F370944

General Info

Members Datasets Scaffolds Average Seq Length
262 135 524 98

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_101674881|Ga0070704_1016748812
Length 102
Sequence MVARLFQVECPCCQAKLKVDPETQAVIAHQPPPEKPRSVEDLNEAVVKLRGEEARRDQVFRDQFEAQKSHGKVLEKKFDELFKQAKDDPTAGKPRLRDIDLD

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
113 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
114 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.29
Rhizosphere 94.66
Stem 0
Stem Tuber 0
Unclassified 43.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_101674881 3300005549 Unclassified 587
2 Ga0070658_10540840 3300005327 Bacteria 1008
3 Ga0070676_11186834 3300005328 Unclassified 580
4 Ga0070683_100000049 3300005329 Bacteria 93310
5 Ga0070683_100024735 3300005329 Bacteria 5383
6 Ga0070690_100466275 3300005330 Bacteria 939
7 Ga0070670_100909830 3300005331 Bacteria 798
8 Ga0070666_10246988 3300005335 Bacteria 1263
9 Ga0070666_10708006 3300005335 Unclassified 739
10 Ga0070680_100151343 3300005336 Bacteria 1948
11 Ga0070682_100772732 3300005337 Unclassified 778
12 Ga0068868_101627474 3300005338 Unclassified 607
13 Ga0070687_100638930 3300005343 Unclassified 736
14 Ga0070661_100851969 3300005344 Unclassified 750
15 Ga0070669_101657975 3300005353 Unclassified 557
16 Ga0070675_100410157 3300005354 Bacteria 1210
17 Ga0070674_100707325 3300005356 Bacteria 862
18 Ga0070673_100320345 3300005364 Bacteria 1369
19 Ga0070688_100149156 3300005365 Unclassified 1597
20 Ga0070659_100306636 3300005366 Bacteria 1325
21 Ga0070667_102289194 3300005367 Unclassified 509
22 Ga0070714_100409437 3300005435 Bacteria 1283
23 Ga0070714_100757652 3300005435 Bacteria 939
24 Ga0070713_100406026 3300005436 Bacteria 1273
25 Ga0070713_100439541 3300005436 Bacteria 1223
26 Ga0070713_101052610 3300005436 Unclassified 786
27 Ga0070713_101985692 3300005436 Unclassified 564
28 Ga0070678_100659868 3300005456 Bacteria 939
29 Ga0070685_10265030 3300005466 Bacteria 1144
30 Ga0070706_100320265 3300005467 Bacteria 1446
31 Ga0070706_100738997 3300005467 Unclassified 912
32 Ga0070684_100000040 3300005535 Bacteria 93306
33 Ga0070684_100036356 3300005535 Bacteria 4220
34 Ga0070684_100149645 3300005535 Bacteria 2114
35 Ga0070684_100503881 3300005535 Bacteria 1121
36 Ga0070684_102097752 3300005535 Unclassified 533
37 Ga0070672_102090927 3300005543 Bacteria 510
38 Ga0070665_101454707 3300005548 Bacteria 694
39 Ga0068855_100097162 3300005563 Bacteria 3393
40 Ga0068855_100192849 3300005563 Unclassified 2297
41 Ga0068855_100265664 3300005563 Bacteria 1910
42 Ga0068855_102217653 3300005563 Unclassified 551
43 Ga0068857_100651161 3300005577 Bacteria 998
44 Ga0070702_100866840 3300005615 Bacteria 704
45 Ga0068852_100047237 3300005616 Unclassified 3672
46 Ga0068859_101051042 3300005617 Unclassified 895
47 Ga0068864_100544115 3300005618 Unclassified 1121
48 Ga0068863_100457304 3300005841 Unclassified 1253
49 Ga0068863_101871463 3300005841 Bacteria 610
50 Ga0068858_102139384 3300005842 Unclassified 553
51 Ga0068860_100621016 3300005843 Bacteria 1087
52 Ga0070717_10005114 3300006028 Bacteria 9569
53 Ga0070717_10014047 3300006028 Bacteria 6155
54 Ga0070717_11296720 3300006028 Unclassified 662
55 Ga0070715_11023333 3300006163 Unclassified 516
