F368121

General Info

Members Datasets Scaffolds Average Seq Length
258 155 516 312

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10008330|Ga0207695_1000833010
Length 355
Sequence VVVTCAAWCFSTEFSARRAYCNVRWVNSWAEEVTLIDCEDFMTILTRLAQWKEHGTISPEQHAVLAGLSRGEPFSVFLELNIFLYAGILVFIAGLGWTVSTWSQQLGDVLVLTILFAILTACFWYCFSRGPAWSAAEIPSPSLVFDYVLYLGSLTWSVELAYVENRFHLLSGQWDLYLLATAGLFFFLAYRFDNRFVLSLALSSLAGWFGLTISHGPSHQDAAYRQYAILYSLTAGAAGFILEHCGLKRHFFGTYLNIAANVLFWALLSGVFDRQGYAAWFFALLAACGASLAWGLPRRQFSFVAYAAVYGYVGVSSVLVRDIHGDTAILSYFVITGVAMLIMLGLIARRFGREA

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 5.43
Rhizosphere 93.41
Stem 0
Stem Tuber 0
Unclassified 18.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10008330 3300025913 Bacteria 12990
2 Ga0070658_10017701 3300005327 Bacteria 5700
3 Ga0070683_100063749 3300005329 Bacteria 3429
4 Ga0070683_100589364 3300005329 Unclassified 1064
5 Ga0070690_100181833 3300005330 Bacteria 1453
6 Ga0070666_10170939 3300005335 Bacteria 1522
7 Ga0070680_100022856 3300005336 Unclassified 4982
8 Ga0068868_100090582 3300005338 Bacteria 2463
9 Ga0068868_100090713 3300005338 Bacteria 2462
10 Ga0070660_100040042 3300005339 Bacteria 3564
11 Ga0070661_100019546 3300005344 Unclassified 4828
12 Ga0070673_100029602 3300005364 Unclassified 4086
13 Ga0070659_100058826 3300005366 Bacteria 3034
14 Ga0070659_100137800 3300005366 Bacteria 1985
15 Ga0070667_100051762 3300005367 Unclassified 3463
16 Ga0070667_100212714 3300005367 Bacteria 1719
17 Ga0070709_10043649 3300005434 Bacteria 2773
18 Ga0070713_100000406 3300005436 Bacteria 27695
19 Ga0070713_100150788 3300005436 Bacteria 2068
20 Ga0070710_10108342 3300005437 Bacteria 1665
21 Ga0070711_100000156 3300005439 Bacteria 36746
22 Ga0070711_100007059 3300005439 Bacteria 6814
23 Ga0070711_100017934 3300005439 Unclassified 4512
24 Ga0070708_100185404 3300005445 Bacteria 1946
25 Ga0070681_10026326 3300005458 Bacteria 5846
26 Ga0070679_100000802 3300005530 Bacteria 27244
27 Ga0070679_100044056 3300005530 Unclassified 4445
28 Ga0070679_100072469 3300005530 Bacteria 3436
29 Ga0070684_100301640 3300005535 Bacteria 1470
30 Ga0068853_100110500 3300005539 Unclassified 2442
31 Ga0070693_100046139 3300005547 Bacteria 2473
32 Ga0070665_100185110 3300005548 Bacteria 2083
33 Ga0068855_100022098 3300005563 Bacteria 7625
34 Ga0068855_100485227 3300005563 Bacteria 1345
35 Ga0070664_100175168 3300005564 Bacteria 1904
36 Ga0068857_100072458 3300005577 Unclassified 3070
37 Ga0068854_100104341 3300005578 Bacteria 2129
38 Ga0068856_100002526 3300005614 Bacteria 18853
39 Ga0068856_100236143 3300005614 Bacteria 1844
40 Ga0068852_100177785 3300005616 Bacteria 1999
41 Ga0068864_100005996 3300005618 Bacteria 9973
42 Ga0068864_100198769 3300005618 Bacteria 1841
43 Ga0068866_10010520 3300005718 Bacteria 3971
44 Ga0068851_10029184 3300005834 Unclassified 2729
45 Ga0068863_100031965 3300005841 Bacteria 5019
46 Ga0068863_100139126 3300005841 Bacteria 2320
47 Ga0068863_100284438 3300005841 Bacteria 1603
