F367878

General Info

Members Datasets Scaffolds Average Seq Length
258 153 516 168

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10262457|Ga0070709_102624572
Length 170
Sequence MPMHGPYELYLVRHGLAETRGESWPDDTKRPLSEEGMARLRKQARGLSRLGVVVEVMLTSPLVRTRQTAEIVAAAFDPRPHIVNVESLAPGGSFAAVMADLEKHGKKARIALVGHEPGIGELAARLIGTRHPIAFKKGAVARIDLDTLSANAPGELRWFLTPRVLRSIKK

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.16
Rhizosphere 97.67
Stem 0
Stem Tuber 0
Unclassified 23.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10262457 3300005434 Bacteria 1248
2 Ga0065715_10189627 3300005293 Bacteria 1423
3 Ga0070658_10125994 3300005327 Bacteria 2132
4 Ga0070670_100244124 3300005331 Bacteria 1564
5 Ga0070670_100329078 3300005331 Bacteria 1340
6 Ga0068869_100270991 3300005334 Bacteria 1362
7 Ga0068869_101081333 3300005334 Unclassified 701
8 Ga0070680_100060495 3300005336 Bacteria 3099
9 Ga0068868_100126667 3300005338 Unclassified 2087
10 Ga0070660_100002307 3300005339 Bacteria 13106
11 Ga0070687_100201418 3300005343 Bacteria 1206
12 Ga0070661_101183857 3300005344 Unclassified 639
13 Ga0070669_100005999 3300005353 Bacteria 8764
14 Ga0070675_100258253 3300005354 Bacteria 1526
15 Ga0070675_100860598 3300005354 Bacteria 830
16 Ga0070671_100063375 3300005355 Bacteria 3078
17 Ga0070674_100112419 3300005356 Bacteria 2002
18 Ga0070673_100080446 3300005364 Bacteria 2640
19 Ga0070688_100185820 3300005365 Bacteria 1444
20 Ga0070688_100331297 3300005365 Unclassified 1109
21 Ga0070659_100095560 3300005366 Bacteria 2387
22 Ga0070659_100708082 3300005366 Unclassified 871
23 Ga0070667_100014018 3300005367 Bacteria 6626
24 Ga0070710_10161420 3300005437 Bacteria 1390
25 Ga0070711_100156153 3300005439 Unclassified 1725
26 Ga0070705_101156002 3300005440 Unclassified 636
27 Ga0070700_100051603 3300005441 Bacteria 2561
28 Ga0070708_100727933 3300005445 Bacteria 933
29 Ga0070678_100090032 3300005456 Bacteria 2350
30 Ga0070678_100806305 3300005456 Bacteria 853
31 Ga0070662_100461370 3300005457 Bacteria 1056
32 Ga0070681_10029872 3300005458 Bacteria 5470
33 Ga0070681_10059584 3300005458 Bacteria 3798
34 Ga0070681_10289868 3300005458 Unclassified 1547
35 Ga0070681_10418846 3300005458 Bacteria 1251
36 Ga0068867_100097216 3300005459 Bacteria 2243
37 Ga0068867_100381962 3300005459 Unclassified 1183
38 Ga0070707_101674709 3300005468 Bacteria 603
39 Ga0070699_100180666 3300005518 Unclassified 1872
40 Ga0070699_100662472 3300005518 Bacteria 953
41 Ga0070684_100707590 3300005535 Bacteria 939
42 Ga0070697_100186388 3300005536 Bacteria 1760
43 Ga0070697_100187418 3300005536 Bacteria 1755
44 Ga0068853_101926230 3300005539 Bacteria 573
45 Ga0070672_100078985 3300005543 Bacteria 2633
46 Ga0070695_100183362 3300005545 Bacteria 1485
47 Ga0070696_100213861 3300005546 Bacteria 1444
48 Ga0070693_100537512 3300005547 Bacteria 835
49 Ga0068855_100038105 3300005563 Bacteria 5713
50 Ga0068855_100253194 3300005563 Bacteria 1964
51 Ga0068856_100430073 3300005614 Bacteria 1340
52 Ga0068859_100302163 3300005617 Bacteria 1694
53 Ga0068859_100485640 3300005617 Unclassified 1331
54 Ga0068859_100559507 3300005617 Bacteria 1238
55 Ga0068864_100965116 3300005618 Bacteria 844
