F372447

General Info

Members Datasets Scaffolds Average Seq Length
264 185 528 190

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_101020322|Ga0068867_1010203221
Length 203
Sequence MLKEIRPAIVLLVGLTLITGLAYPLAMTGIAGAIFPSQAQGSLIRRDDGTVIGSELIGQLFTSDKYFHGRPSATLGPDPADPTKTTSVPYNAVNSMGSNLGPTNRALIDRVKGDVDKLKQENASMPVPIDMVTTSASGLDPDITPEAAEFQLPRVAKARNLPEDKVKQLVADHVERRWLGLLGEPRVNVLELNLALDQLASAQ

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
110 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
111 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
182 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
183 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
184 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
185 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.95
Nodule 0.38
Rhizoplane 9.47
Rhizosphere 76.89
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_101020322 3300005459 Bacteria 751
2 Ga0070658_10017311 3300005327 Bacteria 5768
3 Ga0070680_100007320 3300005336 Bacteria 8417
4 Ga0070680_100369329 3300005336 Bacteria 1221
5 Ga0070682_100004505 3300005337 Bacteria 7737
6 Ga0068868_100011013 3300005338 Bacteria 6572
7 Ga0070660_100005914 3300005339 Bacteria 8462
8 Ga0070660_100027874 3300005339 Bacteria 4220
9 Ga0070687_100330045 3300005343 Bacteria 978
10 Ga0070667_100122144 3300005367 Bacteria 2266
11 Ga0070709_10008444 3300005434 Bacteria 5660
12 Ga0070701_10459673 3300005438 Bacteria 819
13 Ga0070705_100000508 3300005440 Bacteria 22491
14 Ga0070705_100031630 3300005440 Bacteria 2932
15 Ga0070700_100005087 3300005441 Bacteria 6937
16 Ga0070700_100609767 3300005441 Bacteria 856
17 Ga0070694_100000753 3300005444 Bacteria 18124
18 Ga0070708_100074607 3300005445 Bacteria 3060
19 Ga0070663_100008773 3300005455 Bacteria 6235
20 Ga0070663_100053515 3300005455 Bacteria 2882
21 Ga0070663_100077494 3300005455 Bacteria 2434
22 Ga0070663_100430269 3300005455 Bacteria 1084
23 Ga0070678_100028139 3300005456 Bacteria 3828
24 Ga0070678_100379139 3300005456 Bacteria 1223
25 Ga0070681_10007769 3300005458 Bacteria 10484
26 Ga0070681_10025334 3300005458 Bacteria 5967
27 Ga0070698_100284372 3300005471 Bacteria 1585
28 Ga0070698_100933349 3300005471 Bacteria 814
29 Ga0070699_100011482 3300005518 Bacteria 7648
30 Ga0070679_100012308 3300005530 Bacteria 8172
31 Ga0070679_100223383 3300005530 Bacteria 1844
32 Ga0070684_100650483 3300005535 Bacteria 981
33 Ga0068853_100008671 3300005539 Bacteria 8176
34 Ga0070695_100003660 3300005545 Bacteria 8954
35 Ga0070695_100121988 3300005545 Bacteria 1784
36 Ga0070696_100003133 3300005546 Bacteria 11012
37 Ga0070693_100002640 3300005547 Bacteria 8255
38 Ga0068855_100017082 3300005563 Bacteria 8729
39 Ga0068855_100019429 3300005563 Bacteria 8165
40 Ga0070664_100130605 3300005564 Bacteria 2206
41 Ga0068857_100001810 3300005577 Bacteria 17200
42 Ga0068852_100160784 3300005616 Bacteria 2097
43 Ga0068859_100027528 3300005617 Bacteria 5702
44 Ga0068861_100075272 3300005719 Bacteria 2628
