F370866

General Info

Members Datasets Scaffolds Average Seq Length
262 138 262 154

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100784084|Ga0070671_1007840841
Length 178
Sequence MPTRSPEPTPIMPRARSPKPEASPSESPYIAALKMLGRRELSERQVRERLARKGHDEGAIDDAVRRLKEERAIDDSRVAEAIARTETAVKRRGKLRVRRQMETAGIAPDVARTALDNVFEQVDDEALLQAALSRRLRGNRTIQDDREFQRLYRYLTAQGFDSDRILKALKARRRAADE

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
121 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
129 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.91
Rhizosphere 98.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10000157 3300005290 Bacteria 58547
2 Ga0065715_10111658 3300005293 Bacteria 2555
3 Ga0070683_100802583 3300005329 Unclassified 902
4 Ga0070690_100058317 3300005330 Bacteria 2479
5 Ga0070690_100255100 3300005330 Bacteria 1242
6 Ga0070670_100077434 3300005331 Bacteria 2857
7 Ga0070670_100391840 3300005331 Bacteria 1225
8 Ga0070670_101231480 3300005331 Bacteria 684
9 Ga0070666_10013124 3300005335 Bacteria 5249
10 Ga0070666_10953297 3300005335 Bacteria 635
11 Ga0070680_100131647 3300005336 Bacteria 2093
12 Ga0070680_100695505 3300005336 Bacteria 875
13 Ga0070682_100345089 3300005337 Bacteria 1108
14 Ga0070660_100092881 3300005339 Bacteria 2382
15 Ga0070689_100236614 3300005340 Bacteria 1503
16 Ga0070689_100453312 3300005340 Bacteria 1092
17 Ga0070661_100288549 3300005344 Bacteria 1274
18 Ga0070692_10993864 3300005345 Unclassified 586
19 Ga0070669_100022379 3300005353 Bacteria 4518
20 Ga0070675_100045584 3300005354 Bacteria 3588
21 Ga0070671_100025551 3300005355 Bacteria 4847
22 Ga0070671_100784084 3300005355 Bacteria 829
23 Ga0070673_100994094 3300005364 Bacteria 781
24 Ga0070673_101684194 3300005364 Bacteria 600
25 Ga0070688_100016310 3300005365 Bacteria 4245
26 Ga0070688_100021440 3300005365 Bacteria 3774
27 Ga0070688_100064493 3300005365 Bacteria 2325
28 Ga0070688_100876425 3300005365 Bacteria 707
29 Ga0070659_100164293 3300005366 Bacteria 1816
30 Ga0070659_101169167 3300005366 Bacteria 680
31 Ga0070667_100005508 3300005367 Bacteria 10573
32 Ga0070710_10424505 3300005437 Bacteria 896
33 Ga0070711_100225470 3300005439 Bacteria 1459
34 Ga0070705_100477288 3300005440 Bacteria 941
35 Ga0070700_100316328 3300005441 Bacteria 1145
36 Ga0070700_100575140 3300005441 Bacteria 879
37 Ga0070694_100005411 3300005444 Bacteria 7727
38 Ga0070708_100217492 3300005445 Bacteria 1791
39 Ga0070678_100696519 3300005456 Unclassified 915
40 Ga0070662_100197038 3300005457 Bacteria 1596
41 Ga0070681_10004275 3300005458 Bacteria 13557
42 Ga0070681_10030357 3300005458 Bacteria 5424
43 Ga0070685_10027354 3300005466 Bacteria 3151
44 Ga0070707_100061870 3300005468 Bacteria 3591
45 Ga0070707_100344379 3300005468 Bacteria 1448
46 Ga0070707_101557254 3300005468 Bacteria 628
47 Ga0070698_100042498 3300005471 Bacteria 4663
48 Ga0070699_100093305 3300005518 Bacteria 2634
49 Ga0070699_100182165 3300005518 Bacteria 1864
50 Ga0070699_101078487 3300005518 Unclassified 737
51 Ga0070679_100083418 3300005530 Bacteria 3184
52 Ga0070684_100340321 3300005535 Bacteria 1379
53 Ga0070697_100071860 3300005536 Bacteria 2839
54 Ga0070672_100068894 3300005543 Bacteria 2807
55 Ga0070686_100041289 3300005544 Bacteria 2883
56 Ga0070695_100003611 3300005545 Bacteria 9029
57 Ga0070695_100506760 3300005545 Bacteria 934
58 Ga0070695_100723722 3300005545 Bacteria 792
59 Ga0070696_100015830 3300005546 Bacteria 5070
60 Ga0070696_100048811 3300005546 Bacteria 2939
61 Ga0070696_100298079 3300005546 Bacteria 1234
62 Ga0070696_100785083 3300005546 Bacteria 783
63 Ga0070696_101318005 3300005546 Unclassified 613
64 Ga0070704_100183238 3300005549 Bacteria 1677
65 Ga0070704_100719523 3300005549 Bacteria 887
66 Ga0068855_100806954 3300005563 Bacteria 997
67 Ga0070664_100049556 3300005564 Bacteria 3552
68 Ga0070664_100057853 3300005564 Bacteria 3296
69 Ga0070664_100681029 3300005564 Unclassified 957
70 Ga0068857_100593149 3300005577 Bacteria 1047
71 Ga0068857_102116059 3300005577 Unclassified 552
72 Ga0070702_100086188 3300005615 Bacteria 1894
73 Ga0068859_100141869 3300005617 Bacteria 2476
74 Ga0068859_100234941 3300005617 Bacteria 1922
75 Ga0068864_100061834 3300005618 Bacteria 3243
76 Ga0068864_100073643 3300005618 Bacteria 2978
77 Ga0068861_100029352 3300005719 Bacteria 4023
78 Ga0068861_100212904 3300005719 Unclassified 1629
79 Ga0068863_100785362 3300005841 Bacteria 949
80 Ga0068858_101032561 3300005842 Bacteria 806