56 Ga0068866_10180956 3300005718 Bacteria 1245
57 Ga0068861_100173282 3300005719 Unclassified 1790
58 Ga0068861_101156401 3300005719 Bacteria 746
59 Ga0068863_100008012 3300005841 Bacteria 10322
60 Ga0068863_100237113 3300005841 Bacteria 1761
61 Ga0068863_100734174 3300005841 Bacteria 983
62 Ga0068863_100936795 3300005841 Bacteria 867
63 Ga0068858_100238010 3300005842 Bacteria 1727
64 Ga0068858_101023713 3300005842 Bacteria 810
65 Ga0068860_100027062 3300005843 Bacteria 5525
66 Ga0068860_100236758 3300005843 Bacteria 1775
67 Ga0068860_100631479 3300005843 Bacteria 1078
68 Ga0068860_101040285 3300005843 Unclassified 837
69 Ga0068862_100047227 3300005844 Bacteria 3674
70 Ga0068862_100146039 3300005844 Bacteria 2102
71 Ga0068862_102118257 3300005844 Unclassified 574
72 Ga0081540_1174815 3300005983 Bacteria 812
73 Ga0070717_10093742 3300006028 Unclassified 2539
74 Ga0070716_100092543 3300006173 Unclassified 1833
75 Ga0097621_100004737 3300006237 Bacteria 9508
76 Ga0097621_100014127 3300006237 Bacteria 5970
77 Ga0097621_100165284 3300006237 Bacteria 1905
78 Ga0097621_101138479 3300006237 Bacteria 734
79 Ga0068871_100002673 3300006358 Bacteria 12167
80 Ga0068871_100035875 3300006358 Bacteria 3944
81 Ga0068871_100084368 3300006358 Bacteria 2636
82 Ga0075431_101229655 3300006847 Bacteria 711
83 Ga0075433_10092115 3300006852 Bacteria 2680
84 Ga0075433_10382624 3300006852 Bacteria 1242
85 Ga0075434_100116584 3300006871 Bacteria 2684
86 Ga0068865_100018941 3300006881 Bacteria 4450
87 Ga0075436_100061931 3300006914 Bacteria 2586
88 Ga0097620_100302142 3300006931 Bacteria 1694
89 Ga0097620_100485620 3300006931 Unclassified 1331
90 Ga0097620_100559483 3300006931 Bacteria 1238
91 Ga0075435_100033967 3300007076 Bacteria 4037
92 Ga0075435_100086509 3300007076 Unclassified 2581
93 Ga0075435_100196105 3300007076 Unclassified 1710
94 Ga0075435_100639601 3300007076 Unclassified 923
95 Ga0105240_10053948 3300009093 Bacteria 5041
96 Ga0105240_10094749 3300009093 Bacteria 3641
97 Ga0105240_10345611 3300009093 Bacteria 1689
98 Ga0105240_12174698 3300009093 Bacteria 575
99 Ga0111539_10007717 3300009094 Bacteria 13745
100 Ga0111539_10038271 3300009094 Bacteria 5786
101 Ga0111539_10261010 3300009094 Bacteria 2016
102 Ga0111539_10590810 3300009094 Unclassified 1293
103 Ga0105245_10669323 3300009098 Bacteria 1069
104 Ga0105245_11928302 3300009098 Bacteria 644
105 Ga0114129_10001017 3300009147 Bacteria 36585
106 Ga0114129_10001344 3300009147 Bacteria 32950
107 Ga0114129_10008550 3300009147 Bacteria 14592
108 Ga0114129_10189982 3300009147 Bacteria 2790
109 Ga0105243_10419513 3300009148 Bacteria 1248
110 Ga0105243_11569103 3300009148 Unclassified 684
111 Ga0105242_10005258 3300009176 Bacteria 9992
112 Ga0105248_10016697 3300009177 Bacteria 8081
113 Ga0105248_10132042 3300009177 Bacteria 2817
114 Ga0105248_10156619 3300009177 Bacteria 2571
115 Ga0105248_10232442 3300009177 Bacteria 2075
116 Ga0105248_10945389 3300009177 Bacteria 973
117 Ga0105248_11273461 3300009177 Bacteria 832
118 Ga0105238_10351472 3300009551 Bacteria 1463
119 Ga0105249_11801591 3300009553 Bacteria 685
120 Ga0105249_12281734 3300009553 Unclassified 614
121 Ga0105246_10154402 3300011119 Bacteria 1742