56 Ga0097621_100116010 3300006237 Unclassified 2267
57 Ga0097621_100209111 3300006237 Bacteria 1697
58 Ga0097621_100228237 3300006237 Bacteria 1625
59 Ga0097621_101444007 3300006237 Unclassified 652
60 Ga0068871_100262085 3300006358 Unclassified 1508
61 Ga0068871_100276842 3300006358 Bacteria 1467
62 Ga0068871_100667919 3300006358 Bacteria 950
63 Ga0075428_101512836 3300006844 Unclassified 703
64 Ga0075431_100475872 3300006847 Bacteria 1242
65 Ga0068865_100121670 3300006881 Bacteria 1942
66 Ga0068865_101868275 3300006881 Unclassified 543
67 Ga0097620_101051292 3300006931 Unclassified 895
68 Ga0105240_10006278 3300009093 Bacteria 17483
69 Ga0105240_10111456 3300009093 Bacteria 3310
70 Ga0105240_10271392 3300009093 Bacteria 1953
71 Ga0105240_10817697 3300009093 Bacteria 1008
72 Ga0111539_10468557 3300009094 Bacteria 1467
73 Ga0105245_10495496 3300009098 Bacteria 1237
74 Ga0105245_10498454 3300009098 Unclassified 1234
75 Ga0105245_10682786 3300009098 Bacteria 1059
76 Ga0105245_11198992 3300009098 Unclassified 807
77 Ga0105245_13041131 3300009098 Unclassified 520
78 Ga0105247_10142922 3300009101 Bacteria 1570
79 Ga0114129_10252421 3300009147 Bacteria 2367
80 Ga0114129_10741960 3300009147 Bacteria 1258
81 Ga0114129_11239697 3300009147 Bacteria 927
82 Ga0105242_11596921 3300009176 Unclassified 686
83 Ga0105248_10021809 3300009177 Bacteria 7097
84 Ga0105248_10674073 3300009177 Bacteria 1167
85 Ga0105248_10724773 3300009177 Bacteria 1122
86 Ga0105248_10871281 3300009177 Unclassified 1017
87 Ga0105248_10872591 3300009177 Bacteria 1016
88 Ga0105248_10952295 3300009177 Bacteria 970
89 Ga0105248_11277820 3300009177 Unclassified 830
90 Ga0105248_11306712 3300009177 Unclassified 820
91 Ga0105248_12156081 3300009177 Bacteria 634
92 Ga0105248_13398614 3300009177 Unclassified 506
93 Ga0105237_10001245 3300009545 Bacteria 33974
94 Ga0105237_10650075 3300009545 Unclassified 1061
95 Ga0105237_10987827 3300009545 Unclassified 849
96 Ga0105237_11544855 3300009545 Unclassified 671
97 Ga0105237_11597059 3300009545 Unclassified 659
98 Ga0105237_12367926 3300009545 Bacteria 541
99 Ga0105238_11801482 3300009551 Bacteria 644
100 Ga0105239_10120967 3300010375 Bacteria 2907
101 Ga0105239_10600030 3300010375 Bacteria 1256
102 Ga0105239_11737852 3300010375 Unclassified 722
103 Ga0105239_11757311 3300010375 Unclassified 718
104 Ga0105239_12591156 3300010375 Unclassified 591
105 Ga0105246_10440295 3300011119 Bacteria 1093
106 Ga0157370_10246602 3300013104 Bacteria 1652
107 Ga0157370_10480921 3300013104 Bacteria 1141
108 Ga0157369_10127000 3300013105 Archaea 2703
109 Ga0157374_10692960 3300013296 Bacteria 1032
110 Ga0157374_12791088 3300013296 Unclassified 516
111 Ga0157378_10498799 3300013297 Bacteria 1216
112 Ga0157378_10549533 3300013297 Unclassified 1160
113 Ga0157378_10961264 3300013297 Bacteria 887
114 Ga0157378_11262770 3300013297 Unclassified 779
115 Ga0157378_12219728 3300013297 Unclassified 600
116 Ga0157378_12666809 3300013297 Unclassified 552
117 Ga0163162_10566963 3300013306 Bacteria 1263
118 Ga0163162_10834399 3300013306 Bacteria 1038
119 Ga0163162_11256558 3300013306 Unclassified 841
120 Ga0157372_10947577 3300013307 Unclassified 998
121 Ga0157372_11800633 3300013307 Unclassified 704