81 Ga0068858_101281035 3300005842 Bacteria 721
82 Ga0068860_100501489 3300005843 Bacteria 1212
83 Ga0068860_101213495 3300005843 Unclassified 775
84 Ga0068862_100088545 3300005844 Bacteria 2693
85 Ga0068862_100090768 3300005844 Bacteria 2660
86 Ga0068862_100555478 3300005844 Bacteria 1097
87 Ga0068862_100638015 3300005844 Unclassified 1026
88 Ga0075428_100022234 3300006844 Bacteria 7021
89 Ga0075430_100446073 3300006846 Bacteria 1068
90 Ga0075431_101769931 3300006847 Unclassified 574
91 Ga0075433_10105698 3300006852 Bacteria 2494
92 Ga0075433_10776669 3300006852 Bacteria 837
93 Ga0075434_100000749 3300006871 Bacteria 25556
94 Ga0075434_100061442 3300006871 Bacteria 3738
95 Ga0075434_100215971 3300006871 Bacteria 1938
96 Ga0075434_100372412 3300006871 Unclassified 1449
97 Ga0075434_101218298 3300006871 Unclassified 765
98 Ga0075429_100749187 3300006880 Unclassified 856
99 Ga0075436_100002111 3300006914 Bacteria 13708
100 Ga0075436_100017473 3300006914 Bacteria 4911
101 Ga0075436_100035496 3300006914 Bacteria 3439
102 Ga0097620_100141878 3300006931 Bacteria 2476
103 Ga0097620_100234939 3300006931 Bacteria 1922
104 Ga0075435_100000263 3300007076 Bacteria 32673
105 Ga0075435_100006626 3300007076 Bacteria 8204
106 Ga0075435_100020341 3300007076 Bacteria 5083
107 Ga0099794_10215450 3300007265 Unclassified 985
108 Ga0099794_10400891 3300007265 Bacteria 716
109 Ga0105240_10327458 3300009093 Bacteria 1744
110 Ga0111539_10043073 3300009094 Bacteria 5414
111 Ga0111539_10167428 3300009094 Bacteria 2568
112 Ga0111539_10192603 3300009094 Bacteria 2379
113 Ga0111539_11105140 3300009094 Bacteria 921
114 Ga0105245_10218842 3300009098 Bacteria 1836
115 Ga0105245_10710474 3300009098 Unclassified 1039
116 Ga0114129_10000807 3300009147 Bacteria 40253
117 Ga0114129_10005815 3300009147 Bacteria 17467
118 Ga0114129_10009041 3300009147 Bacteria 14197
119 Ga0114129_10012261 3300009147 Bacteria 12196
120 Ga0114129_10073652 3300009147 Bacteria 4758
121 Ga0114129_10075598 3300009147 Bacteria 4690
122 Ga0114129_10753008 3300009147 Bacteria 1247
123 Ga0114129_10880143 3300009147 Bacteria 1136
124 Ga0114129_11196484 3300009147 Bacteria 947
125 Ga0114129_11430351 3300009147 Bacteria 852
126 Ga0114129_11466306 3300009147 Unclassified 840
127 Ga0105243_10609861 3300009148 Bacteria 1052
128 Ga0105243_11818164 3300009148 Bacteria 641
129 Ga0105242_10004605 3300009176 Bacteria 10688
130 Ga0105242_10875729 3300009176 Bacteria 896
131 Ga0105248_10101127 3300009177 Bacteria 3249
132 Ga0105248_10151502 3300009177 Bacteria 2616
133 Ga0105248_10152702 3300009177 Bacteria 2605
134 Ga0105248_10185825 3300009177 Bacteria 2342
135 Ga0105248_11388709 3300009177 Unclassified 795
136 Ga0105238_10124691 3300009551 Bacteria 2555
137 Ga0105238_11534169 3300009551 Bacteria 695
138 Ga0157374_10382877 3300013296 Bacteria 1401
139 Ga0157378_10646430 3300013297 Bacteria 1073
140 Ga0163162_10127706 3300013306 Bacteria 2650
141 Ga0163162_11786383 3300013306 Bacteria 703
142 Ga0157375_10026582 3300013308 Bacteria 5397
143 Ga0157375_10232361 3300013308 Bacteria 2003
144 Ga0163163_10009842 3300014325 Bacteria 8567
145 Ga0157380_11106958 3300014326 Bacteria 831
146 Ga0157377_10382682 3300014745 Bacteria 953
147 Ga0157377_10618630 3300014745 Bacteria 775
148 Ga0157379_10028725 3300014968 Bacteria 4946
149 Ga0157376_10065897 3300014969 Bacteria 3060
150 Ga0163161_10417860 3300017792 Bacteria 1078
151 Ga0207692_10275715 3300025898 Bacteria 1016
152 Ga0207642_10629533 3300025899 Bacteria 670
153 Ga0207707_10030500 3300025912 Bacteria 4717
154 Ga0207707_10058676 3300025912 Bacteria 3349
155 Ga0207695_10279470 3300025913 Bacteria 1563
156 Ga0207663_10587368 3300025916 Bacteria 874
157 Ga0207660_10121193 3300025917 Bacteria 1981
158 Ga0207657_10071050 3300025919 Bacteria 2948
159 Ga0207657_10099739 3300025919 Bacteria 2412
160 Ga0207652_10706737 3300025921 Unclassified 899
161 Ga0207646_10008835 3300025922 Bacteria 10043
162 Ga0207646_10220604 3300025922 Bacteria 1713
163 Ga0207646_10291873 3300025922 Bacteria 1474
164 Ga0207681_10016026 3300025923 Bacteria 4681
165 Ga0207650_10002354 3300025925 Bacteria 13134
166 Ga0207659_10163468 3300025926 Bacteria 1750
167 Ga0207700_10750983 3300025928 Bacteria 872
168 Ga0207644_10099465 3300025931 Bacteria 2182
169 Ga0207690_10104562 3300025932 Bacteria 2029
170 Ga0207690_10201476 3300025932 Bacteria 1512
171 Ga0207690_10351062 3300025932 Bacteria 1166
172 Ga0207690_10642815 3300025932 Bacteria 869
