F373168

General Info

Members Datasets Scaffolds Average Seq Length
265 132 530 298

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100065909|Ga0070697_1000659092
Length 333
Sequence MSADPAAAGRRPYHPSRTGLAPPFGVESVLRFGRGLLLVAASILTASAQEPPIPTSGLSALPEAELSQLSQQDPNPLGEKALAIHPEQWKHGETDHFIYHFVHSYVATPISVEAEFHYRVVAKELEREQPAGDTKSHIYIFERPEEWQQFQVFGKLEPWTGGIQSAGSLFILRNPAYKFSGNVLGHEIAHLILHRFYTDGIPCWLNEGFAQYVSKGARASYQRARGYIAKPHSQAIASDELIPLTKLMAMTHPPSDNVETFYDESERLVRFLAFTDKRNFLTLLDALGRHQPFEASILRIYAGSFASLAALEEKFRDYAAKDFGTTLQQAGDG

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
116 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.79
Rhizosphere 91.32
Stem 0
Stem Tuber 0
Unclassified 28.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100065909 3300005536 Bacteria 2960
2 CNXas_1000066 3300000545 Bacteria 19684
3 JGI25406J46586_10000112 3300003203 Bacteria 35725
4 Ga0065703_1020642 3300005272 Bacteria 1653
5 Ga0065704_10137888 3300005289 Bacteria 1549
6 Ga0065704_10165628 3300005289 Bacteria 1312
7 Ga0065704_10186903 3300005289 Unclassified 1208
8 Ga0065712_10011442 3300005290 Bacteria 2899
9 Ga0065712_10076525 3300005290 Viruses 3645
10 Ga0065715_10127708 3300005293 Bacteria 2081
11 Ga0070676_10006700 3300005328 Bacteria 6172
12 Ga0070676_10015019 3300005328 Bacteria 4265
13 Ga0070676_10027157 3300005328 Bacteria 3244
14 Ga0070676_10056003 3300005328 Unclassified 2329
15 Ga0070690_100008499 3300005330 Bacteria 5916
16 Ga0070670_100005823 3300005331 Bacteria 10421
17 Ga0070670_100050882 3300005331 Bacteria 3559
18 Ga0070666_10010719 3300005335 Bacteria 5736
19 Ga0070666_10029887 3300005335 Bacteria 3586
20 Ga0070666_10103864 3300005335 Unclassified 1961
21 Ga0070666_10126440 3300005335 Viruses 1774
22 Ga0068868_100055801 3300005338 Bacteria 3118
23 Ga0070660_100039191 3300005339 Bacteria 3601
24 Ga0070689_100025960 3300005340 Unclassified 4405
25 Ga0070689_100401289 3300005340 Unclassified 1159
26 Ga0070668_100009652 3300005347 Bacteria 7159
27 Ga0070668_100011430 3300005347 Bacteria 6612
28 Ga0070668_100026253 3300005347 Bacteria 4418
29 Ga0070668_100090079 3300005347 Unclassified 2417
30 Ga0070669_100005516 3300005353 Bacteria 9132
31 Ga0070669_100006427 3300005353 Bacteria 8459
32 Ga0070669_100138372 3300005353 Unclassified 1875
33 Ga0070675_100014319 3300005354 Bacteria 6253
34 Ga0070675_100022297 3300005354 Bacteria 5059
35 Ga0070675_100171834 3300005354 Unclassified 1869
36 Ga0070675_100320657 3300005354 Bacteria 1369
37 Ga0070671_100001687 3300005355 Bacteria 16744
38 Ga0070671_100004271 3300005355 Bacteria 11305
39 Ga0070671_100074189 3300005355 Bacteria 2842
40 Ga0070674_100004006 3300005356 Bacteria 8346
41 Ga0070673_100026775 3300005364 Unclassified 4263
42 Ga0070673_100030270 3300005364 Bacteria 4047
43 Ga0070688_100176420 3300005365 Unclassified 1479
44 Ga0070667_100040418 3300005367 Unclassified 3911
45 Ga0070667_100043370 3300005367 Unclassified 3775
46 Ga0070667_100044215 3300005367 Bacteria 3739
47 Ga0070667_100063651 3300005367 Viruses 3126
48 Ga0070709_10177708 3300005434 Unclassified 1492
49 Ga0070714_100199758 3300005435 Bacteria 1829
50 Ga0070711_100015832 3300005439 Bacteria 4776