48 Ga0068858_100003023 3300005842 Bacteria 16875
49 Ga0068858_100171236 3300005842 Bacteria 2047
50 Ga0068858_100178929 3300005842 Bacteria 2002
51 Ga0068858_100191492 3300005842 Unclassified 1932
52 Ga0068860_100020905 3300005843 Bacteria 6341
53 Ga0070717_10028046 3300006028 Bacteria 4503
54 Ga0070716_100000185 3300006173 Bacteria 24458
55 Ga0070712_100000364 3300006175 Bacteria 25668
56 Ga0070712_100001881 3300006175 Bacteria 12802
57 Ga0097621_100013200 3300006237 Bacteria 6146
58 Ga0097621_100016627 3300006237 Bacteria 5566
59 Ga0097621_100071462 3300006237 Unclassified 2868
60 Ga0068871_100027513 3300006358 Unclassified 4449
61 Ga0068871_100036182 3300006358 Bacteria 3929
62 Ga0068871_100193119 3300006358 Bacteria 1755
63 Ga0068871_100238040 3300006358 Unclassified 1582
64 Ga0068865_100025758 3300006881 Bacteria 3874
65 Ga0105240_10000001 3300009093 Bacteria 2887840
66 Ga0105240_10000903 3300009093 Bacteria 53014
67 Ga0105240_10028476 3300009093 Bacteria 7297
68 Ga0105240_10187908 3300009093 Bacteria 2432
69 Ga0105240_10195835 3300009093 Bacteria 2373
70 Ga0105245_10010155 3300009098 Bacteria 8198
71 Ga0105245_10074908 3300009098 Unclassified 3081
72 Ga0105245_10129858 3300009098 Unclassified 2362
73 Ga0105245_10223358 3300009098 Bacteria 1819
74 Ga0105245_10263879 3300009098 Unclassified 1677
75 Ga0105247_10019600 3300009101 Bacteria 4061
76 Ga0105241_10065747 3300009174 Bacteria 2803
77 Ga0105242_10022977 3300009176 Unclassified 4912
78 Ga0105242_10112032 3300009176 Bacteria 2328
79 Ga0105242_10218670 3300009176 Unclassified 1701
80 Ga0105248_10029759 3300009177 Bacteria 6094
81 Ga0105248_10062091 3300009177 Bacteria 4196
82 Ga0105248_10233685 3300009177 Bacteria 2070
83 Ga0105248_10718633 3300009177 Unclassified 1127
84 Ga0105237_10003162 3300009545 Bacteria 19801
85 Ga0105237_10047506 3300009545 Unclassified 4315
86 Ga0105237_10098628 3300009545 Bacteria 2913
87 Ga0105237_10251200 3300009545 Bacteria 1770
88 Ga0105237_10507845 3300009545 Unclassified 1212
89 Ga0105238_10015893 3300009551 Bacteria 7615
90 Ga0105238_10018101 3300009551 Bacteria 7163
91 Ga0105238_10086655 3300009551 Bacteria 3119
92 Ga0105238_10229144 3300009551 Bacteria 1835
93 Ga0105249_10104183 3300009553 Bacteria 2673
94 Ga0105239_10016001 3300010375 Bacteria 8302
95 Ga0105239_10068053 3300010375 Bacteria 3913
96 Ga0105239_10160602 3300010375 Bacteria 2510
97 Ga0105246_10001137 3300011119 Bacteria 15431
98 Ga0105246_10027508 3300011119 Bacteria 3727
99 Ga0157373_10206673 3300013100 Bacteria 1384
100 Ga0157370_10161375 3300013104 Bacteria 2085
101 Ga0157369_10192965 3300013105 Bacteria 2139
102 Ga0157374_10000974 3300013296 Bacteria 24812
103 Ga0157374_10035208 3300013296 Bacteria 4579
104 Ga0157374_10215640 3300013296 Unclassified 1883
105 Ga0157374_10348490 3300013296 Unclassified 1471
106 Ga0157374_10488952 3300013296 Bacteria 1234
107 Ga0157378_10202699 3300013297 Bacteria 1877
108 Ga0157378_10333956 3300013297 Bacteria 1476