45 Ga0068861_100258447 3300005719 Bacteria 1490
46 Ga0068851_10085315 3300005834 Bacteria 1655
47 Ga0068870_10660155 3300005840 Bacteria 717
48 Ga0068863_100363116 3300005841 Bacteria 1412
49 Ga0068858_100085906 3300005842 Bacteria 2927
50 Ga0068860_100017625 3300005843 Bacteria 6958
51 Ga0068860_100026168 3300005843 Bacteria 5627
52 Ga0068862_100001864 3300005844 Bacteria 19093
53 Ga0081540_1030396 3300005983 Bacteria 2992
54 Ga0075365_10104887 3300006038 Bacteria 1939
55 Ga0075363_100186826 3300006048 Bacteria 1181
56 Ga0075364_10099330 3300006051 Bacteria 1937
57 Ga0075367_10001252 3300006178 Bacteria 10712
58 Ga0097621_100827186 3300006237 Bacteria 859
59 Ga0075434_100238665 3300006871 Bacteria 1838
60 Ga0097620_100027528 3300006931 Bacteria 5702
61 Ga0105240_10146332 3300009093 Bacteria 2819
62 Ga0105243_10042691 3300009148 Bacteria 3551
63 Ga0105241_10016308 3300009174 Bacteria 5445
64 Ga0105242_11734679 3300009176 Bacteria 661
65 Ga0105237_10016176 3300009545 Bacteria 7759
66 Ga0105238_10042741 3300009551 Bacteria 4588
67 Ga0105238_10113903 3300009551 Bacteria 2684
68 Ga0105249_10003884 3300009553 Bacteria 12908
69 Ga0105239_10289433 3300010375 Bacteria 1845
70 Ga0105246_10057295 3300011119 Bacteria 2696
71 Ga0105246_10077140 3300011119 Bacteria 2363
72 Ga0157369_10478187 3300013105 Bacteria 1289
73 Ga0157374_11125029 3300013296 Unclassified 806
74 Ga0157378_10086585 3300013297 Bacteria 2840
75 Ga0163162_10797660 3300013306 Bacteria 1062
76 Ga0163162_11350583 3300013306 Bacteria 810
77 Ga0157375_10090107 3300013308 Bacteria 3125
78 Ga0157379_10093705 3300014968 Bacteria 2694
79 Ga0157376_10581197 3300014969 Bacteria 1112
80 Ga0207427_110494 3300025231 Bacteria 963
81 Ga0209233_1000626 3300025261 Bacteria 17730
82 Ga0207656_10071260 3300025321 Bacteria 1545
83 Ga0207647_10011318 3300025904 Bacteria 6262
84 Ga0207643_10381364 3300025908 Bacteria 889
85 Ga0207705_10012861 3300025909 Bacteria 6043
86 Ga0207705_10133432 3300025909 Bacteria 1849
87 Ga0207707_10019301 3300025912 Bacteria 5950
88 Ga0207707_10049909 3300025912 Bacteria 3646
89 Ga0207660_10012363 3300025917 Bacteria 5584
90 Ga0207660_10179660 3300025917 Bacteria 1643
91 Ga0207657_10000774 3300025919 Bacteria 33927
92 Ga0207657_10059618 3300025919 Bacteria 3278
93 Ga0207652_10011409 3300025921 Bacteria 7164
94 Ga0207694_10032490 3300025924 Bacteria 3995
95 Ga0207694_10069830 3300025924 Bacteria 2745
96 Ga0207706_10173688 3300025933 Bacteria 1893
97 Ga0207669_10427556 3300025937 Bacteria 1044
98 Ga0207689_10214924 3300025942 Bacteria 1589
99 Ga0207689_10390675 3300025942 Bacteria 1159
100 Ga0207679_10098027 3300025945 Bacteria 2285
101 Ga0207667_10019956 3300025949 Bacteria 7468
102 Ga0207667_10143992 3300025949 Bacteria 2454
103 Ga0207712_10000633 3300025961 Bacteria 27772
104 Ga0207668_10163759 3300025972 Bacteria 1736
105 Ga0207658_10286055 3300025986 Bacteria 1415
106 Ga0207639_10008463 3300026041 Bacteria 7051