51 Ga0070711_100051140 3300005439 Bacteria 2836
52 Ga0070700_100430377 3300005441 Unclassified 999
53 Ga0070708_100036528 3300005445 Bacteria 4285
54 Ga0070708_100078978 3300005445 Bacteria 2976
55 Ga0070708_100149663 3300005445 Bacteria 2170
56 Ga0070708_100189372 3300005445 Bacteria 1924
57 Ga0070678_100024610 3300005456 Unclassified 4035
58 Ga0070678_100189124 3300005456 Unclassified 1691
59 Ga0070678_100561778 3300005456 Bacteria 1014
60 Ga0068867_100014334 3300005459 Bacteria 5614
61 Ga0070706_100000035 3300005467 Bacteria 152107
62 Ga0070706_100080306 3300005467 Bacteria 3020
63 Ga0070706_100137227 3300005467 Bacteria 2283
64 Ga0070706_100379465 3300005467 Bacteria 1317
65 Ga0070706_100459475 3300005467 Viruses 1185
66 Ga0070707_100001740 3300005468 Bacteria 20969
67 Ga0070707_100047584 3300005468 Bacteria 4106
68 Ga0070707_100091935 3300005468 Bacteria 2937
69 Ga0070707_100245324 3300005468 Bacteria 1743
70 Ga0070707_100424610 3300005468 Bacteria 1290
71 Ga0070698_100001500 3300005471 Bacteria 25924
72 Ga0070698_100056268 3300005471 Bacteria 3987
73 Ga0070698_100482897 3300005471 Unclassified 1176
74 Ga0070699_100058159 3300005518 Unclassified 3349
75 Ga0070699_100068706 3300005518 Unclassified 3078
76 Ga0070699_100098384 3300005518 Bacteria 2563
77 Ga0070697_100000569 3300005536 Bacteria 27841
78 Ga0070697_100005705 3300005536 Bacteria 9588
79 Ga0070697_100063132 3300005536 Bacteria 3024
80 Ga0070697_100258877 3300005536 Bacteria 1489
81 Ga0070697_100352221 3300005536 Bacteria 1272
82 Ga0070672_100009155 3300005543 Bacteria 6813
83 Ga0070672_100017981 3300005543 Viruses 5100
84 Ga0070672_100175995 3300005543 Unclassified 1781
85 Ga0070665_100029475 3300005548 Bacteria 5523
86 Ga0070665_100050892 3300005548 Viruses 4157
87 Ga0070665_100054958 3300005548 Unclassified 3993
88 Ga0068855_100002235 3300005563 Bacteria 23937
89 Ga0068855_100303085 3300005563 Unclassified 1769
90 Ga0070664_100212553 3300005564 Bacteria 1729
91 Ga0068856_100389438 3300005614 Unclassified 1413
92 Ga0068864_100251641 3300005618 Bacteria 1641
93 Ga0068866_10010593 3300005718 Bacteria 3958
94 Ga0068863_100241616 3300005841 Bacteria 1743
95 Ga0068860_100000199 3300005843 Bacteria 95791
96 Ga0068860_100049133 3300005843 Viruses 4020
97 Ga0068860_100095260 3300005843 Bacteria 2837
98 Ga0081539_10000052 3300005985 Bacteria 268240
99 Ga0081539_10000710 3300005985 Bacteria 66710
100 Ga0081539_10006064 3300005985 Bacteria 11821
101 Ga0081539_10021855 3300005985 Bacteria 4257
102 Ga0070717_10006106 3300006028 Bacteria 8847
103 Ga0070717_10200779 3300006028 Unclassified 1746
104 Ga0070717_10231077 3300006028 Unclassified 1628
105 Ga0070717_10265950 3300006028 Bacteria 1518
106 Ga0070715_10112255 3300006163 Bacteria 1287
107 Ga0070712_100055033 3300006175 Bacteria 2784
108 Ga0070712_100061562 3300006175 Unclassified 2652
109 Ga0097621_100470019 3300006237 Unclassified 1135
110 Ga0068871_100028325 3300006358 Bacteria 4392
111 Ga0068871_100046969 3300006358 Unclassified 3480
112 Ga0075434_100270415 3300006871 Bacteria 1719
113 Ga0068865_100029526 3300006881 Unclassified 3640
