040129 3300046684 Bacteria 2075
245 Ga0495604_0000287 3300047317 Bacteria 45062
246 Ga0495680_0167985 3300047322 Bacteria 1589
247 Ga0495684_0084222 3300047471 Bacteria 2412
248 Ga0495684_0084965 3300047471 Bacteria 2400
249 Ga0495602_0219593 3300048088 Bacteria 1436
250 Ga0496102_0151055 3300048905 Unclassified 2182
251 Ga0496104_0059883 3300048907 Bacteria 3606
252 Ga0496105_0498012 3300048908 Unclassified 957
253 Ga0496112_0026226 3300048915 Bacteria 5604
254 Ga0496112_0191823 3300048915 Unclassified 2005
255 Ga0496112_0535440 3300048915 Bacteria 1106
256 Ga0496115_0203846 3300048918 Bacteria 1634
257 Ga0496115_0266319 3300048918 Unclassified 1409
258 nmdc:mga0n895_136247_c1 3300050512 Bacteria 2482
259 nmdc:mga0n895_145824_c1 3300050512 Bacteria 2397
260 nmdc:mga0n895_223287_c1 3300050512 Bacteria 1912
261 nmdc:mga0rr50_12138_c1 3300050513 Bacteria 5553
262 nmdc:mga0rr50_95373_c1 3300050513 Bacteria 2325
263 nmdc:mga08x19_256879_c1 3300050514 Unclassified 1207
264 nmdc:mga08x19_37310_c1 3300050514 Unclassified 3084
265 nmdc:mga08x19_79002_c1 3300050514 Bacteria 2157
266 nmdc:mga08x19_89227_c1 3300050514 Bacteria 2033
267 Ga0495619_0098804 3300053085 Bacteria 1985
268 Ga0070717_10077607
269 Ga0070683_100153956
270 Ga0070683_100417141
271 Ga0068869_100108263
272 Ga0070680_100012625
273 Ga0068868_100014907
274 Ga0068868_100277729
275 Ga0070689_100223279
276 Ga0070661_100145985
277 Ga0070675_100149727
278 Ga0070673_100006393
279 Ga0070709_10043602
280 Ga0070709_10092594
281 Ga0070714_100007491
282 Ga0070714_100094199
283 Ga0070714_100152817
284 Ga0070713_100001051
285 Ga0070713_100037964
286 Ga0070713_100040460
287 Ga0070713_100342280
288 Ga0070713_100370331
289 Ga0070711_100014896
290 Ga0070711_100059375
291 Ga0070705_100176864
292 Ga0070705_100487390
293 Ga0070708_100009010
294 Ga0070708_100017082
295 Ga0070678_100429472
296 Ga0070681_10001281
297 Ga0070681_10015289
298 Ga0068867_100133317
299 Ga0070706_100005014
300 Ga0070706_100022631
301 Ga0070707_100065902
302 Ga0070707_100130331
303 Ga0070707_100409433
304 Ga0070698_100202397
305 Ga0070699_100049658
306 Ga0070679_100011797
307 Ga0070679_100116218
308 Ga0070684_100054209
309 Ga0070684_100294306
310 Ga0070697_100000177
311 Ga0070697_100091871
312 Ga0068853_100006439
313 Ga0068853_100520080
314 Ga0070672_100486452
315 Ga0070686_100319482
316 Ga0068855_100004299
317 Ga0068855_100004457
318 Ga0068855_100025332
319 Ga0068855_100062444
320 Ga0070664_100000381
321 Ga0070664_100518491
322 Ga0068857_100000707
323 Ga0068857_100049954
324 Ga0068854_100056031
325 Ga0068856_100000109
326 Ga0068856_100002628
327 Ga0068856_100003736
328 Ga0068852_100035399
329 Ga0068852_100262403
330 Ga0068852_100606879
331 Ga0068859_100003932
332 Ga0068861_100076454
333 Ga0068870_10359747
334 Ga0068863_100008766
335 Ga0068863_100027528
336 Ga0068858_100010020
337 Ga0068858_100041167
338 Ga0068858_100083595
339 Ga0068858_100144955
340 Ga0068860_100064839
341 Ga0070717_10010079
