F369940

General Info

Members Datasets Scaffolds Average Seq Length
260 173 520 349

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0106671|Ga0501084_0106671_1109_2335
Length 408
Sequence MRGILDPWSGLTAAKSVSYSRPNGAPRSDHKICWEDSMKRLLFAGWLALIGPSALAQDQPAPMIPFESVPNFIKMPDDMYLGEVAGVAVNSKGHVFVYSRGGSSHGPAYGNTASQLLEFSASGRFVREIGKNLYAWAFAHTVRIDKDDNIWATDKGSDMIIKFNPQGRVEMVFGRKSEASDLEAKPHERNANPPPKHEDGRFRQPTDVTWGPDGSIYISDGYVNSRVAKLNKDGDWIKSWGERGKGPGQFNTPHSIAADAKGNIYVADRTNRRIQVFDGDGNFQREMIIDVQFDHNARPAIGAKPNLTTYKQTGGTMTPGAPWALCITPGPNQVLYAADAYPGRIYKMSLDGKMLGVLGSSGKRLKQFGWIHELACPSENVLFTAEILNWRVQKLILHPQQAKAGDKP

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 0
Rhizoplane 5
Rhizosphere 91.54
Stem 0
Stem Tuber 0
Unclassified 8.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0106671 3300054114 Bacteria 2354
2 JGI25153J46596_10000822 3300003215 Bacteria 18940
3 Ga0065715_10117680 3300005293 Bacteria 2339
4 Ga0065715_10189905 3300005293 Unclassified 1421
5 Ga0070658_10006070 3300005327 Bacteria 9797
6 Ga0070670_100037496 3300005331 Bacteria 4171
7 Ga0068869_100024937 3300005334 Bacteria 4147
8 Ga0070680_100020272 3300005336 Bacteria 5276
9 Ga0070660_100001495 3300005339 Bacteria 16001
10 Ga0070689_100319220 3300005340 Bacteria 1297
11 Ga0070669_100034771 3300005353 Bacteria 3648
12 Ga0070675_100003288 3300005354 Bacteria 12256
13 Ga0070675_100018462 3300005354 Bacteria 5552
14 Ga0070675_100030386 3300005354 Bacteria 4362
15 Ga0070671_100137890 3300005355 Bacteria 2057
16 Ga0070671_100152118 3300005355 Bacteria 1954
17 Ga0070674_100012279 3300005356 Bacteria 5257
18 Ga0070674_100059323 3300005356 Bacteria 2663
19 Ga0070673_100016103 3300005364 Bacteria 5276
20 Ga0070709_10073379 3300005434 Unclassified 2215
21 Ga0070714_100007232 3300005435 Bacteria 8621
22 Ga0070714_100045470 3300005435 Bacteria 3721
23 Ga0070714_100320153 3300005435 Bacteria 1450
24 Ga0070713_100008728 3300005436 Bacteria 7210
25 Ga0070713_100094987 3300005436 Unclassified 2571
26 Ga0070713_100498618 3300005436 Bacteria 1149
27 Ga0070701_10012795 3300005438 Bacteria 3794
28 Ga0070700_100028358 3300005441 Bacteria 3329
29 Ga0070678_100137150 3300005456 Bacteria 1952
30 Ga0070662_100141984 3300005457 Bacteria 1862
31 Ga0070681_10000287 3300005458 Bacteria 40681
32 Ga0068867_100069342 3300005459 Bacteria 2633
33 Ga0070707_100022357 3300005468 Bacteria 5978
34 Ga0070707_100055477 3300005468 Bacteria 3799
35 Ga0070679_100008003 3300005530 Bacteria 9925
36 Ga0070697_100339888 3300005536 Unclassified 1295
37 Ga0070672_100163453 3300005543 Bacteria 1848
38 Ga0070672_100197997 3300005543 Bacteria 1679
39 Ga0070704_100005131 3300005549 Bacteria 7608
40 Ga0068855_100004487 3300005563 Bacteria 17064
41 Ga0070664_100010704 3300005564 Bacteria 7438
42 Ga0068857_100169708 3300005577 Bacteria 1983
43 Ga0068854_100197961 3300005578 Bacteria 1578
44 Ga0070702_100123756 3300005615 Bacteria 1623
45 Ga0068852_100003267 3300005616 Bacteria 11320
46 Ga0068864_100299338 3300005618 Bacteria 1506
47 Ga0068858_100119027 3300005842 Bacteria 2469
48 Ga0068860_100086420 3300005843 Bacteria 2984
49 Ga0068860_100225826 3300005843 Bacteria 1819
50 Ga0081455_10013289 3300005937 Bacteria 8153
51 Ga0070717_10240255 3300006028 Bacteria 1597