122 Ga0157375_10582669 3300013308 Bacteria 1279
123 Ga0157375_10779372 3300013308 Bacteria 1106
124 Ga0157375_11646734 3300013308 Unclassified 759
125 Ga0157375_12241800 3300013308 Unclassified 651
126 Ga0157375_12242538 3300013308 Bacteria 651
127 Ga0163163_10013625 3300014325 Bacteria 7445
128 Ga0163163_10073010 3300014325 Bacteria 3421
129 Ga0163163_10906001 3300014325 Bacteria 945
130 Ga0163163_11425072 3300014325 Bacteria 754
131 Ga0157379_10536793 3300014968 Bacteria 1087
132 Ga0157376_10026029 3300014969 Bacteria 4617
133 Ga0157376_10173576 3300014969 Bacteria 1965
134 Ga0157376_10207625 3300014969 Bacteria 1806
135 Ga0157376_10689066 3300014969 Bacteria 1026
136 Ga0157376_10800221 3300014969 Bacteria 955
137 Ga0157376_10802662 3300014969 Unclassified 954
138 Ga0157376_12286598 3300014969 Unclassified 580
139 Ga0163161_10157106 3300017792 Bacteria 1732
140 Ga0163161_10976409 3300017792 Unclassified 722
141 Ga0213876_10098947 3300021384 Bacteria 1546
142 Ga0213876_10769506 3300021384 Unclassified 512
143 Ga0213875_10094595 3300021388 Bacteria 1393
144 Ga0213875_10677645 3300021388 Unclassified 500
145 Ga0207645_10373225 3300025907 Unclassified 956
146 Ga0207684_10936388 3300025910 Unclassified 727
147 Ga0207695_10000956 3300025913 Bacteria 51440
148 Ga0207695_10184617 3300025913 Bacteria 2005
149 Ga0207695_10718845 3300025913 Bacteria 879
150 Ga0207671_10477526 3300025914 Bacteria 994
151 Ga0207671_11273101 3300025914 Unclassified 573
152 Ga0207671_11581938 3300025914 Unclassified 504
153 Ga0207681_11402001 3300025923 Unclassified 586
154 Ga0207694_10446960 3300025924 Bacteria 1079
155 Ga0207650_11042422 3300025925 Unclassified 696
156 Ga0207659_10706218 3300025926 Bacteria 863
157 Ga0207700_10354686 3300025928 Bacteria 1278
158 Ga0207700_11127064 3300025928 Unclassified 701
159 Ga0207664_10979852 3300025929 Unclassified 758
160 Ga0207644_10019710 3300025931 Bacteria 4580
161 Ga0207644_11162567 3300025931 Unclassified 649
162 Ga0207690_10336404 3300025932 Unclassified 1190
163 Ga0207669_10440387 3300025937 Bacteria 1030
164 Ga0207704_10835697 3300025938 Bacteria 771
165 Ga0207691_10483818 3300025940 Unclassified 1052
166 Ga0207711_10660770 3300025941 Unclassified 975
167 Ga0207711_10671121 3300025941 Bacteria 967
168 Ga0207711_10747483 3300025941 Unclassified 912
169 Ga0207711_11731201 3300025941 Unclassified 568
170 Ga0207661_10000050 3300025944 Bacteria 93646
171 Ga0207661_10020285 3300025944 Bacteria 4965
172 Ga0207667_10356604 3300025949 Bacteria 1491
173 Ga0207658_10448254 3300025986 Unclassified 1142
174 Ga0207677_11059810 3300026023 Unclassified 737
175 Ga0207703_11399385 3300026035 Unclassified 673
176 Ga0207702_11054177 3300026078 Unclassified 807
177 Ga0207641_11133954 3300026088 Unclassified 781
178 Ga0207641_12040182 3300026088 Unclassified 575
179 Ga0207674_10865208 3300026116 Bacteria 871
180 Ga0207675_100912818 3300026118 Unclassified 895
181 Ga0207675_101500468 3300026118 Bacteria 695
182 Ga0207683_10410992 3300026121 Bacteria 1246
183 Ga0207683_10748463 3300026121 Unclassified 907
184 Ga0268266_10676807 3300028379 Bacteria 994
185 Ga0265323_10002411 3300028653 Bacteria 8593
186 Ga0265330_10331776 3300031235 Bacteria 642
187 Ga0265325_10091449 3300031241 Bacteria 1500