173 Ga0207706_10216471 3300025933 Bacteria 1678
174 Ga0207706_10421634 3300025933 Bacteria 1156
175 Ga0207686_11078212 3300025934 Bacteria 654
176 Ga0207670_10380478 3300025936 Bacteria 1124
177 Ga0207670_10657076 3300025936 Bacteria 865
178 Ga0207665_10298316 3300025939 Bacteria 1204
179 Ga0207665_10687130 3300025939 Bacteria 804
180 Ga0207691_10023566 3300025940 Bacteria 5796
181 Ga0207711_10261397 3300025941 Bacteria 1591
182 Ga0207711_10325206 3300025941 Bacteria 1421
183 Ga0207711_10382270 3300025941 Bacteria 1306
184 Ga0207711_10582155 3300025941 Bacteria 1044
185 Ga0207661_10557774 3300025944 Bacteria 1050
186 Ga0207679_10076480 3300025945 Bacteria 2544
187 Ga0207679_10641914 3300025945 Bacteria 960
188 Ga0207667_10671139 3300025949 Bacteria 1041
189 Ga0207651_10745610 3300025960 Bacteria 865
190 Ga0207703_10133037 3300026035 Bacteria 2150
191 Ga0207703_10397566 3300026035 Bacteria 1278
192 Ga0207703_10810029 3300026035 Unclassified 894
193 Ga0207641_10020167 3300026088 Bacteria 5472
194 Ga0207641_10124873 3300026088 Bacteria 2303
195 Ga0207676_10208678 3300026095 Bacteria 1731
196 Ga0207674_10281425 3300026116 Bacteria 1611
197 Ga0207675_100080249 3300026118 Bacteria 3059
198 Ga0207675_100121635 3300026118 Bacteria 2470
199 Ga0207675_101099696 3300026118 Bacteria 815
200 Ga0207683_10743265 3300026121 Bacteria 910
201 Ga0207428_10075109 3300027907 Bacteria 2649
202 Ga0207428_10253759 3300027907 Bacteria 1311
203 Ga0268265_10019372 3300028380 Bacteria 4729
204 Ga0268265_10060164 3300028380 Bacteria 2910
205 Ga0268265_10727877 3300028380 Unclassified 961
206 Ga0268265_10958193 3300028380 Bacteria 843
207 Ga0268264_10219573 3300028381 Bacteria 1749
208 Ga0268264_10340755 3300028381 Bacteria 1424
209 Ga0268264_10429249 3300028381 Bacteria 1276
210 Ga0307409_100754716 3300031995 Bacteria 977
211 Ga0307416_100467257 3300032002 Bacteria 1318
212 Ga0373924_0481420 3300035410 Unclassified 557
213 Ga0373925_0597594 3300037068 Bacteria 909
214 Ga0495621_0128056 3300046539 Bacteria 986
215 Ga0495635_0017233 3300046663 Bacteria 5046
216 Ga0495647_0192790 3300046681 Bacteria 891
217 Ga0495615_0136955 3300048090 Bacteria 720
218 Ga0496104_1380402 3300048907 Bacteria 608
219 Ga0496105_0351491 3300048908 Bacteria 1177
220 Ga0496106_0631934 3300048909 Bacteria 856
221 Ga0496109_0777191 3300048912 Bacteria 896
222 Ga0496114_0129162 3300048917 Bacteria 2180
223 Ga0501075_0108694 3300049591 Bacteria 2108
224 Ga0501249_052830 3300049679 Bacteria 934
225 Ga0501251_060245 3300049681 Bacteria 624
226 Ga0501081_0619734 3300049743 Bacteria 810
227 Ga0501081_1254107 3300049743 Unclassified 562
228 Ga0501045_0784315 3300049824 Unclassified 702
229 nmdc:mga05p37_1110921_c1 3300050507 Bacteria 827
230 nmdc:mga05p37_1177009_c1 3300050507 Bacteria 795
231 nmdc:mga05p37_1257322_c1 3300050507 Bacteria 759
232 nmdc:mga05p37_133989_c1 3300050507 Bacteria 3039
233 nmdc:mga05p37_134458_c1 3300050507 Bacteria 3034
234 nmdc:mga05p37_32649_c2 3300050507 Bacteria 2587
235 nmdc:mga05p37_35404_c1 3300050507 Bacteria 6121
236 nmdc:mga05p37_42232_c1 3300050507 Bacteria 5602
237 nmdc:mga05p37_56741_c1 3300050507 Bacteria 4822
238 nmdc:mga05p37_75588_c1 3300050507 Bacteria 4146
239 nmdc:mga0qj67_439373_c1 3300050509 Bacteria 1051
240 nmdc:mga08y16_327_c1 3300050511 Bacteria 43166
241 nmdc:mga08y16_398644_c1 3300050511 Bacteria 1409
242 nmdc:mga08y16_68149_c1 3300050511 Bacteria 3710
243 nmdc:mga0n895_136634_c1 3300050512 Unclassified 2478
244 nmdc:mga0n895_2175064_c1 3300050512 Bacteria 510
245 nmdc:mga0n895_223219_c1 3300050512 Bacteria 1913
246 nmdc:mga0n895_430_c1 3300050512 Bacteria 28191
247 nmdc:mga0rr50_236430_c1 3300050513 Bacteria 1513
248 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
249 nmdc:mga0rr50_4949_c1 3300050513 Bacteria 7886
250 nmdc:mga0rr50_88348_c1 3300050513 Unclassified 2408
251 nmdc:mga08x19_1588_c1 3300050514 Bacteria 14094
252 nmdc:mga08x19_21989_c1 3300050514 Bacteria 3945
253 nmdc:mga08x19_24944_c1 3300050514 Bacteria 3722
254 nmdc:mga08x19_68133_c1 3300050514 Bacteria 2316
255 nmdc:mga0a205_1301220_c1 3300050515 Bacteria 575
256 nmdc:mga0a205_195943_c1 3300050515 Bacteria 1911
257 nmdc:mga0a205_332337_c1 3300050515 Bacteria 1389
258 nmdc:mga0a205_37375_c1 3300050515 Bacteria 4669
259 nmdc:mga0a205_5457_c2 3300050515 Bacteria 9974
260 nmdc:mga0a205_678109_c1 3300050515 Bacteria 881
261 nmdc:mga0a205_769277_c1 3300050515 Bacteria 811
262 nmdc:mga0a205_789944_c1 3300050515 Bacteria 797