52 Ga0075364_10030004 3300006051 Unclassified 3489
53 Ga0097621_100000383 3300006237 Bacteria 30887
54 Ga0097621_100028876 3300006237 Bacteria 4376
55 Ga0097621_100066600 3300006237 Bacteria 2967
56 Ga0097621_100159900 3300006237 Bacteria 1936
57 Ga0097621_100253068 3300006237 Unclassified 1543
58 Ga0097621_100363951 3300006237 Bacteria 1289
59 Ga0068871_100000553 3300006358 Bacteria 25508
60 Ga0068871_100079390 3300006358 Bacteria 2715
61 Ga0075428_100021818 3300006844 Bacteria 7090
62 Ga0075430_100101588 3300006846 Unclassified 2401
63 Ga0075433_10004007 3300006852 Bacteria 11396
64 Ga0075434_100002454 3300006871 Bacteria 16325
65 Ga0075434_100006911 3300006871 Bacteria 10456
66 Ga0068865_100031214 3300006881 Bacteria 3551
67 Ga0075436_100023060 3300006914 Bacteria 4275
68 Ga0075435_100028251 3300007076 Bacteria 4397
69 Ga0075435_100032647 3300007076 Bacteria 4113
70 Ga0075435_100279803 3300007076 Unclassified 1424
71 Ga0099794_10004386 3300007265 Bacteria 5532
72 Ga0099794_10051401 3300007265 Bacteria 1984
73 Ga0099794_10063629 3300007265 Bacteria 1796
74 Ga0105240_10000077 3300009093 Bacteria 197213
75 Ga0111539_10212071 3300009094 Unclassified 2256
76 Ga0105247_10041776 3300009101 Bacteria 2806
77 Ga0105247_10203656 3300009101 Bacteria 1331
78 Ga0114129_10015855 3300009147 Bacteria 10717
79 Ga0114129_10017519 3300009147 Bacteria 10198
80 Ga0114129_10026822 3300009147 Bacteria 8156
81 Ga0114129_10041007 3300009147 Bacteria 6524
82 Ga0114129_10322264 3300009147 Bacteria 2054
83 Ga0105243_10030028 3300009148 Bacteria 4183
84 Ga0105242_10315303 3300009176 Bacteria 1432
85 Ga0105242_10350958 3300009176 Bacteria 1362
86 Ga0105248_10012377 3300009177 Bacteria 9412
87 Ga0105248_10038858 3300009177 Bacteria 5328
88 Ga0105248_10109007 3300009177 Bacteria 3122
89 Ga0105248_10306355 3300009177 Bacteria 1789
90 Ga0105238_10000821 3300009551 Bacteria 32115
91 Ga0105238_10003109 3300009551 Bacteria 16555
92 Ga0105249_10579067 3300009553 Bacteria 1175
93 Ga0157370_10001689 3300013104 Bacteria 27180
94 Ga0157369_10028657 3300013105 Bacteria 6161
95 Ga0157374_10008659 3300013296 Bacteria 8707
96 Ga0157378_10087514 3300013297 Bacteria 2826
97 Ga0157378_10360412 3300013297 Bacteria 1423
98 Ga0163162_10044902 3300013306 Bacteria 4427
99 Ga0163162_10347151 3300013306 Bacteria 1617
100 Ga0157372_10000125 3300013307 Bacteria 82978
101 Ga0157375_10187558 3300013308 Bacteria 2222
102 Ga0163163_10106295 3300014325 Bacteria 2833
103 Ga0157380_10140620 3300014326 Bacteria 2073
104 Ga0157380_10239595 3300014326 Bacteria 1634
105 Ga0157380_10445765 3300014326 Bacteria 1242
106 Ga0157379_10025966 3300014968 Bacteria 5209
107 Ga0157376_10002956 3300014969 Bacteria 11661
108 Ga0157376_10154851 3300014969 Bacteria 2071
109 Ga0163161_10094706 3300017792 Bacteria 2214
110 Ga0213875_10028998 3300021388 Bacteria 2624
111 Ga0213875_10041839 3300021388 Bacteria 2155
112 Ga0213871_10005644 3300021441 Bacteria 2596
113 Ga0209758_1000079 3300025297 Bacteria 262874
114 Ga0207682_10038996 3300025893 Bacteria 1930
115 Ga0207699_10028204 3300025906 Unclassified 3118
116 Ga0207645_10032332 3300025907 Bacteria 3362
117 Ga0207643_10030424 3300025908 Bacteria 3005
118 Ga0207707_10000650 3300025912 Bacteria 34383
119 Ga0207695_10001093 3300025913 Bacteria 47293