114 Ga0068865_100051691 3300006881 Viruses 2846
115 Ga0075435_100302419 3300007076 Unclassified 1368
116 Ga0111539_10175006 3300009094 Bacteria 2507
117 Ga0111539_10206381 3300009094 Bacteria 2290
118 Ga0111539_10266767 3300009094 Bacteria 1993
119 Ga0105245_10436565 3300009098 Unclassified 1315
120 Ga0105242_10016112 3300009176 Bacteria 5807
121 Ga0105242_10120094 3300009176 Bacteria 2254
122 Ga0105237_10489259 3300009545 Unclassified 1237
123 Ga0099796_10101583 3300010159 Unclassified 1082
124 Ga0105239_10085732 3300010375 Bacteria 3471
125 Ga0105239_10112023 3300010375 Bacteria 3025
126 Ga0157371_10180732 3300013102 Unclassified 1509
127 Ga0157374_10013268 3300013296 Bacteria 7188
128 Ga0157374_10035984 3300013296 Bacteria 4533
129 Ga0157374_10088363 3300013296 Bacteria 2952
130 Ga0157374_10233283 3300013296 Bacteria 1808
131 Ga0157374_10337664 3300013296 Unclassified 1495
132 Ga0157378_10031339 3300013297 Unclassified 4698
133 Ga0157378_10033706 3300013297 Bacteria 4528
134 Ga0157378_10041408 3300013297 Unclassified 4086
135 Ga0157378_10510679 3300013297 Bacteria 1202
136 Ga0157378_10603806 3300013297 Unclassified 1109
137 Ga0163162_10022831 3300013306 Bacteria 6170
138 Ga0163162_10026482 3300013306 Bacteria 5730
139 Ga0163162_10045660 3300013306 Unclassified 4388
140 Ga0163162_10126277 3300013306 Unclassified 2664
141 Ga0163162_10181316 3300013306 Unclassified 2232
142 Ga0157372_10047520 3300013307 Unclassified 4770
143 Ga0157375_10003818 3300013308 Bacteria 13065
144 Ga0157375_10031091 3300013308 Bacteria 5040
145 Ga0157375_10054138 3300013308 Unclassified 3951
146 Ga0157375_10066862 3300013308 Unclassified 3590
147 Ga0157375_10239448 3300013308 Bacteria 1974
148 Ga0157375_10315812 3300013308 Unclassified 1727
149 Ga0157375_10401852 3300013308 Unclassified 1537
150 Ga0157377_10068913 3300014745 Unclassified 2040
151 Ga0157376_10040348 3300014969 Bacteria 3815
152 Ga0157376_10083714 3300014969 Bacteria 2745
153 Ga0163161_10017760 3300017792 Bacteria 4984
154 Ga0213876_10047211 3300021384 Bacteria 2276
155 Ga0213876_10111048 3300021384 Bacteria 1455
156 Ga0207697_10002443 3300025315 Bacteria 9628
157 Ga0207697_10003976 3300025315 Bacteria 7171
158 Ga0207697_10032685 3300025315 Unclassified 2129
159 Ga0207692_10021389 3300025898 Bacteria 2959
160 Ga0207642_10136975 3300025899 Unclassified 1285
161 Ga0207688_10004859 3300025901 Bacteria 7316
162 Ga0207688_10015021 3300025901 Bacteria 4201
163 Ga0207688_10230097 3300025901 Unclassified 1119
164 Ga0207680_10019557 3300025903 Bacteria 3624
165 Ga0207680_10053152 3300025903 Viruses 2431
166 Ga0207699_10007456 3300025906 Bacteria 5354
167 Ga0207645_10004352 3300025907 Bacteria 10487
168 Ga0207645_10007314 3300025907 Bacteria 7809
169 Ga0207645_10008167 3300025907 Bacteria 7330
170 Ga0207684_10000043 3300025910 Bacteria 259939
171 Ga0207684_10006807 3300025910 Bacteria 10364
172 Ga0207684_10086432 3300025910 Bacteria 2671
173 Ga0207684_10205587 3300025910 Bacteria 1699
174 Ga0207693_10009030 3300025915 Bacteria 8136
175 Ga0207663_10006660 3300025916 Bacteria 5939
176 Ga0207657_10085824 3300025919 Bacteria 2636
177 Ga0207646_10017941 3300025922 Bacteria 6609