122 Ga0157369_10119487 3300013105 Unclassified 2797
123 Ga0157372_10542457 3300013307 Bacteria 1356
124 Ga0157375_10655377 3300013308 Unclassified 1206
125 Ga0157375_11776909 3300013308 Unclassified 731
126 Ga0157375_11920593 3300013308 Bacteria 703
127 Ga0157380_10082553 3300014326 Bacteria 2631
128 Ga0157380_10296274 3300014326 Bacteria 1488
129 Ga0157377_10282845 3300014745 Bacteria 1088
130 Ga0157379_10041656 3300014968 Bacteria 4099
131 Ga0157376_10011217 3300014969 Bacteria 6595
132 Ga0157376_10064601 3300014969 Bacteria 3087
133 Ga0206356_11279661 3300020070 Bacteria 1503
134 Ga0206353_11858587 3300020082 Bacteria 917
135 Ga0213876_10402619 3300021384 Unclassified 728
136 Ga0207692_10091584 3300025898 Bacteria 1650
137 Ga0207642_10155532 3300025899 Bacteria 1222
138 Ga0207680_10516708 3300025903 Bacteria 851
139 Ga0207685_10183090 3300025905 Bacteria 972
140 Ga0207699_10267097 3300025906 Unclassified 1184
141 Ga0207699_10434423 3300025906 Bacteria 940
142 Ga0207645_10343689 3300025907 Unclassified 998
143 Ga0207643_10651084 3300025908 Unclassified 680
144 Ga0207705_10046346 3300025909 Bacteria 3124
145 Ga0207707_10470054 3300025912 Bacteria 1075
146 Ga0207695_10038633 3300025913 Bacteria 5136
147 Ga0207695_10708007 3300025913 Unclassified 887
148 Ga0207663_10127164 3300025916 Unclassified 1755
149 Ga0207662_10222080 3300025918 Bacteria 1231
150 Ga0207657_10001907 3300025919 Bacteria 22534
151 Ga0207649_10606532 3300025920 Bacteria 842
152 Ga0207652_10366960 3300025921 Bacteria 1299
153 Ga0207646_11390575 3300025922 Unclassified 611
154 Ga0207681_10002833 3300025923 Bacteria 10975
155 Ga0207681_10182980 3300025923 Unclassified 1598
156 Ga0207650_10037170 3300025925 Bacteria 3547
157 Ga0207659_10202597 3300025926 Bacteria 1586
158 Ga0207659_10737979 3300025926 Unclassified 844
159 Ga0207687_10271912 3300025927 Bacteria 1355
160 Ga0207644_10044383 3300025931 Bacteria 3158
161 Ga0207706_10358548 3300025933 Bacteria 1267
162 Ga0207706_10492564 3300025933 Bacteria 1058
163 Ga0207706_10551304 3300025933 Bacteria 992
164 Ga0207686_10239263 3300025934 Bacteria 1320
165 Ga0207686_10561054 3300025934 Bacteria 894
166 Ga0207709_10407670 3300025935 Bacteria 1041
167 Ga0207670_10043284 3300025936 Bacteria 2972
168 Ga0207669_10214071 3300025937 Bacteria 1409
169 Ga0207704_10049922 3300025938 Bacteria 2521
170 Ga0207691_10063783 3300025940 Bacteria 3340
171 Ga0207711_10016981 3300025941 Bacteria 6045
172 Ga0207711_10358916 3300025941 Bacteria 1350
173 Ga0207689_10103386 3300025942 Unclassified 2341
174 Ga0207689_10256063 3300025942 Bacteria 1448
175 Ga0207689_10774368 3300025942 Unclassified 810
176 Ga0207689_10866922 3300025942 Bacteria 762
177 Ga0207651_10015319 3300025960 Bacteria 4453
178 Ga0207651_10916938 3300025960 Bacteria 781
179 Ga0207651_11066719 3300025960 Bacteria 723
180 Ga0207651_11204616 3300025960 Archaea 680
181 Ga0207668_10197839 3300025972 Bacteria 1598
182 Ga0207658_10022939 3300025986 Bacteria 4350
183 Ga0207677_10432289 3300026023 Unclassified 1124
184 Ga0207677_10597700 3300026023 Bacteria 968
185 Ga0207703_10082113 3300026035 Bacteria 2689
186 Ga0207703_10131082 3300026035 Bacteria 2165
187 Ga0207703_10184679 3300026035 Bacteria 1842