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100802583 Ga0070683_1008025831 119
2 3300005336 Ga0070680_100131647 Ga0070680_1001316472 119
3 3300005337 Ga0070682_100345089 Ga0070682_1003450892 119
4 3300005366 Ga0070659_100164293 Ga0070659_1001642933 119
5 3300005458 Ga0070681_10004275 Ga0070681_100042758 119
6 3300005530 Ga0070679_100083418 Ga0070679_1000834182 119
7 3300005563 Ga0068855_100806954 Ga0068855_1008069542 119
8 3300025912 Ga0207707_10030500 Ga0207707_100305002 119
9 3300025917 Ga0207660_10121193 Ga0207660_101211933 119
10 3300025921 Ga0207652_10706737 Ga0207652_107067372 119
11 3300025949 Ga0207667_10671139 Ga0207667_106711392 119
12 3300005339 Ga0070660_100092881 Ga0070660_1000928812 123
13 3300025919 Ga0207657_10099739 Ga0207657_100997391 123
14 3300025932 Ga0207690_10351062 Ga0207690_103510621 128
15 3300005564 Ga0070664_100057853 Ga0070664_1000578532 132
16 3300025932 Ga0207690_10104562 Ga0207690_101045622 132
17 3300006844 Ga0075428_100022234 Ga0075428_1000222343 135
18 3300009176 Ga0105242_10875729 Ga0105242_108757292 135
19 3300025934 Ga0207686_11078212 Ga0207686_110782122 135
20 3300048908 Ga0496105_0351491 Ga0496105_0351491_221_703 135
21 3300026088 Ga0207641_10020167 Ga0207641_100201672 136
22 3300009147 Ga0114129_10009041 Ga0114129_1000904111 137
23 3300050507 nmdc:mga05p37_42232_c1 nmdc:mga05p37_42232_c1_2825_3325 137
24 3300006871 Ga0075434_100215971 Ga0075434_1002159712 139
25 3300009147 Ga0114129_10012261 Ga0114129_100122614 139
26 3300009177 Ga0105248_10152702 Ga0105248_101527024 139
27 3300050507 nmdc:mga05p37_35404_c1 nmdc:mga05p37_35404_c1_2267_2701 139
28 3300050515 nmdc:mga0a205_769277_c1 nmdc:mga0a205_769277_c1_307_741 139
29 3300005330 Ga0070690_100058317 Ga0070690_1000583172 140
30 3300005331 Ga0070670_101231480 Ga0070670_1012314801 140
31 3300005353 Ga0070669_100022379 Ga0070669_1000223792 140
32 3300005364 Ga0070673_100994094 Ga0070673_1009940941 140
33 3300005365 Ga0070688_100064493 Ga0070688_1000644932 140
34 3300005441 Ga0070700_100316328 Ga0070700_1003163281 140
35 3300005444 Ga0070694_100005411 Ga0070694_1000054116 140
36 3300005457 Ga0070662_100197038 Ga0070662_1001970382 140
37 3300005468 Ga0070707_100061870 Ga0070707_1000618702 140
38 3300005545 Ga0070695_100003611 Ga0070695_1000036119 140
39 3300005546 Ga0070696_100785083 Ga0070696_1007850832 140
40 3300005549 Ga0070704_100183238 Ga0070704_1001832382 140
41 3300005719 Ga0068861_100212904 Ga0068861_1002129042 140
42 3300005844 Ga0068862_100088545 Ga0068862_1000885452 140
43 3300009094 Ga0111539_10043073 Ga0111539_100430736 140
44 3300009147 Ga0114129_10005815 Ga0114129_100058153 140
45 3300009147 Ga0114129_11196484 Ga0114129_111964842 140
46 3300013308 Ga0157375_10232361 Ga0157375_102323611 140
47 3300014745 Ga0157377_10382682 Ga0157377_103826823 140
48 3300025899 Ga0207642_10629533 Ga0207642_106295331 140
49 3300025922 Ga0207646_10008835 Ga0207646_100088354 140
50 3300025923 Ga0207681_10016026 Ga0207681_100160265 140
51 3300025933 Ga0207706_10216471 Ga0207706_102164712 140
52 3300025960 Ga0207651_10745610 Ga0207651_107456102 140
53 3300026118 Ga0207675_100121635 Ga0207675_1001216352 140
54 3300027907 Ga0207428_10253759 Ga0207428_102537592 140
55 3300028380 Ga0268265_10019372 Ga0268265_100193725 140
56 3300050507 nmdc:mga05p37_1110921_c1 nmdc:mga05p37_1110921_c1_273_725 140
57 3300050507 nmdc:mga05p37_134458_c1 nmdc:mga05p37_134458_c1_1185_1637 140
58 3300050511 nmdc:mga08y16_398644_c1 nmdc:mga08y16_398644_c1_302_802 140
59 3300050515 nmdc:mga0a205_195943_c1 nmdc:mga0a205_195943_c1_966_1418 140
60 3300005440 Ga0070705_100477288 Ga0070705_1004772882 141
61 3300005546 Ga0070696_100015830 Ga0070696_1000158302 141
62 3300005445 Ga0070708_100217492 Ga0070708_1002174924 142
63 3300006852 Ga0075433_10776669 Ga0075433_107766691 142
64 3300050507 nmdc:mga05p37_1257322_c1 nmdc:mga05p37_1257322_c1_149_637 142
65 3300048912 Ga0496109_0777191 Ga0496109_0777191_268_744 144
66 3300026035 Ga0207703_10397566 Ga0207703_103975661 147