120 Ga0207695_10157919 3300025913 Bacteria 2201
121 Ga0207663_10204807 3300025916 Unclassified 1426
122 Ga0207660_10010179 3300025917 Bacteria 6094
123 Ga0207652_10002209 3300025921 Bacteria 16605
124 Ga0207694_10001037 3300025924 Bacteria 24190
125 Ga0207694_10003179 3300025924 Bacteria 13105
126 Ga0207650_10007177 3300025925 Bacteria 7594
127 Ga0207659_10024165 3300025926 Bacteria 4068
128 Ga0207700_10018599 3300025928 Unclassified 4675
129 Ga0207700_10214403 3300025928 Bacteria 1629
130 Ga0207664_10046169 3300025929 Bacteria 3418
131 Ga0207686_10023900 3300025934 Bacteria 3533
132 Ga0207686_10028808 3300025934 Bacteria 3268
133 Ga0207670_10110552 3300025936 Bacteria 1980
134 Ga0207669_10052165 3300025937 Bacteria 2455
135 Ga0207711_10018627 3300025941 Bacteria 5773
136 Ga0207711_10119138 3300025941 Bacteria 2355
137 Ga0207711_10174176 3300025941 Bacteria 1954
138 Ga0207689_10005280 3300025942 Bacteria 11579
139 Ga0207689_10078371 3300025942 Bacteria 2715
140 Ga0207661_10231730 3300025944 Bacteria 1636
141 Ga0207667_10000123 3300025949 Bacteria 120422
142 Ga0207651_10010793 3300025960 Bacteria 5080
143 Ga0207640_10037244 3300025981 Bacteria 3059
144 Ga0207677_10008574 3300026023 Bacteria 5719
145 Ga0207708_10014399 3300026075 Bacteria 5918
146 Ga0207641_10333321 3300026088 Bacteria 1442
147 Ga0207683_10077994 3300026121 Bacteria 2935
148 Ga0207683_10101673 3300026121 Bacteria 2567
149 Ga0207683_10213720 3300026121 Bacteria 1756
150 Ga0207698_10209560 3300026142 Bacteria 1752
151 Ga0209588_1002094 3300027671 Bacteria 5387
152 Ga0207428_10117504 3300027907 Unclassified 2041
153 Ga0268264_10034299 3300028381 Bacteria 4173
154 Ga0268264_10082012 3300028381 Bacteria 2758
155 Ga0265338_10005239 3300028800 Bacteria 17004
156 Ga0265338_10215380 3300028800 Bacteria 1438
157 Ga0265330_10000456 3300031235 Bacteria 27248
158 Ga0265332_10003636 3300031238 Bacteria 7391
159 Ga0265328_10000151 3300031239 Bacteria 32936
160 Ga0265320_10033953 3300031240 Bacteria 2601
161 Ga0265325_10000243 3300031241 Bacteria 38641
162 Ga0265325_10001378 3300031241 Bacteria 17169
163 Ga0265329_10030446 3300031242 Bacteria 1758
164 Ga0265340_10003178 3300031247 Bacteria 9306
165 Ga0265340_10020055 3300031247 Bacteria 3440
166 Ga0265339_10000118 3300031249 Bacteria 65006
167 Ga0265316_10009328 3300031344 Bacteria 9040
168 Ga0265316_10014814 3300031344 Bacteria 6842
169 Ga0265316_10158513 3300031344 Bacteria 1693
170 Ga0265313_10000369 3300031595 Bacteria 48818
171 Ga0265314_10000564 3300031711 Bacteria 47150
172 Ga0265314_10069285 3300031711 Bacteria 2368
173 Ga0265342_10000680 3300031712 Bacteria 35552
174 Ga0373926_0033024 3300035083 Bacteria 1828
175 Ga0373936_0036160 3300035113 Bacteria 1968
176 Ga0373945_0038927 3300035116 Bacteria 1712
177 Ga0373953_0017749 3300035117 Bacteria 2621
178 Ga0373943_0003095 3300035170 Bacteria 7553
179 Ga0373946_0088982 3300035171 Bacteria 1365
180 Ga0373955_0136366 3300035172 Bacteria 1436
181 Ga0373955_0235004 3300035172 Bacteria 1097
182 Ga0373961_0004009 3300035241 Bacteria 3587
183 Ga0373931_0000682 3300035691 Bacteria 14097
184 Ga0373935_0017685 3300035692 Bacteria 4328
185 Ga0373935_0055156 3300035692 Bacteria 2532
186 Ga0373947_0020796 3300035725 Bacteria 3793