109 Ga0157378_10335147 3300013297 Bacteria 1473
110 Ga0163162_10155981 3300013306 Unclassified 2403
111 Ga0157372_10000810 3300013307 Bacteria 33907
112 Ga0157372_10003400 3300013307 Bacteria 17173
113 Ga0157372_10033801 3300013307 Bacteria 5619
114 Ga0157372_10042202 3300013307 Bacteria 5044
115 Ga0157372_10058191 3300013307 Bacteria 4320
116 Ga0157375_10000742 3300013308 Bacteria 28635
117 Ga0157375_10005456 3300013308 Bacteria 11059
118 Ga0157375_10107594 3300013308 Bacteria 2882
119 Ga0163163_10006652 3300014325 Bacteria 10127
120 Ga0163163_10064579 3300014325 Bacteria 3632
121 Ga0163163_10104652 3300014325 Bacteria 2856
122 Ga0163163_10105945 3300014325 Bacteria 2837
123 Ga0163163_10190741 3300014325 Bacteria 2098
124 Ga0163163_10440567 3300014325 Unclassified 1362
125 Ga0182008_10010213 3300014497 Bacteria 5031
126 Ga0182006_1103724 3300015261 Unclassified 1006
127 Ga0182007_10011201 3300015262 Bacteria 3498
128 Ga0209233_1000812 3300025261 Bacteria 13923
129 Ga0207697_10096995 3300025315 Bacteria 1254
130 Ga0207656_10035373 3300025321 Bacteria 2091
131 Ga0207642_10006551 3300025899 Bacteria 3880
132 Ga0207680_10102747 3300025903 Unclassified 1839
133 Ga0207647_10023367 3300025904 Unclassified 4088
134 Ga0207699_10015723 3300025906 Bacteria 3939
135 Ga0207699_10023106 3300025906 Bacteria 3380
136 Ga0207705_10017982 3300025909 Bacteria 5055
137 Ga0207695_10000001 3300025913 Bacteria 2888630
138 Ga0207695_10032298 3300025913 Bacteria 5730
139 Ga0207695_10059670 3300025913 Bacteria 3954
140 Ga0207695_10081320 3300025913 Unclassified 3279
141 Ga0207695_10126934 3300025913 Unclassified 2512
142 Ga0207695_10316173 3300025913 Unclassified 1451
143 Ga0207671_10056467 3300025914 Bacteria 2909
144 Ga0207671_10228354 3300025914 Bacteria 1460
145 Ga0207693_10000010 3300025915 Bacteria 162031
146 Ga0207693_10004491 3300025915 Bacteria 11802
147 Ga0207663_10013552 3300025916 Bacteria 4434
148 Ga0207663_10071872 3300025916 Bacteria 2234
149 Ga0207660_10053998 3300025917 Bacteria 2866
150 Ga0207657_10003218 3300025919 Bacteria 17487
151 Ga0207652_10075330 3300025921 Bacteria 2941
152 Ga0207652_10089884 3300025921 Bacteria 2697
153 Ga0207652_10105388 3300025921 Bacteria 2495
154 Ga0207694_10017432 3300025924 Bacteria 5429
155 Ga0207694_10160008 3300025924 Bacteria 1818
156 Ga0207659_10261959 3300025926 Bacteria 1407
157 Ga0207687_10002081 3300025927 Bacteria 13680
158 Ga0207687_10015203 3300025927 Bacteria 5044
159 Ga0207687_10282444 3300025927 Bacteria 1331
160 Ga0207700_10010542 3300025928 Bacteria 5840
161 Ga0207700_10098004 3300025928 Bacteria 2331
162 Ga0207700_10428056 3300025928 Unclassified 1164
163 Ga0207664_10035467 3300025929 Bacteria 3849
164 Ga0207664_10217612 3300025929 Unclassified 1655
165 Ga0207690_10236077 3300025932 Bacteria 1406
166 Ga0207686_10015317 3300025934 Unclassified 4285
167 Ga0207686_10018681 3300025934 Unclassified 3927
168 Ga0207704_10165003 3300025938 Unclassified 1581