178 Ga0207646_10063645 3300025922 Bacteria 3293
179 Ga0207646_10120967 3300025922 Bacteria 2352
180 Ga0207646_10224197 3300025922 Bacteria 1698
181 Ga0207646_10314811 3300025922 Unclassified 1414
182 Ga0207646_10406592 3300025922 Unclassified 1229
183 Ga0207681_10015072 3300025923 Unclassified 4818
184 Ga0207681_10085515 3300025923 Bacteria 2238
185 Ga0207681_10175127 3300025923 Unclassified 1629
186 Ga0207650_10053337 3300025925 Unclassified 2996
187 Ga0207650_10087122 3300025925 Bacteria 2379
188 Ga0207659_10031349 3300025926 Viruses 3638
189 Ga0207659_10212470 3300025926 Bacteria 1551
190 Ga0207687_10320191 3300025927 Unclassified 1255
191 Ga0207687_10445696 3300025927 Bacteria 1073
192 Ga0207664_10089758 3300025929 Bacteria 2517
193 Ga0207644_10027067 3300025931 Viruses 3958
194 Ga0207644_10038671 3300025931 Unclassified 3363
195 Ga0207644_10059247 3300025931 Bacteria 2769
196 Ga0207706_10024338 3300025933 Bacteria 5428
197 Ga0207686_10005931 3300025934 Bacteria 6555
198 Ga0207670_10410097 3300025936 Unclassified 1085
199 Ga0207669_10005079 3300025937 Bacteria 5860
200 Ga0207669_10007634 3300025937 Bacteria 5020
201 Ga0207704_10063580 3300025938 Viruses 2301
202 Ga0207665_10008481 3300025939 Bacteria 6768
203 Ga0207665_10171043 3300025939 Bacteria 1569
204 Ga0207691_10005768 3300025940 Bacteria 11980
205 Ga0207691_10012683 3300025940 Bacteria 8073
206 Ga0207691_10022916 3300025940 Bacteria 5885
207 Ga0207691_10037035 3300025940 Bacteria 4518
208 Ga0207691_10353939 3300025940 Unclassified 1256
209 Ga0207679_10329464 3300025945 Bacteria 1325
210 Ga0207667_10003901 3300025949 Bacteria 18340
211 Ga0207667_10331479 3300025949 Unclassified 1554
212 Ga0207651_10018081 3300025960 Unclassified 4185
213 Ga0207651_10018466 3300025960 Viruses 4151
214 Ga0207651_10163577 3300025960 Unclassified 1747
215 Ga0207651_10205704 3300025960 Unclassified 1581
216 Ga0207658_10039967 3300025986 Bacteria 3387
217 Ga0207677_10074034 3300026023 Bacteria 2415
218 Ga0207708_10475956 3300026075 Unclassified 1044
219 Ga0207702_10195438 3300026078 Viruses 1872
220 Ga0207648_10012251 3300026089 Bacteria 8029
221 Ga0207648_10097980 3300026089 Viruses 2567
222 Ga0207676_10264819 3300026095 Bacteria 1554
223 Ga0207683_10020284 3300026121 Bacteria 5684
224 Ga0207683_10023163 3300026121 Bacteria 5337
225 Ga0207683_10150473 3300026121 Unclassified 2100
226 Ga0207683_10536602 3300026121 Bacteria 1081
227 Ga0268264_10001876 3300028381 Bacteria 19086
228 Ga0268264_10095182 3300028381 Bacteria 2576
229 Ga0373943_0028376 3300035170 Bacteria 2637
230 Ga0373943_0037303 3300035170 Bacteria 2333
231 Ga0373946_0042108 3300035171 Unclassified 1876
232 Ga0373946_0170750 3300035171 Bacteria 1026
233 Ga0373931_0060602 3300035691 Bacteria 2038
234 Ga0373935_0121760 3300035692 Bacteria 1744
235 Ga0373927_0026751 3300035695 Bacteria 3770
236 Ga0373947_0310761 3300035725 Unclassified 1052
237 Ga0373925_0241470 3300037068 Unclassified 1447
238 Ga0395900_0024462 3300037418 Bacteria 6185
239 Ga0436365_0109923 3300039437 Bacteria 2699
240 Ga0436365_1807797 3300039437 Bacteria 4474
241 Ga0451839_0105081 3300041496 Unclassified 1036