187 Ga0373947_0022357 3300035725 Bacteria 3667
188 Ga0373947_0042562 3300035725 Bacteria 2711
189 Ga0373947_0110648 3300035725 Bacteria 1735
190 Ga0373937_0041206 3300036401 Bacteria 4212
191 Ga0373937_0047036 3300036401 Unclassified 3947
192 Ga0373937_0303616 3300036401 Unclassified 1509
193 Ga0373925_0007449 3300037068 Bacteria 7986
194 Ga0373925_0021194 3300037068 Bacteria 4736
195 Ga0436365_1779922 3300039437 Bacteria 2113
196 Ga0451576_0061265 3300045051 Bacteria 3924
197 Ga0495580_0016089 3300046472 Bacteria 5622
198 Ga0495608_0010712 3300046511 Bacteria 6396
199 Ga0495618_0139147 3300046514 Bacteria 1553
200 Ga0495628_0049459 3300046516 Bacteria 3329
201 Ga0495652_0160771 3300046529 Bacteria 1744
202 Ga0495587_0004620 3300046536 Bacteria 9048
203 Ga0495587_0087940 3300046536 Bacteria 1798
204 Ga0495645_0107126 3300046543 Bacteria 1981
205 Ga0495667_0081859 3300046559 Bacteria 2098
206 Ga0495667_0215404 3300046559 Bacteria 1227
207 Ga0495634_0024766 3300046642 Unclassified 4207
208 Ga0495634_0064847 3300046642 Bacteria 2421
209 Ga0495634_0142892 3300046642 Bacteria 1518
210 Ga0495599_0027762 3300046678 Bacteria 3547
211 Ga0495658_0060557 3300046683 Bacteria 2172
212 Ga0495669_0042314 3300046684 Bacteria 2025
213 Ga0495613_0000596 3300046689 Bacteria 29048
214 Ga0495613_0116589 3300046689 Bacteria 1921
215 Ga0495604_0057802 3300047317 Bacteria 2981
216 Ga0495674_0008568 3300047319 Bacteria 9733
217 Ga0495680_0116583 3300047322 Bacteria 1975
218 Ga0495684_0000091 3300047471 Bacteria 63223
219 Ga0495684_0185558 3300047471 Bacteria 1540
220 Ga0495602_0061550 3300048088 Unclassified 3263
221 Ga0495602_0284015 3300048088 Bacteria 1218
222 Ga0496100_0081326 3300048903 Bacteria 2188
223 Ga0496101_0106260 3300048904 Bacteria 2108
224 Ga0496101_0185130 3300048904 Unclassified 1605
225 Ga0496104_0001967 3300048907 Bacteria 17802
226 Ga0496104_0107911 3300048907 Bacteria 2668
227 Ga0496105_0014240 3300048908 Bacteria 6328
228 Ga0496105_0155076 3300048908 Bacteria 1881
229 Ga0496106_0146158 3300048909 Bacteria 1862
230 Ga0496107_0001825 3300048910 Bacteria 13436
231 Ga0496111_0027785 3300048914 Bacteria 4006
232 Ga0496112_0225944 3300048915 Bacteria 1827
233 Ga0496114_0047624 3300048917 Bacteria 3565
234 Ga0496115_0203207 3300048918 Bacteria 1636
235 Ga0501071_0274282 3300049587 Bacteria 1276
236 nmdc:mga00v17_104686_c1 3300050491 Unclassified 1789
237 nmdc:mga05p37_142344_c1 3300050507 Bacteria 2937
238 nmdc:mga05p37_16036_c1 3300050507 Bacteria 9017
239 nmdc:mga05p37_35179_c1 3300050507 Bacteria 6140
240 nmdc:mga05p37_39205_c1 3300050507 Bacteria 5814
241 nmdc:mga05p37_51284_c1 3300050507 Bacteria 5074
242 nmdc:mga05p37_51550_c1 3300050507 Bacteria 5060
243 nmdc:mga0qj67_63909_c1 3300050509 Unclassified 2926
244 nmdc:mga08y16_102465_c1 3300050511 Bacteria 2980
245 nmdc:mga08y16_94851_c1 3300050511 Unclassified 3108
246 nmdc:mga0n895_168610_c1 3300050512 Bacteria 2222
247 nmdc:mga0n895_44655_c1 3300050512 Unclassified 4321
248 nmdc:mga0n895_83011_c1 3300050512 Bacteria 3195
249 nmdc:mga0rr50_186325_c1 3300050513 Bacteria 1699
250 nmdc:mga0rr50_27142_c1 3300050513 Bacteria 4004
251 nmdc:mga0rr50_40275_c1 3300050513 Bacteria 3396
252 nmdc:mga08x19_164391_c1 3300050514 Bacteria 1508
253 nmdc:mga08x19_20649_c1 3300050514 Bacteria 4057