188 Ga0207703_10521071 3300026035 Bacteria 1118
189 Ga0207708_10100265 3300026075 Unclassified 2241
190 Ga0207702_10377358 3300026078 Bacteria 1363
191 Ga0207641_10045110 3300026088 Unclassified 3710
192 Ga0207641_10282042 3300026088 Unclassified 1563
193 Ga0207648_10109725 3300026089 Bacteria 2422
194 Ga0207676_10404935 3300026095 Bacteria 1276
195 Ga0207675_100166480 3300026118 Unclassified 2105
196 Ga0207675_101263612 3300026118 Bacteria 759
197 Ga0207683_10068499 3300026121 Bacteria 3133
198 Ga0207683_10522323 3300026121 Bacteria 1097
199 Ga0207428_10056271 3300027907 Bacteria 3126
200 Ga0207428_10114116 3300027907 Bacteria 2076
201 Ga0207428_10121484 3300027907 Bacteria 2002
202 Ga0207428_10271485 3300027907 Bacteria 1260
203 Ga0207428_11024567 3300027907 Unclassified 579
204 Ga0268265_10006637 3300028380 Bacteria 7830
205 Ga0268265_10138632 3300028380 Bacteria 2033
206 Ga0268265_10499567 3300028380 Bacteria 1146
207 Ga0268264_10112212 3300028381 Unclassified 2390
208 Ga0268264_10208188 3300028381 Bacteria 1794
209 Ga0268264_10605264 3300028381 Bacteria 1080
210 Ga0307509_10718998 3300031507 Unclassified 665
211 Ga0373923_0426407 3300035111 Bacteria 641
212 Ga0373941_0012238 3300035115 Bacteria 2239
213 Ga0373941_0192379 3300035115 Bacteria 771
214 Ga0373946_0293995 3300035171 Bacteria 802
215 Ga0373955_0069612 3300035172 Unclassified 1964
216 Ga0373937_0172060 3300036401 Bacteria 2032
217 Ga0373937_1304422 3300036401 Bacteria 674
218 Ga0395905_1307195 3300037471 Unclassified 629
219 Ga0436365_1637464 3300039437 Bacteria 828
220 Ga0466963_0561581 3300044694 Unclassified 806
221 Ga0466963_0586647 3300044694 Unclassified 787
222 Ga0451576_0243371 3300045051 Bacteria 1879
223 Ga0451576_1011633 3300045051 Bacteria 871
224 Ga0466967_0805070 3300045976 Unclassified 933
225 Ga0466967_0851915 3300045976 Unclassified 906
226 Ga0495651_0356738 3300046462 Unclassified 965
227 Ga0495642_0227496 3300046528 Unclassified 815
228 Ga0495586_0708216 3300046535 Bacteria 581
229 Ga0495645_0031447 3300046543 Bacteria 3868
230 Ga0495658_0103481 3300046683 Unclassified 1703
231 Ga0495613_0115078 3300046689 Bacteria 1936
232 Ga0495674_0125251 3300047319 Unclassified 2169
233 Ga0495684_0292547 3300047471 Unclassified 1172
234 Ga0496102_0823664 3300048905 Bacteria 850
235 Ga0496110_0356360 3300048913 Archaea 1333
236 Ga0496114_0048088 3300048917 Bacteria 3548
237 Ga0501047_0380826 3300049581 Bacteria 1245
238 Ga0501068_0197987 3300049584 Bacteria 1274
239 nmdc:mga05p37_1013700_c1 3300050507 Bacteria 880
240 nmdc:mga05p37_185438_c1 3300050507 Bacteria 2530
241 nmdc:mga05p37_207909_c1 3300050507 Bacteria 2367
242 nmdc:mga05p37_20973_c1 3300050507 Bacteria 7910
243 nmdc:mga05p37_34496_c1 3300050507 Bacteria 6199
244 nmdc:mga08y16_174979_c1 3300050511 Bacteria 2229
245 nmdc:mga08y16_17664_c1 3300050511 Bacteria 7514
246 nmdc:mga08y16_213009_c1 3300050511 Bacteria 2001
247 nmdc:mga08y16_779979_c1 3300050511 Unclassified 950
248 nmdc:mga08y16_90120_c1 3300050511 Bacteria 3196
249 nmdc:mga0n895_109678_c1 3300050512 Unclassified 2775
250 nmdc:mga0n895_88192_c1 3300050512 Bacteria 3102
251 nmdc:mga0rr50_364781_c1 3300050513 Bacteria 1216