169 Ga0207665_10005675 3300025939 Bacteria 8313
170 Ga0207711_10000770 3300025941 Bacteria 31501
171 Ga0207711_10007079 3300025941 Bacteria 9400
172 Ga0207711_10171963 3300025941 Bacteria 1966
173 Ga0207711_10207885 3300025941 Bacteria 1788
174 Ga0207661_10432910 3300025944 Bacteria 1196
175 Ga0207679_10004644 3300025945 Bacteria 8548
176 Ga0207667_10024076 3300025949 Bacteria 6695
177 Ga0207667_10080991 3300025949 Bacteria 3363
178 Ga0207651_10029691 3300025960 Unclassified 3469
179 Ga0207712_10024684 3300025961 Bacteria 3985
180 Ga0207677_10074510 3300026023 Bacteria 2409
181 Ga0207677_10119979 3300026023 Bacteria 1976
182 Ga0207703_10042550 3300026035 Unclassified 3643
183 Ga0207703_10043396 3300026035 Unclassified 3609
184 Ga0207703_10105254 3300026035 Bacteria 2398
185 Ga0207703_10151257 3300026035 Bacteria 2024
186 Ga0207639_10048135 3300026041 Bacteria 3225
187 Ga0207702_10115849 3300026078 Unclassified 2390
188 Ga0207641_10023901 3300026088 Bacteria 5038
189 Ga0207641_10119707 3300026088 Bacteria 2347
190 Ga0207648_10074352 3300026089 Bacteria 2961
191 Ga0207676_10013428 3300026095 Bacteria 5883
192 Ga0207676_10182858 3300026095 Bacteria 1837
193 Ga0268266_10122138 3300028379 Bacteria 2319
194 Ga0268266_10199356 3300028379 Bacteria 1831
195 Ga0268264_10019354 3300028381 Bacteria 5564
196 Ga0265338_10019749 3300028800 Bacteria 7125
197 Ga0265325_10000615 3300031241 Bacteria 25980
198 Ga0265325_10045965 3300031241 Unclassified 2266
199 Ga0265325_10047914 3300031241 Unclassified 2211
200 Ga0265316_10034772 3300031344 Plasmid 4091
201 Ga0373945_0026774 3300035116 Bacteria 2010
202 Ga0373935_0111523 3300035692 Bacteria 1816
203 Ga0373927_0000306 3300035695 Bacteria 38554
204 Ga0373927_0006814 3300035695 Bacteria 7773
205 Ga0373933_0056131 3300035724 Bacteria 2363
206 Ga0373947_0000564 3300035725 Bacteria 21588
207 Ga0373937_0011713 3300036401 Bacteria 7692
208 Ga0373937_0023351 3300036401 Bacteria 5568
209 Ga0373937_0142143 3300036401 Bacteria 2246
210 Ga0373925_0000062 3300037068 Bacteria 114902
211 Ga0436363_0368673 3300039450 Unclassified 3152
212 Ga0466963_0037081 3300044694 Bacteria 3182
213 Ga0466967_0023147 3300045976 Bacteria 5086
214 Ga0495592_0052460 3300046454 Bacteria 3028
215 Ga0495651_0020151 3300046462 Bacteria 5176
216 Ga0495580_0035344 3300046472 Bacteria 3594
217 Ga0495582_0000655 3300046473 Bacteria 19068
218 Ga0495664_0008532 3300046477 Bacteria 5713
219 Ga0495594_0001359 3300046499 Bacteria 12682
220 Ga0495606_0044289 3300046507 Bacteria 2961
221 Ga0495618_0093650 3300046514 Bacteria 1921
222 Ga0495628_0065155 3300046516 Bacteria 2851
223 Ga0495666_0003323 3300046526 Bacteria 8118
224 Ga0495640_0006413 3300046533 Bacteria 9301
225 Ga0495586_0187303 3300046535 Bacteria 1172
226 Ga0495587_0002050 3300046536 Bacteria 13455
227 Ga0495633_0087709 3300046558 Bacteria 1447
228 Ga0495667_0012001 3300046559 Bacteria 5869
229 Ga0495667_0122768 3300046559 Unclassified 1677
230 Ga0495635_0010262 3300046663 Bacteria 6549