254 nmdc:mga08x19_43965_c1 3300050514 Bacteria 2851
255 nmdc:mga0a205_106170_c1 3300050515 Bacteria 2707
256 nmdc:mga0a205_37713_c2 3300050515 Bacteria 2389
257 nmdc:mga0a205_49261_c1 3300050515 Bacteria 4066
258 Ga0495619_0022103 3300053085 Bacteria 4066
259 Ga0500642_0095628 3300053130 Bacteria 1377
260 Ga0500616_0111162 3300053153 Bacteria 1323
261 Ga0501084_0106671
262 JGI25153J46596_10000822
263 Ga0065715_10117680
264 Ga0065715_10189905
265 Ga0070658_10006070
266 Ga0070670_100037496
267 Ga0068869_100024937
268 Ga0070680_100020272
269 Ga0070660_100001495
270 Ga0070689_100319220
271 Ga0070669_100034771
272 Ga0070675_100003288
273 Ga0070675_100018462
274 Ga0070675_100030386
275 Ga0070671_100137890
276 Ga0070671_100152118
277 Ga0070674_100012279
278 Ga0070674_100059323
279 Ga0070673_100016103
280 Ga0070709_10073379
281 Ga0070714_100007232
282 Ga0070714_100045470
283 Ga0070714_100320153
284 Ga0070713_100008728
285 Ga0070713_100094987
286 Ga0070713_100498618
287 Ga0070701_10012795
288 Ga0070700_100028358
289 Ga0070678_100137150
290 Ga0070662_100141984
291 Ga0070681_10000287
292 Ga0068867_100069342
293 Ga0070707_100022357
294 Ga0070707_100055477
295 Ga0070679_100008003
296 Ga0070697_100339888
297 Ga0070672_100163453
298 Ga0070672_100197997
299 Ga0070704_100005131
300 Ga0068855_100004487
301 Ga0070664_100010704
302 Ga0068857_100169708
303 Ga0068854_100197961
304 Ga0070702_100123756
305 Ga0068852_100003267
306 Ga0068864_100299338
307 Ga0068858_100119027
308 Ga0068860_100086420
309 Ga0068860_100225826
310 Ga0081455_10013289
311 Ga0070717_10240255
312 Ga0075364_10030004
313 Ga0097621_100000383
314 Ga0097621_100028876
315 Ga0097621_100066600
316 Ga0097621_100159900
317 Ga0097621_100253068
318 Ga0097621_100363951
319 Ga0068871_100000553
320 Ga0068871_100079390
321 Ga0075428_100021818
322 Ga0075430_100101588
323 Ga0075433_10004007
324 Ga0075434_100002454
325 Ga0075434_100006911
326 Ga0068865_100031214
327 Ga0075436_100023060
328 Ga0075435_100028251
329 Ga0075435_100032647
330 Ga0075435_100279803
331 Ga0099794_10004386
332 Ga0099794_10051401
333 Ga0099794_10063629
334 Ga0105240_10000077
335 Ga0111539_10212071
336 Ga0105247_10041776
337 Ga0105247_10203656
338 Ga0114129_10015855
339 Ga0114129_10017519
340 Ga0114129_10026822
341 Ga0114129_10041007
342 Ga0114129_10322264
343 Ga0105243_10030028
344 Ga0105242_10315303
345 Ga0105242_10350958
346 Ga0105248_10012377
347 Ga0105248_10038858
348 Ga0105248_10109007
349 Ga0105248_10306355
350 Ga0105238_10000821
351 Ga0105238_10003109
352 Ga0105249_10579067
353 Ga0157370_10001689
354 Ga0157369_10028657
355 Ga0157374_10008659
356 Ga0157378_10087514
357 Ga0157378_10360412
358 Ga0163162_10044902
359 Ga0163162_10347151
360 Ga0157372_10000125
361 Ga0157375_10187558
362 Ga0163163_10106295
363 Ga0157380_10140620
364 Ga0157380_10239595
365 Ga0157380_10445765
366 Ga0157379_10025966
367 Ga0157376_10002956
368 Ga0157376_10154851
369 Ga0163161_10094706
370 Ga0213875_10028998
371 Ga0213875_10041839
372 Ga0213871_10005644
373 Ga0209758_1000079
374 Ga0207682_10038996
375 Ga0207699_10028204
376 Ga0207645_10032332
377 Ga0207643_10030424
378 Ga0207707_10000650
379 Ga0207695_10001093
380 Ga0207695_10157919
381 Ga0207663_10204807
382 Ga0207660_10010179
383 Ga0207652_10002209