188 Ga0265325_10243724 3300031241 Unclassified 816
189 Ga0265331_10005309 3300031250 Bacteria 7798
190 Ga0265316_10015109 3300031344 Bacteria 6764
191 Ga0265316_10017781 3300031344 Bacteria 6129
192 Ga0265316_10045423 3300031344 Bacteria 3487
193 Ga0265316_10145800 3300031344 Bacteria 1775
194 Ga0265316_10532673 3300031344 Bacteria 837
195 Ga0265316_10783682 3300031344 Bacteria 669
196 Ga0265316_10848085 3300031344 Bacteria 639
197 Ga0265316_11124558 3300031344 Bacteria 544
198 Ga0265342_10184511 3300031712 Bacteria 1141
199 Ga0265342_10417848 3300031712 Unclassified 691
200 Ga0265342_10639214 3300031712 Unclassified 535
201 Ga0373953_0069516 3300035117 Bacteria 1451
202 Ga0373954_0148542 3300035118 Bacteria 1145
203 Ga0373954_0392309 3300035118 Unclassified 686
204 Ga0373943_0128999 3300035170 Bacteria 1352
205 Ga0373927_0001114 3300035695 Bacteria 20394
206 Ga0373933_0717963 3300035724 Unclassified 657
207 Ga0373947_0006237 3300035725 Bacteria 6931
208 Ga0373947_0407427 3300035725 Bacteria 918
209 Ga0373937_0795834 3300036401 Unclassified 893
210 Ga0373937_0979745 3300036401 Unclassified 794
211 Ga0373937_1182858 3300036401 Unclassified 713
212 Ga0373937_1284876 3300036401 Unclassified 680
213 Ga0373925_0000927 3300037068 Bacteria 26693
214 Ga0373925_0360401 3300037068 Bacteria 1182
215 Ga0373925_0489648 3300037068 Bacteria 1009
216 Ga0373925_0576539 3300037068 Bacteria 926
217 Ga0373925_0783701 3300037068 Unclassified 786
218 Ga0373925_0999354 3300037068 Unclassified 689
219 Ga0436364_0693857 3300037853 Bacteria 7192
220 Ga0436365_0418046 3300039437 Bacteria 7053
221 Ga0436365_1169161 3300039437 Unclassified 1518
222 Ga0451839_0014203 3300041496 Unclassified 740
223 Ga0451577_1061426 3300042876 Bacteria 726
224 Ga0451577_1262983 3300042876 Unclassified 658
225 Ga0453683_0938223 3300044673 Unclassified 573
226 Ga0451576_1013458 3300045051 Unclassified 870
227 Ga0451576_1014227 3300045051 Unclassified 870
228 Ga0451576_1332785 3300045051 Unclassified 748
229 Ga0495651_0210458 3300046462 Unclassified 1354
230 Ga0495580_0001260 3300046472 Bacteria 22339
231 Ga0495580_0016454 3300046472 Bacteria 5549
232 Ga0495580_0169408 3300046472 Bacteria 1510
233 Ga0495580_0710605 3300046472 Unclassified 657
234 Ga0495662_0270845 3300046476 Bacteria 836
235 Ga0495664_0121625 3300046477 Unclassified 1579
236 Ga0495628_0552219 3300046516 Bacteria 827
237 Ga0495630_0840918 3300046517 Unclassified 700
238 Ga0495666_0054483 3300046526 Unclassified 1918
239 Ga0495652_0325312 3300046529 Unclassified 1109
240 Ga0495645_0001245 3300046543 Bacteria 17375
241 Ga0495645_0366969 3300046543 Unclassified 924
242 Ga0495599_0800803 3300046678 Unclassified 538
243 Ga0495599_0849268 3300046678 Unclassified 519
244 Ga0495669_0139041 3300046684 Unclassified 1146
245 Ga0495624_0024937 3300046690 Bacteria 3934
246 Ga0495636_0675308 3300047318 Bacteria 509
247 Ga0495674_0016516 3300047319 Bacteria 6887
248 Ga0495674_0583715 3300047319 Bacteria 887
249 Ga0495674_0777295 3300047319 Unclassified 746
250 Ga0495684_0112196 3300047471 Bacteria 2056
251 Ga0495684_0188528 3300047471 Bacteria 1526
252 Ga0495684_0527106 3300047471 Unclassified 808
253 Ga0495684_0865518 3300047471 Bacteria 585
254 Ga0495602_0840947 3300048088 Unclassified 614