107 Ga0207678_10000157 3300026067 Bacteria 56289
108 Ga0207678_10313886 3300026067 Bacteria 1348
109 Ga0207708_10007214 3300026075 Bacteria 8217
110 Ga0207708_10762686 3300026075 Bacteria 831
111 Ga0207648_10977610 3300026089 Bacteria 792
112 Ga0207674_10002863 3300026116 Bacteria 21432
113 Ga0207675_100105641 3300026118 Bacteria 2654
114 Ga0207683_10228735 3300026121 Bacteria 1695
115 Ga0207683_10379488 3300026121 Bacteria 1299
116 Ga0207698_10138117 3300026142 Bacteria 2095
117 Ga0268265_10031339 3300028380 Bacteria 3839
118 Ga0268264_10026308 3300028381 Bacteria 4753
119 Ga0268264_10060551 3300028381 Bacteria 3173
120 Ga0265318_10001925 3300028577 Bacteria 11611
121 Ga0307515_10001155 3300028794 Bacteria 60447
122 Ga0265325_10121406 3300031241 Bacteria 1259
123 Ga0265340_10003636 3300031247 Bacteria 8670
124 Ga0265340_10169259 3300031247 Bacteria 990
125 Ga0265339_10001899 3300031249 Bacteria 15338
126 Ga0265339_10023003 3300031249 Bacteria 3605
127 Ga0265339_10026297 3300031249 Bacteria 3334
128 Ga0265331_10032408 3300031250 Bacteria 2589
129 Ga0265316_10020872 3300031344 Bacteria 5563
130 Ga0265316_10056628 3300031344 Bacteria 3060
131 Ga0265316_10321812 3300031344 Bacteria 1123
132 Ga0265313_10008134 3300031595 Bacteria 7015
133 Ga0265313_10016451 3300031595 Bacteria 4250
134 Ga0265313_10018753 3300031595 Bacteria 3875
135 Ga0265313_10080347 3300031595 Bacteria 1482
136 Ga0265314_10001283 3300031711 Bacteria 28552
137 Ga0265314_10003416 3300031711 Bacteria 15368
138 Ga0265314_10021554 3300031711 Bacteria 4950
139 Ga0265314_10158914 3300031711 Bacteria 1377
140 Ga0265314_10267226 3300031711 Bacteria 974
141 Ga0265342_10011482 3300031712 Bacteria 6060
142 Ga0265342_10096256 3300031712 Bacteria 1692
143 Ga0307412_10164579 3300031911 Bacteria 1652
144 Ga0373934_0073740 3300035086 Bacteria 1367
145 Ga0373955_0015590 3300035172 Bacteria 3724
146 Ga0373933_0012072 3300035724 Bacteria 4771
147 Ga0373947_0079083 3300035725 Bacteria 2031
148 Ga0373937_0043274 3300036401 Bacteria 4109
149 Ga0373937_0278005 3300036401 Bacteria 1581
150 Ga0373925_0789962 3300037068 Bacteria 783
151 Ga0436365_0531713 3300039437 Bacteria 972
152 Ga0451833_1353746 3300041491 Bacteria 2623
153 Ga0451841_0571377 3300041498 Bacteria 699
154 Ga0451849_0981115 3300041505 Bacteria 1188
155 Ga0466972_0090827 3300044658 Bacteria 1448
156 Ga0466965_0059196 3300044683 Bacteria 1911
157 Ga0466960_0035770 3300044901 Bacteria 2323
158 Ga0495603_0013229 3300046455 Bacteria 4989
159 Ga0495603_0049297 3300046455 Bacteria 2507
160 Ga0495629_0126785 3300046459 Bacteria 1778
161 Ga0495638_0006297 3300046460 Bacteria 8652
162 Ga0495639_0060844 3300046475 Bacteria 1731
163 Ga0495584_0081224 3300046491 Bacteria 1632
164 Ga0495594_0218790 3300046499 Bacteria 1086
165 Ga0495608_0074703 3300046511 Bacteria 2209
166 Ga0495632_0316714 3300046519 Bacteria 690
167 Ga0495666_0159590 3300046526 Bacteria 1046
168 Ga0495622_0005820 3300046557 Bacteria 5718
169 Ga0495622_0028665 3300046557 Bacteria 2600