342 Ga0070717_10016694
343 Ga0070717_10054616
344 Ga0070717_10524467
345 Ga0070716_100064870
346 Ga0070712_100045925
347 Ga0070712_100090031
348 Ga0097621_100000513
349 Ga0097621_100001550
350 Ga0097621_100097132
351 Ga0068871_100000407
352 Ga0068871_100000451
353 Ga0068871_100065589
354 Ga0075434_100019403
355 Ga0075434_100045626
356 Ga0068865_100286618
357 Ga0075436_100005196
358 Ga0075436_100035781
359 Ga0075436_100106444
360 Ga0097620_100003932
361 Ga0075435_100030073
362 Ga0105240_10002219
363 Ga0105240_10014252
364 Ga0105240_10118734
365 Ga0105241_10022927
366 Ga0105242_10274147
367 Ga0105248_10022825
368 Ga0105237_10020633
369 Ga0105238_10000511
370 Ga0105238_10038108
371 Ga0105239_10129059
372 Ga0105239_10385596
373 Ga0157371_10223658
374 Ga0157370_10189371
375 Ga0157369_10002613
376 Ga0157369_10004029
377 Ga0157369_10125407
378 Ga0157374_10000095
379 Ga0157374_10000211
380 Ga0157374_10001813
381 Ga0157378_10000123
382 Ga0157378_10000143
383 Ga0157378_10005289
384 Ga0157378_10017375
385 Ga0157378_10065394
386 Ga0157378_10433668
387 Ga0157378_10850077
388 Ga0157372_10000957
389 Ga0157372_10002550
390 Ga0157372_10011928
391 Ga0157372_10018343
392 Ga0157372_10042301
393 Ga0157372_10046388
394 Ga0157372_10216925
395 Ga0157375_10154729
396 Ga0157375_10417232
397 Ga0157375_10611977
398 Ga0157379_10037222
399 Ga0157376_10005125
400 Ga0213876_10091609
401 Ga0228598_1000080
402 Ga0228598_1001149
403 Ga0207692_10192741
404 Ga0207642_10114771
405 Ga0207680_10058295
406 Ga0207647_10073110
407 Ga0207647_10185273
408 Ga0207684_10000519
409 Ga0207684_10122461
410 Ga0207654_10033328
411 Ga0207707_10000521
412 Ga0207707_10003826
413 Ga0207707_10365226
414 Ga0207695_10017696
415 Ga0207695_10018136
416 Ga0207695_10253099
417 Ga0207693_10023971
418 Ga0207693_10087120
419 Ga0207693_10275935
420 Ga0207693_10303268
421 Ga0207663_10070205
422 Ga0207660_10056259
423 Ga0207649_10188460
424 Ga0207652_10015075
425 Ga0207646_10137113
426 Ga0207694_10000867
427 Ga0207650_10071493
428 Ga0207659_10249769
429 Ga0207700_10009135
430 Ga0207700_10302995
431 Ga0207700_10310023
432 Ga0207700_10318579
433 Ga0207700_10754635
434 Ga0207664_10000852
435 Ga0207664_10059000
436 Ga0207664_10069020
437 Ga0207664_10564195
438 Ga0207686_10147760
439 Ga0207711_10071709
440 Ga0207711_10113008
441 Ga0207689_10342710
442 Ga0207661_10027393
443 Ga0207661_10028279
444 Ga0207661_10232679
445 Ga0207679_10009497
446 Ga0207667_10001938
447 Ga0207667_10006470
448 Ga0207667_10006996
449 Ga0207667_10053446
450 Ga0207651_10170159
451 Ga0207640_10021837
452 Ga0207677_10023288
453 Ga0207677_10225737
454 Ga0207703_10024229
455 Ga0207703_10061686
456 Ga0207703_10094482
457 Ga0207703_10112892
458 Ga0207639_10006650
459 Ga0207702_10000417
460 Ga0207702_10004506
461 Ga0207702_10004896
462 Ga0207641_10001208
463 Ga0207641_10051460
464 Ga0207648_10125357
465 Ga0207674_10002110
466 Ga0207674_10618856
467 Ga0207698_10397049
468 Ga0268266_10075826
469 Ga0268264_10012221