255 Ga0495614_0570866 3300048089 Bacteria 542
256 Ga0496112_0431689 3300048915 Bacteria 1256
257 Ga0496112_0969187 3300048915 Unclassified 771
258 Ga0496112_1127887 3300048915 Unclassified 702
259 Ga0496112_1773887 3300048915 Unclassified 529
260 Ga0496115_0102217 3300048918 Bacteria 2351
261 Ga0496115_0394921 3300048918 Bacteria 1123
262 nmdc:mga05p37_154483_c1 3300050507 Bacteria 2805
263 Ga0070704_101674881
264 Ga0070658_10540840
265 Ga0070676_11186834
266 Ga0070683_100000049
267 Ga0070683_100024735
268 Ga0070690_100466275
269 Ga0070670_100909830
270 Ga0070666_10246988
271 Ga0070666_10708006
272 Ga0070680_100151343
273 Ga0070682_100772732
274 Ga0068868_101627474
275 Ga0070687_100638930
276 Ga0070661_100851969
277 Ga0070669_101657975
278 Ga0070675_100410157
279 Ga0070674_100707325
280 Ga0070673_100320345
281 Ga0070688_100149156
282 Ga0070659_100306636
283 Ga0070667_102289194
284 Ga0070714_100409437
285 Ga0070714_100757652
286 Ga0070713_100406026
287 Ga0070713_100439541
288 Ga0070713_101052610
289 Ga0070713_101985692
290 Ga0070678_100659868
291 Ga0070685_10265030
292 Ga0070706_100320265
293 Ga0070706_100738997
294 Ga0070684_100000040
295 Ga0070684_100036356
296 Ga0070684_100149645
297 Ga0070684_100503881
298 Ga0070684_102097752
299 Ga0070672_102090927
300 Ga0070665_101454707
301 Ga0068855_100097162
302 Ga0068855_100192849
303 Ga0068855_100265664
304 Ga0068855_102217653
305 Ga0068857_100651161
306 Ga0070702_100866840
307 Ga0068852_100047237
308 Ga0068859_101051042
309 Ga0068864_100544115
310 Ga0068863_100457304
311 Ga0068863_101871463
312 Ga0068858_102139384
313 Ga0068860_100621016
314 Ga0070717_10005114
315 Ga0070717_10014047
316 Ga0070717_11296720
317 Ga0070715_11023333
318 Ga0097621_100116010
319 Ga0097621_100209111
320 Ga0097621_100228237
321 Ga0097621_101444007
322 Ga0068871_100262085
323 Ga0068871_100276842
324 Ga0068871_100667919
325 Ga0075428_101512836
326 Ga0075431_100475872
327 Ga0068865_100121670
328 Ga0068865_101868275
329 Ga0097620_101051292
330 Ga0105240_10006278
331 Ga0105240_10111456
332 Ga0105240_10271392
333 Ga0105240_10817697
334 Ga0111539_10468557
335 Ga0105245_10495496
336 Ga0105245_10498454
337 Ga0105245_10682786
338 Ga0105245_11198992
339 Ga0105245_13041131
340 Ga0105247_10142922
341 Ga0114129_10252421
342 Ga0114129_10741960
343 Ga0114129_11239697
344 Ga0105242_11596921
345 Ga0105248_10021809
346 Ga0105248_10674073
347 Ga0105248_10724773
348 Ga0105248_10871281
349 Ga0105248_10872591
350 Ga0105248_10952295
351 Ga0105248_11277820
352 Ga0105248_11306712
353 Ga0105248_12156081
354 Ga0105248_13398614
355 Ga0105237_10001245
356 Ga0105237_10650075
357 Ga0105237_10987827
358 Ga0105237_11544855
359 Ga0105237_11597059
360 Ga0105237_12367926
361 Ga0105238_11801482
362 Ga0105239_10120967
363 Ga0105239_10600030
364 Ga0105239_11737852
365 Ga0105239_11757311
366 Ga0105239_12591156
367 Ga0105246_10440295
368 Ga0157370_10246602
369 Ga0157370_10480921
370 Ga0157369_10127000
371 Ga0157374_10692960
372 Ga0157374_12791088
373 Ga0157378_10498799
374 Ga0157378_10549533
375 Ga0157378_10961264
376 Ga0157378_11262770
377 Ga0157378_12219728
378 Ga0157378_12666809
379 Ga0163162_10566963
380 Ga0163162_10834399
381 Ga0163162_11256558
382 Ga0157372_10947577
383 Ga0157372_11800633