170 Ga0495622_0121427 3300046557 Bacteria 1193
171 Ga0495659_0197858 3300046664 Bacteria 823
172 Ga0495657_0506675 3300046675 Bacteria 703
173 Ga0495670_0486292 3300046691 Bacteria 670
174 Ga0495680_0360538 3300047322 Bacteria 1010
175 Ga0495680_0457587 3300047322 Bacteria 872
176 Ga0495675_0033750 3300047444 Bacteria 3266
177 Ga0495593_0043358 3300047673 Bacteria 2411
178 Ga0495614_0061024 3300048089 Bacteria 1620
179 Ga0495626_0132002 3300048091 Bacteria 1066
180 Ga0496100_0064379 3300048903 Bacteria 2426
181 Ga0496100_0076694 3300048903 Bacteria 2245
182 Ga0496101_0007369 3300048904 Bacteria 7126
183 Ga0496101_0291817 3300048904 Bacteria 1276
184 Ga0496101_0442602 3300048904 Bacteria 1025
185 Ga0496102_0011091 3300048905 Bacteria 7762
186 Ga0496102_0014892 3300048905 Bacteria 6765
187 Ga0496102_0167820 3300048905 Bacteria 2066
188 Ga0496102_0739174 3300048905 Bacteria 907
189 Ga0496103_0000898 3300048906 Bacteria 21446
190 Ga0496103_0015024 3300048906 Bacteria 4603
191 Ga0496104_0029561 3300048907 Bacteria 5084
192 Ga0496105_0067678 3300048908 Bacteria 2949
193 Ga0496105_0122419 3300048908 Bacteria 2145
194 Ga0496106_0006772 3300048909 Bacteria 8482
195 Ga0496106_0018107 3300048909 Bacteria 5208
196 Ga0496106_0624296 3300048909 Bacteria 862
197 Ga0496107_0006344 3300048910 Bacteria 8129
198 Ga0496107_0040070 3300048910 Bacteria 3361
199 Ga0496109_0085189 3300048912 Bacteria 2917
200 Ga0496110_0460833 3300048913 Bacteria 1158
201 Ga0496112_0015605 3300048915 Bacteria 7095
202 Ga0496113_0143441 3300048916 Bacteria 1880
203 Ga0496115_0046336 3300048918 Bacteria 3474
204 Ga0496115_0081961 3300048918 Bacteria 2628
205 Ga0496120_0037500 3300048923 Bacteria 2876
206 Ga0496121_0022872 3300048924 Bacteria 6041
207 Ga0496121_0121058 3300048924 Bacteria 1977
208 Ga0496121_0271168 3300048924 Bacteria 1166
209 Ga0496121_0789499 3300048924 Bacteria 559
210 Ga0496125_0000202 3300048928 Bacteria 125963
211 Ga0501031_0075516 3300049568 Bacteria 2194
212 Ga0501031_0187020 3300049568 Bacteria 1353
213 Ga0501031_0487478 3300049568 Bacteria 795
214 Ga0501032_0210872 3300049569 Bacteria 1266
215 Ga0501033_0184327 3300049570 Bacteria 1495
216 Ga0501034_0020072 3300049571 Bacteria 6823
217 Ga0501034_0533037 3300049571 Bacteria 1085
218 Ga0501036_0106897 3300049572 Bacteria 2366
219 Ga0501037_0015012 3300049573 Bacteria 5697
220 Ga0501037_0057002 3300049573 Bacteria 2853
221 Ga0501037_0349662 3300049573 Bacteria 1020
222 Ga0501038_0184269 3300049574 Bacteria 1683
223 Ga0501046_0068254 3300049580 Bacteria 2768
224 Ga0501047_0065419 3300049581 Bacteria 3505
225 Ga0501047_0089278 3300049581 Bacteria 2959
226 Ga0501047_0101665 3300049581 Bacteria 2754
227 Ga0501048_0197685 3300049582 Bacteria 1425
228 Ga0501070_0356157 3300049586 Bacteria 1187
229 Ga0501073_0001734 3300049589 Bacteria 16199
230 Ga0501073_0329822 3300049589 Bacteria 1053
231 Ga0501074_0167467 3300049590 Bacteria 1569
232 Ga0501079_0449813 3300049741 Bacteria 1012