67 3300005330 Ga0070690_100255100 Ga0070690_1002551002 148
68 3300005335 Ga0070666_10013124 Ga0070666_100131245 148
69 3300005340 Ga0070689_100236614 Ga0070689_1002366142 148
70 3300005340 Ga0070689_100453312 Ga0070689_1004533122 148
71 3300005355 Ga0070671_100025551 Ga0070671_1000255513 148
72 3300005364 Ga0070673_101684194 Ga0070673_1016841941 148
73 3300005365 Ga0070688_100016310 Ga0070688_1000163104 148
74 3300005365 Ga0070688_100876425 Ga0070688_1008764251 148
75 3300005367 Ga0070667_100005508 Ga0070667_1000055084 148
76 3300005441 Ga0070700_100575140 Ga0070700_1005751402 148
77 3300005456 Ga0070678_100696519 Ga0070678_1006965191 148
78 3300005466 Ga0070685_10027354 Ga0070685_100273542 148
79 3300005468 Ga0070707_100344379 Ga0070707_1003443792 148
80 3300005518 Ga0070699_100093305 Ga0070699_1000933055 148
81 3300005518 Ga0070699_100182165 Ga0070699_1001821651 148
82 3300005536 Ga0070697_100071860 Ga0070697_1000718601 148
83 3300005543 Ga0070672_100068894 Ga0070672_1000688942 148
84 3300005544 Ga0070686_100041289 Ga0070686_1000412892 148
85 3300005545 Ga0070695_100506760 Ga0070695_1005067601 148
86 3300005546 Ga0070696_100298079 Ga0070696_1002980792 148
87 3300005617 Ga0068859_100141869 Ga0068859_1001418692 148
88 3300005719 Ga0068861_100029352 Ga0068861_1000293522 148
89 3300005842 Ga0068858_101281035 Ga0068858_1012810352 148
90 3300005844 Ga0068862_100638015 Ga0068862_1006380152 148
91 3300006852 Ga0075433_10105698 Ga0075433_101056982 148
92 3300006871 Ga0075434_100000749 Ga0075434_10000074919 148
93 3300006871 Ga0075434_100372412 Ga0075434_1003724122 148
94 3300006914 Ga0075436_100002111 Ga0075436_1000021119 148
95 3300006914 Ga0075436_100035496 Ga0075436_1000354962 148
96 3300006931 Ga0097620_100141878 Ga0097620_1001418782 148
97 3300007076 Ga0075435_100000263 Ga0075435_10000026326 148
98 3300007076 Ga0075435_100020341 Ga0075435_1000203416 148
99 3300007265 Ga0099794_10215450 Ga0099794_102154502 148
100 3300007265 Ga0099794_10400891 Ga0099794_104008912 148
101 3300009093 Ga0105240_10327458 Ga0105240_103274582 148
102 3300009094 Ga0111539_11105140 Ga0111539_111051402 148
103 3300009098 Ga0105245_10218842 Ga0105245_102188422 148
104 3300009147 Ga0114129_10753008 Ga0114129_107530082 148
105 3300009147 Ga0114129_10880143 Ga0114129_108801432 148
106 3300009147 Ga0114129_11430351 Ga0114129_114303512 148
107 3300009176 Ga0105242_10004605 Ga0105242_100046054 148
108 3300009177 Ga0105248_10101127 Ga0105248_101011273 148
109 3300013297 Ga0157378_10646430 Ga0157378_106464301 148
110 3300013306 Ga0163162_10127706 Ga0163162_101277062 148
111 3300013306 Ga0163162_11786383 Ga0163162_117863831 148
112 3300013308 Ga0157375_10026582 Ga0157375_100265823 148
113 3300014745 Ga0157377_10618630 Ga0157377_106186302 148
114 3300014968 Ga0157379_10028725 Ga0157379_100287255 148
115 3300014969 Ga0157376_10065897 Ga0157376_100658973 148
116 3300017792 Ga0163161_10417860 Ga0163161_104178602 148
117 3300025913 Ga0207695_10279470 Ga0207695_102794702 148
118 3300025922 Ga0207646_10291873 Ga0207646_102918732 148
119 3300025931 Ga0207644_10099465 Ga0207644_100994653 148
120 3300025936 Ga0207670_10380478 Ga0207670_103804782 148
121 3300025936 Ga0207670_10657076 Ga0207670_106570761 148
122 3300025940 Ga0207691_10023566 Ga0207691_100235662 148
123 3300025941 Ga0207711_10382270 Ga0207711_103822702 148
124 3300026118 Ga0207675_100080249 Ga0207675_1000802492 148
125 3300028380 Ga0268265_10727877 Ga0268265_107278771 148
126 3300028381 Ga0268264_10219573 Ga0268264_102195732 148
127 3300035410 Ga0373924_0481420 Ga0373924_0481420_39_494 148
128 3300037068 Ga0373925_0597594 Ga0373925_0597594_411_866 148
129 3300046663 Ga0495635_0017233 Ga0495635_0017233_358_813 148
130 3300048907 Ga0496104_1380402 Ga0496104_1380402_86_589 148
131 3300048909 Ga0496106_0631934 Ga0496106_0631934_15_518 148
132 3300048917 Ga0496114_0129162 Ga0496114_0129162_86_541 148
133 3300049591 Ga0501075_0108694 Ga0501075_0108694_683_1129 148
134 3300049681 Ga0501251_060245 Ga0501251_060245_153_608 148