231 Ga0495599_0038132 3300046678 Bacteria 3019
232 Ga0495646_0004782 3300046680 Bacteria 8550
233 Ga0495613_0012702 3300046689 Bacteria 6262
234 Ga0495624_0013391 3300046690 Bacteria 5593
235 Ga0495600_0070809 3300046809 Bacteria 2279
236 Ga0495600_0177189 3300046809 Bacteria 1374
237 Ga0495581_0004082 3300047315 Bacteria 8408
238 Ga0495604_0078975 3300047317 Bacteria 2468
239 Ga0495676_0006532 3300047321 Bacteria 10745
240 Ga0495675_0010653 3300047444 Bacteria 5750
241 Ga0495684_0354421 3300047471 Unclassified 1041
242 Ga0495602_0015857 3300048088 Bacteria 7590
243 Ga0495614_0000212 3300048089 Bacteria 22493
244 Ga0496100_0098918 3300048903 Bacteria 2006
245 Ga0496102_0071823 3300048905 Bacteria 3178
246 Ga0496102_0139084 3300048905 Bacteria 2276
247 Ga0496102_0494347 3300048905 Unclassified 1145
248 Ga0496103_0016972 3300048906 Bacteria 4350
249 Ga0496104_0087060 3300048907 Bacteria 2983
250 Ga0496104_0180632 3300048907 Bacteria 2020
251 Ga0496106_0176857 3300048909 Bacteria 1693
252 Ga0496108_0026244 3300048911 Unclassified 4804
253 Ga0496110_0327903 3300048913 Bacteria 1394
254 Ga0496111_0185318 3300048914 Bacteria 1547
255 Ga0496112_0192189 3300048915 Bacteria 2002
256 Ga0496113_0029924 3300048916 Unclassified 3937
257 Ga0496115_0018411 3300048918 Bacteria 5362
258 Ga0500568_0001528 3300053139 Bacteria 14729
259 Ga0207695_10008330
260 Ga0070658_10017701
261 Ga0070683_100063749
262 Ga0070683_100589364
263 Ga0070690_100181833
264 Ga0070666_10170939
265 Ga0070680_100022856
266 Ga0068868_100090582
267 Ga0068868_100090713
268 Ga0070660_100040042
269 Ga0070661_100019546
270 Ga0070673_100029602
271 Ga0070659_100058826
272 Ga0070659_100137800
273 Ga0070667_100051762
274 Ga0070667_100212714
275 Ga0070709_10043649
276 Ga0070713_100000406
277 Ga0070713_100150788
278 Ga0070710_10108342
279 Ga0070711_100000156
280 Ga0070711_100007059
281 Ga0070711_100017934
282 Ga0070708_100185404
283 Ga0070681_10026326
284 Ga0070679_100000802
285 Ga0070679_100044056
286 Ga0070679_100072469
287 Ga0070684_100301640
288 Ga0068853_100110500
289 Ga0070693_100046139
290 Ga0070665_100185110
291 Ga0068855_100022098
292 Ga0068855_100485227
293 Ga0070664_100175168
294 Ga0068857_100072458
295 Ga0068854_100104341
296 Ga0068856_100002526
297 Ga0068856_100236143
298 Ga0068852_100177785
299 Ga0068864_100005996
300 Ga0068864_100198769
301 Ga0068866_10010520
302 Ga0068851_10029184
303 Ga0068863_100031965
304 Ga0068863_100139126
305 Ga0068863_100284438
306 Ga0068858_100003023
307 Ga0068858_100171236
308 Ga0068858_100178929
309 Ga0068858_100191492
310 Ga0068860_100020905
311 Ga0070717_10028046
312 Ga0070716_100000185
313 Ga0070712_100000364
314 Ga0070712_100001881
315 Ga0097621_100013200
316 Ga0097621_100016627
317 Ga0097621_100071462
318 Ga0068871_100027513
319 Ga0068871_100036182
320 Ga0068871_100193119
321 Ga0068871_100238040
322 Ga0068865_100025758
323 Ga0105240_10000001
324 Ga0105240_10000903
325 Ga0105240_10028476
326 Ga0105240_10187908