233 Ga0501080_0348592 3300049742 Bacteria 1337
234 Ga0501035_0000253 3300049822 Bacteria 64326
235 Ga0501035_0039270 3300049822 Bacteria 4284
236 Ga0501044_0008484 3300049823 Bacteria 11264
237 Ga0501044_0095509 3300049823 Bacteria 2995
238 Ga0501044_0284737 3300049823 Bacteria 1585
239 nmdc:mga03n38_123068_c1 3300050490 Bacteria 1277
240 nmdc:mga00v17_183144_c1 3300050491 Bacteria 1352
241 nmdc:mga0yw44_106788_c1 3300050492 Bacteria 1790
242 nmdc:mga0yw44_155040_c1 3300050492 Bacteria 1496
243 nmdc:mga0yw44_84879_c1 3300050492 Bacteria 1991
244 nmdc:mga06z11_75308_c1 3300050494 Bacteria 1797
245 nmdc:mga04h51_35085_c1 3300050495 Bacteria 1606
246 nmdc:mga0n895_322572_c1 3300050512 Bacteria 1565
247 nmdc:mga0rr50_22215_c1 3300050513 Bacteria 4350
248 nmdc:mga0sz30_20171_c1 3300050516 Bacteria 2687
249 Ga0495601_0010586 3300053077 Bacteria 5494
250 Ga0495601_0029936 3300053077 Bacteria 3380
251 Ga0495601_0176685 3300053077 Bacteria 1396
252 Ga0495595_0017142 3300053084 Bacteria 3113
253 Ga0495619_0137275 3300053085 Bacteria 1682
254 Ga0500655_015244 3300053133 Bacteria 1410
255 Ga0500568_0141163 3300053139 Bacteria 893
256 Ga0500604_0104499 3300053151 Bacteria 936
257 Ga0500616_0062957 3300053153 Bacteria 1914
258 Ga0500627_0131279 3300053158 Bacteria 1131
259 Ga0500627_0156599 3300053158 Bacteria 1028
260 Ga0500627_0276104 3300053158 Bacteria 738
261 2599103897 2597490356 Bacteria 7030811
262 2846957586 2846952575 Bacteria 6587527
263 2848863723 2848858292 Bacteria 7391279
264 3005596342 3005594810 Bacteria 8716512
265 Ga0068867_101020322
266 Ga0070658_10017311
267 Ga0070680_100007320
268 Ga0070680_100369329
269 Ga0070682_100004505
270 Ga0068868_100011013
271 Ga0070660_100005914
272 Ga0070660_100027874
273 Ga0070687_100330045
274 Ga0070667_100122144
275 Ga0070709_10008444
276 Ga0070701_10459673
277 Ga0070705_100000508
278 Ga0070705_100031630
279 Ga0070700_100005087
280 Ga0070700_100609767
281 Ga0070694_100000753
282 Ga0070708_100074607
283 Ga0070663_100008773
284 Ga0070663_100053515
285 Ga0070663_100077494
286 Ga0070663_100430269
287 Ga0070678_100028139
288 Ga0070678_100379139
289 Ga0070681_10007769
290 Ga0070681_10025334
291 Ga0070698_100284372
292 Ga0070698_100933349
293 Ga0070699_100011482
294 Ga0070679_100012308
295 Ga0070679_100223383
296 Ga0070684_100650483
297 Ga0068853_100008671
298 Ga0070695_100003660
299 Ga0070695_100121988
300 Ga0070696_100003133
301 Ga0070693_100002640
302 Ga0068855_100017082
303 Ga0068855_100019429
304 Ga0070664_100130605
305 Ga0068857_100001810
306 Ga0068852_100160784
307 Ga0068859_100027528
308 Ga0068861_100075272
309 Ga0068861_100258447
310 Ga0068851_10085315
311 Ga0068870_10660155
312 Ga0068863_100363116
313 Ga0068858_100085906
314 Ga0068860_100017625
315 Ga0068860_100026168
316 Ga0068862_100001864
317 Ga0081540_1030396
318 Ga0075365_10104887
319 Ga0075363_100186826
320 Ga0075364_10099330
321 Ga0075367_10001252
322 Ga0097621_100827186
323 Ga0075434_100238665
324 Ga0097620_100027528