135 3300050507 nmdc:mga05p37_56741_c1 nmdc:mga05p37_56741_c1_615_1079 148
136 3300050511 nmdc:mga08y16_327_c1 nmdc:mga08y16_327_c1_17892_18338 148
137 3300050512 nmdc:mga0n895_136634_c1 nmdc:mga0n895_136634_c1_196_654 148
138 3300050512 nmdc:mga0n895_430_c1 nmdc:mga0n895_430_c1_23926_24381 148
139 3300050513 nmdc:mga0rr50_236430_c1 nmdc:mga0rr50_236430_c1_470_937 148
140 3300050513 nmdc:mga0rr50_2_c1 nmdc:mga0rr50_2_c1_369667_370122 148
141 3300050513 nmdc:mga0rr50_4949_c1 nmdc:mga0rr50_4949_c1_6137_6595 148
142 3300050514 nmdc:mga08x19_1588_c1 nmdc:mga08x19_1588_c1_9112_9567 148
143 3300050514 nmdc:mga08x19_21989_c1 nmdc:mga08x19_21989_c1_520_972 148
144 3300050514 nmdc:mga08x19_24944_c1 nmdc:mga08x19_24944_c1_2810_3256 148
145 3300050515 nmdc:mga0a205_1301220_c1 nmdc:mga0a205_1301220_c1_45_500 148
146 3300050515 nmdc:mga0a205_37375_c1 nmdc:mga0a205_37375_c1_17_481 148
147 3300005331 Ga0070670_100391840 Ga0070670_1003918401 149
148 3300005437 Ga0070710_10424505 Ga0070710_104245052 149
149 3300005468 Ga0070707_101557254 Ga0070707_1015572541 149
150 3300005471 Ga0070698_100042498 Ga0070698_1000424982 149
151 3300005535 Ga0070684_100340321 Ga0070684_1003403212 149
152 3300005564 Ga0070664_100681029 Ga0070664_1006810291 149
153 3300005843 Ga0068860_100501489 Ga0068860_1005014892 149
154 3300009148 Ga0105243_10609861 Ga0105243_106098612 149
155 3300009177 Ga0105248_10151502 Ga0105248_101515023 149
156 3300009551 Ga0105238_10124691 Ga0105238_101246912 149
157 3300013296 Ga0157374_10382877 Ga0157374_103828772 149
158 3300014326 Ga0157380_11106958 Ga0157380_111069582 149
159 3300025898 Ga0207692_10275715 Ga0207692_102757152 149
160 3300025916 Ga0207663_10587368 Ga0207663_105873682 149
161 3300025928 Ga0207700_10750983 Ga0207700_107509831 149
162 3300025932 Ga0207690_10201476 Ga0207690_102014762 149
163 3300025933 Ga0207706_10421634 Ga0207706_104216341 149
164 3300025939 Ga0207665_10298316 Ga0207665_102983162 149
165 3300025939 Ga0207665_10687130 Ga0207665_106871302 149
166 3300025941 Ga0207711_10325206 Ga0207711_103252062 149
167 3300025944 Ga0207661_10557774 Ga0207661_105577742 149
168 3300025945 Ga0207679_10641914 Ga0207679_106419142 149
169 3300026118 Ga0207675_101099696 Ga0207675_1010996962 149
170 3300028380 Ga0268265_10958193 Ga0268265_109581931 149
171 3300028381 Ga0268264_10429249 Ga0268264_104292492 149
172 3300046681 Ga0495647_0192790 Ga0495647_0192790_216_698 149
173 3300048090 Ga0495615_0136955 Ga0495615_0136955_16_471 149
174 3300049743 Ga0501081_1254107 Ga0501081_1254107_91_546 149
175 3300049824 Ga0501045_0784315 Ga0501045_0784315_89_544 149
176 3300050507 nmdc:mga05p37_133989_c1 nmdc:mga05p37_133989_c1_2021_2491 149
177 3300050512 nmdc:mga0n895_2175064_c1 nmdc:mga0n895_2175064_c1_30_500 149
178 3300050515 nmdc:mga0a205_678109_c1 nmdc:mga0a205_678109_c1_116_586 149
179 3300005290 Ga0065712_10000157 Ga0065712_1000015719 150
180 3300005293 Ga0065715_10111658 Ga0065715_101116581 150
181 3300005331 Ga0070670_100077434 Ga0070670_1000774342 150
182 3300005335 Ga0070666_10953297 Ga0070666_109532971 150
183 3300005336 Ga0070680_100695505 Ga0070680_1006955051 150
184 3300005344 Ga0070661_100288549 Ga0070661_1002885492 150
185 3300005345 Ga0070692_10993864 Ga0070692_109938641 150
186 3300005354 Ga0070675_100045584 Ga0070675_1000455842 150
187 3300005355 Ga0070671_100784084 Ga0070671_1007840841 150
188 3300005365 Ga0070688_100021440 Ga0070688_1000214402 150
189 3300005366 Ga0070659_101169167 Ga0070659_1011691672 150
190 3300005439 Ga0070711_100225470 Ga0070711_1002254702 150
191 3300005458 Ga0070681_10030357 Ga0070681_100303575 150
192 3300005518 Ga0070699_101078487 Ga0070699_1010784872 150
193 3300005545 Ga0070695_100723722 Ga0070695_1007237222 150
194 3300005546 Ga0070696_100048811 Ga0070696_1000488112 150
195 3300005546 Ga0070696_101318005 Ga0070696_1013180051 150
196 3300005549 Ga0070704_100719523 Ga0070704_1007195232 150
197 3300005564 Ga0070664_100049556 Ga0070664_1000495561 150
198 3300005577 Ga0068857_100593149 Ga0068857_1005931491 150