384 Ga0207694_10001037
385 Ga0207694_10003179
386 Ga0207650_10007177
387 Ga0207659_10024165
388 Ga0207700_10018599
389 Ga0207700_10214403
390 Ga0207664_10046169
391 Ga0207686_10023900
392 Ga0207686_10028808
393 Ga0207670_10110552
394 Ga0207669_10052165
395 Ga0207711_10018627
396 Ga0207711_10119138
397 Ga0207711_10174176
398 Ga0207689_10005280
399 Ga0207689_10078371
400 Ga0207661_10231730
401 Ga0207667_10000123
402 Ga0207651_10010793
403 Ga0207640_10037244
404 Ga0207677_10008574
405 Ga0207708_10014399
406 Ga0207641_10333321
407 Ga0207683_10077994
408 Ga0207683_10101673
409 Ga0207683_10213720
410 Ga0207698_10209560
411 Ga0209588_1002094
412 Ga0207428_10117504
413 Ga0268264_10034299
414 Ga0268264_10082012
415 Ga0265338_10005239
416 Ga0265338_10215380
417 Ga0265330_10000456
418 Ga0265332_10003636
419 Ga0265328_10000151
420 Ga0265320_10033953
421 Ga0265325_10000243
422 Ga0265325_10001378
423 Ga0265329_10030446
424 Ga0265340_10003178
425 Ga0265340_10020055
426 Ga0265339_10000118
427 Ga0265316_10009328
428 Ga0265316_10014814
429 Ga0265316_10158513
430 Ga0265313_10000369
431 Ga0265314_10000564
432 Ga0265314_10069285
433 Ga0265342_10000680
434 Ga0373926_0033024
435 Ga0373936_0036160
436 Ga0373945_0038927
437 Ga0373953_0017749
438 Ga0373943_0003095
439 Ga0373946_0088982
440 Ga0373955_0136366
441 Ga0373955_0235004
442 Ga0373961_0004009
443 Ga0373931_0000682
444 Ga0373935_0017685
445 Ga0373935_0055156
446 Ga0373947_0020796
447 Ga0373947_0022357
448 Ga0373947_0042562
449 Ga0373947_0110648
450 Ga0373937_0041206
451 Ga0373937_0047036
452 Ga0373937_0303616
453 Ga0373925_0007449
454 Ga0373925_0021194
455 Ga0436365_1779922
456 Ga0451576_0061265
457 Ga0495580_0016089
458 Ga0495608_0010712
459 Ga0495618_0139147
460 Ga0495628_0049459
461 Ga0495652_0160771
462 Ga0495587_0004620
463 Ga0495587_0087940
464 Ga0495645_0107126
465 Ga0495667_0081859
466 Ga0495667_0215404
467 Ga0495634_0024766
468 Ga0495634_0064847
469 Ga0495634_0142892
470 Ga0495599_0027762
471 Ga0495658_0060557
472 Ga0495669_0042314
473 Ga0495613_0000596
474 Ga0495613_0116589
475 Ga0495604_0057802
476 Ga0495674_0008568
477 Ga0495680_0116583
478 Ga0495684_0000091
479 Ga0495684_0185558
480 Ga0495602_0061550
481 Ga0495602_0284015
482 Ga0496100_0081326
483 Ga0496101_0106260
484 Ga0496101_0185130
485 Ga0496104_0001967
486 Ga0496104_0107911
487 Ga0496105_0014240
488 Ga0496105_0155076
489 Ga0496106_0146158
490 Ga0496107_0001825
491 Ga0496111_0027785
492 Ga0496112_0225944
493 Ga0496114_0047624
494 Ga0496115_0203207
495 Ga0501071_0274282
496 nmdc:mga00v17_104686_c1
497 nmdc:mga05p37_142344_c1
498 nmdc:mga05p37_16036_c1
499 nmdc:mga05p37_35179_c1
500 nmdc:mga05p37_39205_c1
501 nmdc:mga05p37_51284_c1
502 nmdc:mga05p37_51550_c1
503 nmdc:mga0qj67_63909_c1
504 nmdc:mga08y16_102465_c1
505 nmdc:mga08y16_94851_c1
506 nmdc:mga0n895_168610_c1
507 nmdc:mga0n895_44655_c1
508 nmdc:mga0n895_83011_c1
509 nmdc:mga0rr50_186325_c1
510 nmdc:mga0rr50_27142_c1
511 nmdc:mga0rr50_40275_c1
512 nmdc:mga08x19_164391_c1
513 nmdc:mga08x19_20649_c1
514 nmdc:mga08x19_43965_c1
515 nmdc:mga0a205_106170_c1
516 nmdc:mga0a205_37713_c2
517 nmdc:mga0a205_49261_c1
518 Ga0495619_0022103
519 Ga0500642_0095628
520 Ga0500616_0111162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01436