325 Ga0105240_10146332
326 Ga0105243_10042691
327 Ga0105241_10016308
328 Ga0105242_11734679
329 Ga0105237_10016176
330 Ga0105238_10042741
331 Ga0105238_10113903
332 Ga0105249_10003884
333 Ga0105239_10289433
334 Ga0105246_10057295
335 Ga0105246_10077140
336 Ga0157369_10478187
337 Ga0157374_11125029
338 Ga0157378_10086585
339 Ga0163162_10797660
340 Ga0163162_11350583
341 Ga0157375_10090107
342 Ga0157379_10093705
343 Ga0157376_10581197
344 Ga0207427_110494
345 Ga0209233_1000626
346 Ga0207656_10071260
347 Ga0207647_10011318
348 Ga0207643_10381364
349 Ga0207705_10012861
350 Ga0207705_10133432
351 Ga0207707_10019301
352 Ga0207707_10049909
353 Ga0207660_10012363
354 Ga0207660_10179660
355 Ga0207657_10000774
356 Ga0207657_10059618
357 Ga0207652_10011409
358 Ga0207694_10032490
359 Ga0207694_10069830
360 Ga0207706_10173688
361 Ga0207669_10427556
362 Ga0207689_10214924
363 Ga0207689_10390675
364 Ga0207679_10098027
365 Ga0207667_10019956
366 Ga0207667_10143992
367 Ga0207712_10000633
368 Ga0207668_10163759
369 Ga0207658_10286055
370 Ga0207639_10008463
371 Ga0207678_10000157
372 Ga0207678_10313886
373 Ga0207708_10007214
374 Ga0207708_10762686
375 Ga0207648_10977610
376 Ga0207674_10002863
377 Ga0207675_100105641
378 Ga0207683_10228735
379 Ga0207683_10379488
380 Ga0207698_10138117
381 Ga0268265_10031339
382 Ga0268264_10026308
383 Ga0268264_10060551
384 Ga0265318_10001925
385 Ga0307515_10001155
386 Ga0265325_10121406
387 Ga0265340_10003636
388 Ga0265340_10169259
389 Ga0265339_10001899
390 Ga0265339_10023003
391 Ga0265339_10026297
392 Ga0265331_10032408
393 Ga0265316_10020872
394 Ga0265316_10056628
395 Ga0265316_10321812
396 Ga0265313_10008134
397 Ga0265313_10016451
398 Ga0265313_10018753
399 Ga0265313_10080347
400 Ga0265314_10001283
401 Ga0265314_10003416
402 Ga0265314_10021554
403 Ga0265314_10158914
404 Ga0265314_10267226
405 Ga0265342_10011482
406 Ga0265342_10096256
407 Ga0307412_10164579
408 Ga0373934_0073740
409 Ga0373955_0015590
410 Ga0373933_0012072
411 Ga0373947_0079083
412 Ga0373937_0043274
413 Ga0373937_0278005
414 Ga0373925_0789962
415 Ga0436365_0531713
416 Ga0451833_1353746
417 Ga0451841_0571377
418 Ga0451849_0981115
419 Ga0466972_0090827
420 Ga0466965_0059196
421 Ga0466960_0035770
422 Ga0495603_0013229
423 Ga0495603_0049297
424 Ga0495629_0126785
425 Ga0495638_0006297
426 Ga0495639_0060844
427 Ga0495584_0081224
428 Ga0495594_0218790
429 Ga0495608_0074703
430 Ga0495632_0316714
431 Ga0495666_0159590
432 Ga0495622_0005820
433 Ga0495622_0028665
434 Ga0495622_0121427
435 Ga0495659_0197858
436 Ga0495657_0506675
437 Ga0495670_0486292
438 Ga0495680_0360538
439 Ga0495680_0457587
440 Ga0495675_0033750
441 Ga0495593_0043358
442 Ga0495614_0061024
443 Ga0495626_0132002
444 Ga0496100_0064379
445 Ga0496100_0076694
446 Ga0496101_0007369
447 Ga0496101_0291817
448 Ga0496101_0442602
449 Ga0496102_0011091
450 Ga0496102_0014892
451 Ga0496102_0167820
452 Ga0496102_0739174
453 Ga0496103_0000898
454 Ga0496103_0015024
455 Ga0496104_0029561
456 Ga0496105_0067678