199 3300005577 Ga0068857_102116059 Ga0068857_1021160591 150
200 3300005615 Ga0070702_100086188 Ga0070702_1000861881 150
201 3300005617 Ga0068859_100234941 Ga0068859_1002349412 150
202 3300005618 Ga0068864_100061834 Ga0068864_1000618342 150
203 3300005618 Ga0068864_100073643 Ga0068864_1000736433 150
204 3300005841 Ga0068863_100785362 Ga0068863_1007853621 150
205 3300005842 Ga0068858_101032561 Ga0068858_1010325612 150
206 3300005843 Ga0068860_101213495 Ga0068860_1012134952 150
207 3300005844 Ga0068862_100090768 Ga0068862_1000907682 150
208 3300005844 Ga0068862_100555478 Ga0068862_1005554782 150
209 3300006846 Ga0075430_100446073 Ga0075430_1004460732 150
210 3300006847 Ga0075431_101769931 Ga0075431_1017699311 150
211 3300006871 Ga0075434_100061442 Ga0075434_1000614423 150
212 3300006871 Ga0075434_101218298 Ga0075434_1012182982 150
213 3300006880 Ga0075429_100749187 Ga0075429_1007491872 150
214 3300006914 Ga0075436_100017473 Ga0075436_1000174733 150
215 3300006931 Ga0097620_100234939 Ga0097620_1002349392 150
216 3300007076 Ga0075435_100006626 Ga0075435_1000066263 150
217 3300009094 Ga0111539_10167428 Ga0111539_101674282 150
218 3300009094 Ga0111539_10192603 Ga0111539_101926032 150
219 3300009098 Ga0105245_10710474 Ga0105245_107104742 150
220 3300009147 Ga0114129_10000807 Ga0114129_1000080712 150
221 3300009147 Ga0114129_10073652 Ga0114129_100736522 150
222 3300009147 Ga0114129_10075598 Ga0114129_100755983 150
223 3300009147 Ga0114129_11466306 Ga0114129_114663061 150
224 3300009148 Ga0105243_11818164 Ga0105243_118181642 150
225 3300009177 Ga0105248_10185825 Ga0105248_101858252 150
226 3300009177 Ga0105248_11388709 Ga0105248_113887092 150
227 3300009551 Ga0105238_11534169 Ga0105238_115341691 150
228 3300014325 Ga0163163_10009842 Ga0163163_100098422 150
229 3300025912 Ga0207707_10058676 Ga0207707_100586762 150
230 3300025919 Ga0207657_10071050 Ga0207657_100710502 150
231 3300025922 Ga0207646_10220604 Ga0207646_102206042 150
232 3300025925 Ga0207650_10002354 Ga0207650_100023544 150
233 3300025926 Ga0207659_10163468 Ga0207659_101634682 150
234 3300025932 Ga0207690_10642815 Ga0207690_106428152 150
235 3300025941 Ga0207711_10261397 Ga0207711_102613971 150
236 3300025941 Ga0207711_10582155 Ga0207711_105821552 150
237 3300025945 Ga0207679_10076480 Ga0207679_100764802 150
238 3300026035 Ga0207703_10133037 Ga0207703_101330371 150
239 3300026035 Ga0207703_10810029 Ga0207703_108100292 150
240 3300026088 Ga0207641_10124873 Ga0207641_101248732 150
241 3300026095 Ga0207676_10208678 Ga0207676_102086782 150
242 3300026116 Ga0207674_10281425 Ga0207674_102814251 150
243 3300026121 Ga0207683_10743265 Ga0207683_107432651 150
244 3300027907 Ga0207428_10075109 Ga0207428_100751092 150
245 3300028380 Ga0268265_10060164 Ga0268265_100601643 150
246 3300028381 Ga0268264_10340755 Ga0268264_103407551 150
247 3300031995 Ga0307409_100754716 Ga0307409_1007547162 150
248 3300032002 Ga0307416_100467257 Ga0307416_1004672572 150
249 3300046539 Ga0495621_0128056 Ga0495621_0128056_346_807 150
250 3300049679 Ga0501249_052830 Ga0501249_052830_276_731 150
251 3300049743 Ga0501081_0619734 Ga0501081_0619734_77_541 150
252 3300050507 nmdc:mga05p37_1177009_c1 nmdc:mga05p37_1177009_c1_272_751 150
253 3300050507 nmdc:mga05p37_32649_c2 nmdc:mga05p37_32649_c2_1752_2207 150
254 3300050507 nmdc:mga05p37_75588_c1 nmdc:mga05p37_75588_c1_2149_2613 150
255 3300050509 nmdc:mga0qj67_439373_c1 nmdc:mga0qj67_439373_c1_310_774 150
256 3300050511 nmdc:mga08y16_68149_c1 nmdc:mga08y16_68149_c1_1408_1872 150
257 3300050512 nmdc:mga0n895_223219_c1 nmdc:mga0n895_223219_c1_20_478 150
258 3300050513 nmdc:mga0rr50_88348_c1 nmdc:mga0rr50_88348_c1_69_527 150
259 3300050514 nmdc:mga08x19_68133_c1 nmdc:mga08x19_68133_c1_1722_2180 150
260 3300050515 nmdc:mga0a205_332337_c1 nmdc:mga0a205_332337_c1_820_1299 150
261 3300050515 nmdc:mga0a205_5457_c2 nmdc:mga0a205_5457_c2_7593_8051 150
262 3300050515 nmdc:mga0a205_789944_c1 nmdc:mga0a205_789944_c1_21_500 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02631