242 Ga0495580_0167255 3300046472 Unclassified 1521
243 Ga0495598_0005404 3300046537 Bacteria 2829
244 Ga0495659_0029175 3300046664 Bacteria 1914
245 Ga0495658_0233770 3300046683 Bacteria 1153
246 Ga0495669_0011039 3300046684 Bacteria 3825
247 Ga0496100_0009645 3300048903 Bacteria 5429
248 Ga0496100_0021163 3300048903 Bacteria 3913
249 Ga0496100_0396180 3300048903 Unclassified 1051
250 Ga0496101_0008508 3300048904 Bacteria 6707
251 Ga0496103_0024025 3300048906 Bacteria 3677
252 Ga0496104_0007681 3300048907 Bacteria 9546
253 Ga0496106_0011416 3300048909 Bacteria 6572
254 Ga0496106_0118204 3300048909 Bacteria 2070
255 Ga0496107_0002913 3300048910 Bacteria 11313
256 Ga0496108_0073480 3300048911 Bacteria 2887
257 Ga0496108_0221455 3300048911 Unclassified 1644
258 Ga0496109_0473874 3300048912 Unclassified 1182
259 Ga0496110_0480098 3300048913 Unclassified 1132
260 Ga0496111_0293235 3300048914 Unclassified 1206
261 Ga0496112_0077834 3300048915 Bacteria 3280
262 Ga0496112_0125167 3300048915 Bacteria 2541
263 Ga0496114_0013011 3300048917 Bacteria 6668
264 Ga0496115_0007492 3300048918 Bacteria 8034
265 nmdc:mga08y16_273139_c1 3300050511 Unclassified 1744
266 Ga0070697_100065909
267 CNXas_1000066
268 JGI25406J46586_10000112
269 Ga0065703_1020642
270 Ga0065704_10137888
271 Ga0065704_10165628
272 Ga0065704_10186903
273 Ga0065712_10011442
274 Ga0065712_10076525
275 Ga0065715_10127708
276 Ga0070676_10006700
277 Ga0070676_10015019
278 Ga0070676_10027157
279 Ga0070676_10056003
280 Ga0070690_100008499
281 Ga0070670_100005823
282 Ga0070670_100050882
283 Ga0070666_10010719
284 Ga0070666_10029887
285 Ga0070666_10103864
286 Ga0070666_10126440
287 Ga0068868_100055801
288 Ga0070660_100039191
289 Ga0070689_100025960
290 Ga0070689_100401289
291 Ga0070668_100009652
292 Ga0070668_100011430
293 Ga0070668_100026253
294 Ga0070668_100090079
295 Ga0070669_100005516
296 Ga0070669_100006427
297 Ga0070669_100138372
298 Ga0070675_100014319
299 Ga0070675_100022297
300 Ga0070675_100171834
301 Ga0070675_100320657
302 Ga0070671_100001687
303 Ga0070671_100004271
304 Ga0070671_100074189
305 Ga0070674_100004006
306 Ga0070673_100026775
307 Ga0070673_100030270
308 Ga0070688_100176420
309 Ga0070667_100040418
310 Ga0070667_100043370
311 Ga0070667_100044215
312 Ga0070667_100063651
313 Ga0070709_10177708
314 Ga0070714_100199758
315 Ga0070711_100015832
316 Ga0070711_100051140
317 Ga0070700_100430377
318 Ga0070708_100036528
319 Ga0070708_100078978
320 Ga0070708_100149663
321 Ga0070708_100189372
322 Ga0070678_100024610
323 Ga0070678_100189124
324 Ga0070678_100561778
325 Ga0068867_100014334
326 Ga0070706_100000035
327 Ga0070706_100080306
328 Ga0070706_100137227
329 Ga0070706_100379465
330 Ga0070706_100459475
331 Ga0070707_100001740
332 Ga0070707_100047584
333 Ga0070707_100091935
334 Ga0070707_100245324
335 Ga0070707_100424610
336 Ga0070698_100001500
337 Ga0070698_100056268
338 Ga0070698_100482897
339 Ga0070699_100058159
340 Ga0070699_100068706
341 Ga0070699_100098384
342 Ga0070697_100000569
343 Ga0070697_100005705
344 Ga0070697_100063132
345 Ga0070697_100258877
346 Ga0070697_100352221
347 Ga0070672_100009155
348 Ga0070672_100017981