457 Ga0496105_0122419
458 Ga0496106_0006772
459 Ga0496106_0018107
460 Ga0496106_0624296
461 Ga0496107_0006344
462 Ga0496107_0040070
463 Ga0496109_0085189
464 Ga0496110_0460833
465 Ga0496112_0015605
466 Ga0496113_0143441
467 Ga0496115_0046336
468 Ga0496115_0081961
469 Ga0496120_0037500
470 Ga0496121_0022872
471 Ga0496121_0121058
472 Ga0496121_0271168
473 Ga0496121_0789499
474 Ga0496125_0000202
475 Ga0501031_0075516
476 Ga0501031_0187020
477 Ga0501031_0487478
478 Ga0501032_0210872
479 Ga0501033_0184327
480 Ga0501034_0020072
481 Ga0501034_0533037
482 Ga0501036_0106897
483 Ga0501037_0015012
484 Ga0501037_0057002
485 Ga0501037_0349662
486 Ga0501038_0184269
487 Ga0501046_0068254
488 Ga0501047_0065419
489 Ga0501047_0089278
490 Ga0501047_0101665
491 Ga0501048_0197685
492 Ga0501070_0356157
493 Ga0501073_0001734
494 Ga0501073_0329822
495 Ga0501074_0167467
496 Ga0501079_0449813
497 Ga0501080_0348592
498 Ga0501035_0000253
499 Ga0501035_0039270
500 Ga0501044_0008484
501 Ga0501044_0095509
502 Ga0501044_0284737
503 nmdc:mga03n38_123068_c1
504 nmdc:mga00v17_183144_c1
505 nmdc:mga0yw44_106788_c1
506 nmdc:mga0yw44_155040_c1
507 nmdc:mga0yw44_84879_c1
508 nmdc:mga06z11_75308_c1
509 nmdc:mga04h51_35085_c1
510 nmdc:mga0n895_322572_c1
511 nmdc:mga0rr50_22215_c1
512 nmdc:mga0sz30_20171_c1
513 Ga0495601_0010586
514 Ga0495601_0029936
515 Ga0495601_0176685
516 Ga0495595_0017142
517 Ga0495619_0137275
518 Ga0500655_015244
519 Ga0500568_0141163
520 Ga0500604_0104499
521 Ga0500616_0062957
522 Ga0500627_0131279
523 Ga0500627_0156599
524 Ga0500627_0276104
525 2599103897
526 2846957586
527 2848863723
528 3005596342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

5

198

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7338 6 186
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7255 5 185
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7088 6 186
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.6943 5 185
6t1t-assembly1.cif.gz_A cytochrome p450 reductase in complex with nadph from candida tropicalis 0.6725 132 158
ID Description Score Start End Superfamily
af_Q4DXT8_380_511_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.651 3 40 3.40.50.300
1hf0B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.5859 97 158 1.10.10.60
1kcyA00 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.4991 93 184 1.10.238.10
af_A0A0G2KYI1_1717_1836_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.4967 86 189 1.10.238.10
1gvfB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.495 89 157 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A8B3G858-F1-model_v4 deleted 0.9787 129 184
AF-A0A4Q6CGJ9-F1-model_v4 deleted 0.9583 129 184
AF-D5RTV0-F1-model_v4 Potassium-transporting ATPase subunit C 0.9503 140 185 GO:0005524
GO:0005886
GO:0008556
AF-A0A536ZNA7-F1-model_v4 Potassium-transporting ATPase subunit C 0.9483 110 184 GO:0005524
GO:0005886
GO:0008556
AF-Q8VTB5-F1-model_v4 FrrA 0.9482 126 187 GO:0005524
GO:0005886
GO:0008556

Map