RecX_HTH2

RecX, second three-helix domain

74

115

0.99

PF21982

RecX_HTH1

RecX, first three-helix domain

29

67

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dfg-assembly1.cif.gz_A crystal structure of recx: a potent inhibitor protein of reca from xanthomonas campestris 0.9012 5 147
3dfg-assembly1.cif.gz_A crystal structure of recx: a potent inhibitor protein of reca from xanthomonas campestris 0.878 5 147
3c1d-assembly3.cif.gz_A x-ray crystal structure of recx 0.83 3 143
3d5l-assembly2.cif.gz_B crystal structure of regulatory protein recx 0.7962 3 148
3c1d-assembly3.cif.gz_B x-ray crystal structure of recx 0.7936 3 143
ID Description Score Start End Superfamily
3d5lB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9537 3 50 1.10.10.10
3e3vA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9283 51 94 1.10.10.10
3dfgA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9277 5 47 1.10.10.10
3e3vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9264 3 50 1.10.10.10
3e3vA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8916 51 94 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7V8WCG7-F1-model_v4 Regulatory protein RecX 0.9638 5 148 GO:0005737
GO:0006282
AF-A0A432HTL0-F1-model_v4 Regulatory protein RecX 0.9624 5 150 GO:0005737
GO:0006282
AF-A0A321L7N3-F1-model_v4 Regulatory protein RecX 0.9605 2 149 GO:0005737
GO:0006282
AF-A0A2V8HI88-F1-model_v4 Regulatory protein RecX 0.9573 3 149 GO:0005737
GO:0006282
AF-A0A3D1QW24-F1-model_v4 Regulatory protein RecX 0.9533 5 147 GO:0005737
GO:0006282

Feature Viewer

pLDDT pTM Quality
95.58 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map