470 Ga0268264_10070405
471 Ga0265320_10001179
472 Ga0265340_10018603
473 Ga0265339_10024191
474 Ga0265331_10018094
475 Ga0265331_10099387
476 Ga0265316_10004197
477 Ga0265316_10008612
478 Ga0307508_10004997
479 Ga0265314_10008372
480 Ga0316215_1002017
481 Ga0373926_0082799
482 Ga0373934_0009573
483 Ga0373936_0024458
484 Ga0373954_0000433
485 Ga0373957_0007518
486 Ga0373931_0248843
487 Ga0373935_0404215
488 Ga0373935_0471731
489 Ga0373933_0020616
490 Ga0373937_0000216
491 Ga0373937_0032115
492 Ga0373937_0473234
493 Ga0373925_0238592
494 Ga0453683_0175941
495 Ga0466961_0011342
496 Ga0451576_0022077
497 Ga0451576_0158584
498 Ga0451576_0429326
499 Ga0466967_0681702
500 Ga0495592_0342073
501 Ga0495653_0026945
502 Ga0495580_0009678
503 Ga0495580_0011713
504 Ga0495580_0013615
505 Ga0495580_0018941
506 Ga0495580_0076157
507 Ga0495608_0021248
508 Ga0495587_0005938
509 Ga0495635_0148005
510 Ga0495623_0142296
511 Ga0495669_0040129
512 Ga0495604_0000287
513 Ga0495680_0167985
514 Ga0495684_0084222
515 Ga0495684_0084965
516 Ga0495602_0219593
517 Ga0496102_0151055
518 Ga0496104_0059883
519 Ga0496105_0498012
520 Ga0496112_0026226
521 Ga0496112_0191823
522 Ga0496112_0535440
523 Ga0496115_0203846
524 Ga0496115_0266319
525 nmdc:mga0n895_136247_c1
526 nmdc:mga0n895_145824_c1
527 nmdc:mga0n895_223287_c1
528 nmdc:mga0rr50_12138_c1
529 nmdc:mga0rr50_95373_c1
530 nmdc:mga08x19_256879_c1
531 nmdc:mga08x19_37310_c1
532 nmdc:mga08x19_79002_c1
533 nmdc:mga08x19_89227_c1
534 Ga0495619_0098804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qw7-assembly2.cif.gz_B crystal structure of l2 complexed with relebactam (16 hour soak) 0.782 196 232
3lez-assembly1.cif.gz_A crystal structure of a halotolerant bacterial beta-lactamase 0.7654 194 235
5o68-assembly4.cif.gz_K crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.6292 43 234
3lw3-assembly1.cif.gz_A crystal structure of hp0420-homologue from helicobacter felis 0.6266 193 232
5o68-assembly2.cif.gz_E crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.6123 43 234
ID Description Score Start End Superfamily
5ne2A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7855 196 232 3.40.710.10
af_Q9NAD2_69_201_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5943 147 205 3.10.450.50
af_Q58NB7_50_141_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5803 153 217 3.10.450.10
af_Q54CS9_3_300_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5214 69 130 3.40.50.300
2gf6D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.5167 158 235 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V8VVB7-F1-model_v4 Transporter 0.9024 47 235
AF-A0A2V7SI67-F1-model_v4 Methyl-accepting chemotaxis protein 0.8977 24 234 GO:0007165
GO:0016020
AF-A0A2V7I6V6-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.8948 24 240
AF-A0A2V8M4H2-F1-model_v4 Outer membrane protein beta-barrel domain-containing protein 0.892 24 241
AF-A0A2V7S597-F1-model_v4 Uncharacterized protein 0.892 34 224

Map