NHL

NHL repeat

250

277

0.99

PF17170

DUF5128

6-bladed beta-propeller

199

312

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wwf-assembly1.cif.gz_C crystal structure of the computationally designed pizza2-sr protein 0.8828 132 210
5chb-assembly1.cif.gz_C crystal structure of nvpizza2-s16h58 coordinating a cdcl2 nanocrystal 0.8523 129 219
4zcn-assembly1.cif.gz_A crystal structure of nvpizza2-s16s58 0.8357 129 219
5chb-assembly1.cif.gz_C crystal structure of nvpizza2-s16h58 coordinating a cdcl2 nanocrystal 0.8343 129 219
3ww8-assembly1.cif.gz_B crystal structure of the computationally designed pizza3 protein 0.8203 132 281
ID Description Score Start End Superfamily
af_B7YZK8_1340_1431_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9745 130 217 2.40.10.500
af_D3ZVM4_770_855_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9661 130 209 2.40.10.500
af_Q03601_890_974_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9633 130 209 2.40.10.500
af_Q03601_692_793_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9484 130 217 2.40.10.500
af_O70277_468_658_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9204 130 326 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A2V8CH44-F1-model_v4 6-bladed beta-propeller 0.9864 137 220 GO:0005576
AF-A0A7S0VR10-F1-model_v4 Peptidylamidoglycolate lyase 0.9709 130 220 GO:0000209
GO:0043161
GO:0061630
AF-A0A3N5MPA6-F1-model_v4 6-bladed beta-propeller 0.9649 130 220 GO:0016020
AF-A0A2V9INS2-F1-model_v4 6-bladed beta-propeller 0.9643 233 328
AF-A0A2V9VAT9-F1-model_v4 6-bladed beta-propeller 0.9595 207 328

Map