327 Ga0105240_10195835
328 Ga0105245_10010155
329 Ga0105245_10074908
330 Ga0105245_10129858
331 Ga0105245_10223358
332 Ga0105245_10263879
333 Ga0105247_10019600
334 Ga0105241_10065747
335 Ga0105242_10022977
336 Ga0105242_10112032
337 Ga0105242_10218670
338 Ga0105248_10029759
339 Ga0105248_10062091
340 Ga0105248_10233685
341 Ga0105248_10718633
342 Ga0105237_10003162
343 Ga0105237_10047506
344 Ga0105237_10098628
345 Ga0105237_10251200
346 Ga0105237_10507845
347 Ga0105238_10015893
348 Ga0105238_10018101
349 Ga0105238_10086655
350 Ga0105238_10229144
351 Ga0105249_10104183
352 Ga0105239_10016001
353 Ga0105239_10068053
354 Ga0105239_10160602
355 Ga0105246_10001137
356 Ga0105246_10027508
357 Ga0157373_10206673
358 Ga0157370_10161375
359 Ga0157369_10192965
360 Ga0157374_10000974
361 Ga0157374_10035208
362 Ga0157374_10215640
363 Ga0157374_10348490
364 Ga0157374_10488952
365 Ga0157378_10202699
366 Ga0157378_10333956
367 Ga0157378_10335147
368 Ga0163162_10155981
369 Ga0157372_10000810
370 Ga0157372_10003400
371 Ga0157372_10033801
372 Ga0157372_10042202
373 Ga0157372_10058191
374 Ga0157375_10000742
375 Ga0157375_10005456
376 Ga0157375_10107594
377 Ga0163163_10006652
378 Ga0163163_10064579
379 Ga0163163_10104652
380 Ga0163163_10105945
381 Ga0163163_10190741
382 Ga0163163_10440567
383 Ga0182008_10010213
384 Ga0182006_1103724
385 Ga0182007_10011201
386 Ga0209233_1000812
387 Ga0207697_10096995
388 Ga0207656_10035373
389 Ga0207642_10006551
390 Ga0207680_10102747
391 Ga0207647_10023367
392 Ga0207699_10015723
393 Ga0207699_10023106
394 Ga0207705_10017982
395 Ga0207695_10000001
396 Ga0207695_10032298
397 Ga0207695_10059670
398 Ga0207695_10081320
399 Ga0207695_10126934
400 Ga0207695_10316173
401 Ga0207671_10056467
402 Ga0207671_10228354
403 Ga0207693_10000010
404 Ga0207693_10004491
405 Ga0207663_10013552
406 Ga0207663_10071872
407 Ga0207660_10053998
408 Ga0207657_10003218
409 Ga0207652_10075330
410 Ga0207652_10089884
411 Ga0207652_10105388
412 Ga0207694_10017432
413 Ga0207694_10160008
414 Ga0207659_10261959
415 Ga0207687_10002081
416 Ga0207687_10015203
417 Ga0207687_10282444
418 Ga0207700_10010542
419 Ga0207700_10098004
420 Ga0207700_10428056
421 Ga0207664_10035467
422 Ga0207664_10217612
423 Ga0207690_10236077
424 Ga0207686_10015317
425 Ga0207686_10018681
426 Ga0207704_10165003
427 Ga0207665_10005675
428 Ga0207711_10000770
429 Ga0207711_10007079
430 Ga0207711_10171963
431 Ga0207711_10207885
432 Ga0207661_10432910
433 Ga0207679_10004644
434 Ga0207667_10024076
435 Ga0207667_10080991
436 Ga0207651_10029691
437 Ga0207712_10024684
438 Ga0207677_10074510
439 Ga0207677_10119979
440 Ga0207703_10042550
441 Ga0207703_10043396
442 Ga0207703_10105254
443 Ga0207703_10151257
444 Ga0207639_10048135
445 Ga0207702_10115849
446 Ga0207641_10023901
447 Ga0207641_10119707
448 Ga0207648_10074352
449 Ga0207676_10013428
450 Ga0207676_10182858
451 Ga0268266_10122138
452 Ga0268266_10199356
453 Ga0268264_10019354
454 Ga0265338_10019749
455 Ga0265325_10000615
456 Ga0265325_10045965