384 Ga0157375_10582669
385 Ga0157375_10779372
386 Ga0157375_11646734
387 Ga0157375_12241800
388 Ga0157375_12242538
389 Ga0163163_10013625
390 Ga0163163_10073010
391 Ga0163163_10906001
392 Ga0163163_11425072
393 Ga0157379_10536793
394 Ga0157376_10026029
395 Ga0157376_10173576
396 Ga0157376_10207625
397 Ga0157376_10689066
398 Ga0157376_10800221
399 Ga0157376_10802662
400 Ga0157376_12286598
401 Ga0163161_10157106
402 Ga0163161_10976409
403 Ga0213876_10098947
404 Ga0213876_10769506
405 Ga0213875_10094595
406 Ga0213875_10677645
407 Ga0207645_10373225
408 Ga0207684_10936388
409 Ga0207695_10000956
410 Ga0207695_10184617
411 Ga0207695_10718845
412 Ga0207671_10477526
413 Ga0207671_11273101
414 Ga0207671_11581938
415 Ga0207681_11402001
416 Ga0207694_10446960
417 Ga0207650_11042422
418 Ga0207659_10706218
419 Ga0207700_10354686
420 Ga0207700_11127064
421 Ga0207664_10979852
422 Ga0207644_10019710
423 Ga0207644_11162567
424 Ga0207690_10336404
425 Ga0207669_10440387
426 Ga0207704_10835697
427 Ga0207691_10483818
428 Ga0207711_10660770
429 Ga0207711_10671121
430 Ga0207711_10747483
431 Ga0207711_11731201
432 Ga0207661_10000050
433 Ga0207661_10020285
434 Ga0207667_10356604
435 Ga0207658_10448254
436 Ga0207677_11059810
437 Ga0207703_11399385
438 Ga0207702_11054177
439 Ga0207641_11133954
440 Ga0207641_12040182
441 Ga0207674_10865208
442 Ga0207675_100912818
443 Ga0207675_101500468
444 Ga0207683_10410992
445 Ga0207683_10748463
446 Ga0268266_10676807
447 Ga0265323_10002411
448 Ga0265330_10331776
449 Ga0265325_10091449
450 Ga0265325_10243724
451 Ga0265331_10005309
452 Ga0265316_10015109
453 Ga0265316_10017781
454 Ga0265316_10045423
455 Ga0265316_10145800
456 Ga0265316_10532673
457 Ga0265316_10783682
458 Ga0265316_10848085
459 Ga0265316_11124558
460 Ga0265342_10184511
461 Ga0265342_10417848
462 Ga0265342_10639214
463 Ga0373953_0069516
464 Ga0373954_0148542
465 Ga0373954_0392309
466 Ga0373943_0128999
467 Ga0373927_0001114
468 Ga0373933_0717963
469 Ga0373947_0006237
470 Ga0373947_0407427
471 Ga0373937_0795834
472 Ga0373937_0979745
473 Ga0373937_1182858
474 Ga0373937_1284876
475 Ga0373925_0000927
476 Ga0373925_0360401
477 Ga0373925_0489648
478 Ga0373925_0576539
479 Ga0373925_0783701
480 Ga0373925_0999354
481 Ga0436364_0693857
482 Ga0436365_0418046
483 Ga0436365_1169161
484 Ga0451839_0014203
485 Ga0451577_1061426
486 Ga0451577_1262983
487 Ga0453683_0938223
488 Ga0451576_1013458
489 Ga0451576_1014227
490 Ga0451576_1332785
491 Ga0495651_0210458
492 Ga0495580_0001260
493 Ga0495580_0016454
494 Ga0495580_0169408
495 Ga0495580_0710605
496 Ga0495662_0270845
497 Ga0495664_0121625
498 Ga0495628_0552219
499 Ga0495630_0840918
500 Ga0495666_0054483
501 Ga0495652_0325312
502 Ga0495645_0001245
503 Ga0495645_0366969
504 Ga0495599_0800803
505 Ga0495599_0849268
506 Ga0495669_0139041
507 Ga0495624_0024937
508 Ga0495636_0675308
509 Ga0495674_0016516
510 Ga0495674_0583715
511 Ga0495674_0777295
512 Ga0495684_0112196
513 Ga0495684_0188528
514 Ga0495684_0527106
515 Ga0495684_0865518
516 Ga0495602_0840947
517 Ga0495614_0570866
518 Ga0496112_0431689
519 Ga0496112_0969187
520 Ga0496112_1127887
521 Ga0496112_1773887
522 Ga0496115_0102217
523 Ga0496115_0394921
524 nmdc:mga05p37_154483_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map