349 Ga0070672_100175995
350 Ga0070665_100029475
351 Ga0070665_100050892
352 Ga0070665_100054958
353 Ga0068855_100002235
354 Ga0068855_100303085
355 Ga0070664_100212553
356 Ga0068856_100389438
357 Ga0068864_100251641
358 Ga0068866_10010593
359 Ga0068863_100241616
360 Ga0068860_100000199
361 Ga0068860_100049133
362 Ga0068860_100095260
363 Ga0081539_10000052
364 Ga0081539_10000710
365 Ga0081539_10006064
366 Ga0081539_10021855
367 Ga0070717_10006106
368 Ga0070717_10200779
369 Ga0070717_10231077
370 Ga0070717_10265950
371 Ga0070715_10112255
372 Ga0070712_100055033
373 Ga0070712_100061562
374 Ga0097621_100470019
375 Ga0068871_100028325
376 Ga0068871_100046969
377 Ga0075434_100270415
378 Ga0068865_100029526
379 Ga0068865_100051691
380 Ga0075435_100302419
381 Ga0111539_10175006
382 Ga0111539_10206381
383 Ga0111539_10266767
384 Ga0105245_10436565
385 Ga0105242_10016112
386 Ga0105242_10120094
387 Ga0105237_10489259
388 Ga0099796_10101583
389 Ga0105239_10085732
390 Ga0105239_10112023
391 Ga0157371_10180732
392 Ga0157374_10013268
393 Ga0157374_10035984
394 Ga0157374_10088363
395 Ga0157374_10233283
396 Ga0157374_10337664
397 Ga0157378_10031339
398 Ga0157378_10033706
399 Ga0157378_10041408
400 Ga0157378_10510679
401 Ga0157378_10603806
402 Ga0163162_10022831
403 Ga0163162_10026482
404 Ga0163162_10045660
405 Ga0163162_10126277
406 Ga0163162_10181316
407 Ga0157372_10047520
408 Ga0157375_10003818
409 Ga0157375_10031091
410 Ga0157375_10054138
411 Ga0157375_10066862
412 Ga0157375_10239448
413 Ga0157375_10315812
414 Ga0157375_10401852
415 Ga0157377_10068913
416 Ga0157376_10040348
417 Ga0157376_10083714
418 Ga0163161_10017760
419 Ga0213876_10047211
420 Ga0213876_10111048
421 Ga0207697_10002443
422 Ga0207697_10003976
423 Ga0207697_10032685
424 Ga0207692_10021389
425 Ga0207642_10136975
426 Ga0207688_10004859
427 Ga0207688_10015021
428 Ga0207688_10230097
429 Ga0207680_10019557
430 Ga0207680_10053152
431 Ga0207699_10007456
432 Ga0207645_10004352
433 Ga0207645_10007314
434 Ga0207645_10008167
435 Ga0207684_10000043
436 Ga0207684_10006807
437 Ga0207684_10086432
438 Ga0207684_10205587
439 Ga0207693_10009030
440 Ga0207663_10006660
441 Ga0207657_10085824
442 Ga0207646_10017941
443 Ga0207646_10063645
444 Ga0207646_10120967
445 Ga0207646_10224197
446 Ga0207646_10314811
447 Ga0207646_10406592
448 Ga0207681_10015072
449 Ga0207681_10085515
450 Ga0207681_10175127
451 Ga0207650_10053337
452 Ga0207650_10087122
453 Ga0207659_10031349
454 Ga0207659_10212470
455 Ga0207687_10320191
456 Ga0207687_10445696
457 Ga0207664_10089758
458 Ga0207644_10027067
459 Ga0207644_10038671
460 Ga0207644_10059247
461 Ga0207706_10024338
462 Ga0207686_10005931
463 Ga0207670_10410097
464 Ga0207669_10005079
465 Ga0207669_10007634
466 Ga0207704_10063580
467 Ga0207665_10008481
468 Ga0207665_10171043
469 Ga0207691_10005768
470 Ga0207691_10012683
471 Ga0207691_10022916
472 Ga0207691_10037035
473 Ga0207691_10353939
474 Ga0207679_10329464
475 Ga0207667_10003901
476 Ga0207667_10331479
477 Ga0207651_10018081
478 Ga0207651_10018466
479 Ga0207651_10163577
480 Ga0207651_10205704
481 Ga0207658_10039967
482 Ga0207677_10074034
483 Ga0207708_10475956
484 Ga0207702_10195438