457 Ga0265325_10047914
458 Ga0265316_10034772
459 Ga0373945_0026774
460 Ga0373935_0111523
461 Ga0373927_0000306
462 Ga0373927_0006814
463 Ga0373933_0056131
464 Ga0373947_0000564
465 Ga0373937_0011713
466 Ga0373937_0023351
467 Ga0373937_0142143
468 Ga0373925_0000062
469 Ga0436363_0368673
470 Ga0466963_0037081
471 Ga0466967_0023147
472 Ga0495592_0052460
473 Ga0495651_0020151
474 Ga0495580_0035344
475 Ga0495582_0000655
476 Ga0495664_0008532
477 Ga0495594_0001359
478 Ga0495606_0044289
479 Ga0495618_0093650
480 Ga0495628_0065155
481 Ga0495666_0003323
482 Ga0495640_0006413
483 Ga0495586_0187303
484 Ga0495587_0002050
485 Ga0495633_0087709
486 Ga0495667_0012001
487 Ga0495667_0122768
488 Ga0495635_0010262
489 Ga0495599_0038132
490 Ga0495646_0004782
491 Ga0495613_0012702
492 Ga0495624_0013391
493 Ga0495600_0070809
494 Ga0495600_0177189
495 Ga0495581_0004082
496 Ga0495604_0078975
497 Ga0495676_0006532
498 Ga0495675_0010653
499 Ga0495684_0354421
500 Ga0495602_0015857
501 Ga0495614_0000212
502 Ga0496100_0098918
503 Ga0496102_0071823
504 Ga0496102_0139084
505 Ga0496102_0494347
506 Ga0496103_0016972
507 Ga0496104_0087060
508 Ga0496104_0180632
509 Ga0496106_0176857
510 Ga0496108_0026244
511 Ga0496110_0327903
512 Ga0496111_0185318
513 Ga0496112_0192189
514 Ga0496113_0029924
515 Ga0496115_0018411
516 Ga0500568_0001528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09925

DUF2157

Predicted membrane protein (DUF2157)

49

198

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sgx-assembly1.cif.gz_C structure of protomer 1 of the esx-3 core complex 0.5613 22 306
6umm-assembly1.cif.gz_G a complete structure of the esx-3 translocon complex 0.5576 40 307
6sgx-assembly1.cif.gz_C structure of protomer 1 of the esx-3 core complex 0.5187 22 306
6umm-assembly1.cif.gz_H a complete structure of the esx-3 translocon complex 0.5133 22 307
7b9s-assembly1.cif.gz_3 structure of the mycobacterial esx-5 type vii secretion system hexameric pore complex 0.4927 16 307
ID Description Score Start End Superfamily
af_P09483_251_364_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.4453 48 122 1.20.58.390
af_I1KTF7_309_469_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4319 78 274 1.25.40.10
af_Q965Q2_544_743_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4274 68 300 1.25.40.10
af_I1KTF7_309_469_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4195 78 274 1.25.40.10
af_Q8T0B1_4_125_1.20.190.10 Mainly Alpha;Up-down Bundle;Delta-Endotoxin; domain 1;Pesticidal crystal protein, N-terminal domain 0.4124 43 148 1.20.190.10
ID Description Score Start End GO Terms
AF-A0A2V7VSR6-F1-model_v4 Uncharacterized protein 0.8977 69 170 GO:0016020
AF-A0A357YBV3-F1-model_v4 DUF2157 domain-containing protein 0.8784 40 314 GO:0016020
AF-A0A2V7VSR6-F1-model_v4 Uncharacterized protein 0.874 69 170 GO:0016020
AF-A0A357YBV3-F1-model_v4 DUF2157 domain-containing protein 0.8667 40 314 GO:0016020
AF-A0A348W4Q0-F1-model_v4 deleted 0.8618 16 230

Map