485 Ga0207648_10012251
486 Ga0207648_10097980
487 Ga0207676_10264819
488 Ga0207683_10020284
489 Ga0207683_10023163
490 Ga0207683_10150473
491 Ga0207683_10536602
492 Ga0268264_10001876
493 Ga0268264_10095182
494 Ga0373943_0028376
495 Ga0373943_0037303
496 Ga0373946_0042108
497 Ga0373946_0170750
498 Ga0373931_0060602
499 Ga0373935_0121760
500 Ga0373927_0026751
501 Ga0373947_0310761
502 Ga0373925_0241470
503 Ga0395900_0024462
504 Ga0436365_0109923
505 Ga0436365_1807797
506 Ga0451839_0105081
507 Ga0495580_0167255
508 Ga0495598_0005404
509 Ga0495659_0029175
510 Ga0495658_0233770
511 Ga0495669_0011039
512 Ga0496100_0009645
513 Ga0496100_0021163
514 Ga0496100_0396180
515 Ga0496101_0008508
516 Ga0496103_0024025
517 Ga0496104_0007681
518 Ga0496106_0011416
519 Ga0496106_0118204
520 Ga0496107_0002913
521 Ga0496108_0073480
522 Ga0496108_0221455
523 Ga0496109_0473874
524 Ga0496110_0480098
525 Ga0496111_0293235
526 Ga0496112_0077834
527 Ga0496112_0125167
528 Ga0496114_0013011
529 Ga0496115_0007492
530 nmdc:mga08y16_273139_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13485

Peptidase_MA_2

Peptidase MA superfamily

125

320

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4arf-assembly1.cif.gz_A crystal structure of the peptidase domain of collagenase h from clostridium histolyticum in complex with the peptidic inhibitor isoamylphosphonyl-gly-pro-ala at 1.77 angstrom resolution. 0.7114 60 282
7zbv-assembly1.cif.gz_A crystal structure of the peptidase domain of collagenase g from clostridium histolyticum in complex with a diphosphonate-based inhibitor 0.6944 40 282
4ar8-assembly2.cif.gz_B crystal structure of the peptidase domain of collagenase t from clostridium tetani complexed with the peptidic inhibitor isoamyl- phosphonyl-gly-pro-ala at 2.05 angstrom resolution. 0.6788 39 283
7z5u-assembly1.cif.gz_A crystal structure of the peptidase domain of collagenase g from clostridium histolyticum in complex with a hydroxamate-based inhibitor 0.6741 40 282
7vlz-assembly1.cif.gz_A crystal structure of the collagenase unit of a vibrio collagenase from vibrio harveyi vhjr7 0.661 39 282
ID Description Score Start End Superfamily
4ar8A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Collagenase ColT, N-terminal domain 0.6662 40 158 3.40.30.160
af_A0A1Q0XTP9_219_321_3.30.2010.30 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6081 60 157 3.30.2010.30
4ar8A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Collagenase ColT, N-terminal domain 0.5778 40 158 3.40.30.160
af_Q2FY02_5_155_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.5762 72 184 3.40.390.30
af_A5A631_214_450_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.5669 54 287 1.10.390.10
ID Description Score Start End GO Terms
AF-A0A2V6KSS0-F1-model_v4 Peptidase MA-like domain-containing protein 0.9493 97 294
AF-A0A2V5W174-F1-model_v4 Uncharacterized protein 0.9349 205 282
AF-A0A2V6D7A7-F1-model_v4 Peptidase MA-like domain-containing protein 0.9308 5 257
AF-A0A2V6KSS0-F1-model_v4 Peptidase MA-like domain-containing protein 0.9266 97 294
AF-A0A838I579-F1-model_v4 Peptidase MA-like domain-containing protein 0.9229 4 294

Map