252 nmdc:mga0rr50_860471_c1 3300050513 Unclassified 773
253 nmdc:mga08x19_12415_c1 3300050514 Bacteria 5132
254 nmdc:mga08x19_16976_c1 3300050514 Bacteria 4449
255 nmdc:mga0a205_184116_c1 3300050515 Unclassified 1982
256 nmdc:mga0a205_390000_c1 3300050515 Bacteria 1257
257 nmdc:mga0a205_608659_c1 3300050515 Unclassified 945
258 nmdc:mga0a205_9836_c1 3300050515 Bacteria 8773
259 Ga0070709_10262457
260 Ga0065715_10189627
261 Ga0070658_10125994
262 Ga0070670_100244124
263 Ga0070670_100329078
264 Ga0068869_100270991
265 Ga0068869_101081333
266 Ga0070680_100060495
267 Ga0068868_100126667
268 Ga0070660_100002307
269 Ga0070687_100201418
270 Ga0070661_101183857
271 Ga0070669_100005999
272 Ga0070675_100258253
273 Ga0070675_100860598
274 Ga0070671_100063375
275 Ga0070674_100112419
276 Ga0070673_100080446
277 Ga0070688_100185820
278 Ga0070688_100331297
279 Ga0070659_100095560
280 Ga0070659_100708082
281 Ga0070667_100014018
282 Ga0070710_10161420
283 Ga0070711_100156153
284 Ga0070705_101156002
285 Ga0070700_100051603
286 Ga0070708_100727933
287 Ga0070678_100090032
288 Ga0070678_100806305
289 Ga0070662_100461370
290 Ga0070681_10029872
291 Ga0070681_10059584
292 Ga0070681_10289868
293 Ga0070681_10418846
294 Ga0068867_100097216
295 Ga0068867_100381962
296 Ga0070707_101674709
297 Ga0070699_100180666
298 Ga0070699_100662472
299 Ga0070684_100707590
300 Ga0070697_100186388
301 Ga0070697_100187418
302 Ga0068853_101926230
303 Ga0070672_100078985
304 Ga0070695_100183362
305 Ga0070696_100213861
306 Ga0070693_100537512
307 Ga0068855_100038105
308 Ga0068855_100253194
309 Ga0068856_100430073
310 Ga0068859_100302163
311 Ga0068859_100485640
312 Ga0068859_100559507
313 Ga0068864_100965116
314 Ga0068866_10180956
315 Ga0068861_100173282
316 Ga0068861_101156401
317 Ga0068863_100008012
318 Ga0068863_100237113
319 Ga0068863_100734174
320 Ga0068863_100936795
321 Ga0068858_100238010
322 Ga0068858_101023713
323 Ga0068860_100027062
324 Ga0068860_100236758
325 Ga0068860_100631479
326 Ga0068860_101040285
327 Ga0068862_100047227
328 Ga0068862_100146039
329 Ga0068862_102118257
330 Ga0081540_1174815
331 Ga0070717_10093742
332 Ga0070716_100092543
333 Ga0097621_100004737
334 Ga0097621_100014127
335 Ga0097621_100165284
336 Ga0097621_101138479
337 Ga0068871_100002673
338 Ga0068871_100035875
339 Ga0068871_100084368
340 Ga0075431_101229655
341 Ga0075433_10092115
342 Ga0075433_10382624
343 Ga0075434_100116584
344 Ga0068865_100018941
345 Ga0075436_100061931
346 Ga0097620_100302142
347 Ga0097620_100485620
348 Ga0097620_100559483
349 Ga0075435_100033967
350 Ga0075435_100086509
351 Ga0075435_100196105
352 Ga0075435_100639601
353 Ga0105240_10053948
354 Ga0105240_10094749
355 Ga0105240_10345611
356 Ga0105240_12174698
357 Ga0111539_10007717
358 Ga0111539_10038271
359 Ga0111539_10261010
360 Ga0111539_10590810
361 Ga0105245_10669323
362 Ga0105245_11928302
363 Ga0114129_10001017
364 Ga0114129_10001344
365 Ga0114129_10008550
366 Ga0114129_10189982
367 Ga0105243_10419513
368 Ga0105243_11569103
369 Ga0105242_10005258
370 Ga0105248_10016697
371 Ga0105248_10132042
372 Ga0105248_10156619
373 Ga0105248_10232442
374 Ga0105248_10945389
375 Ga0105248_11273461
376 Ga0105238_10351472
377 Ga0105249_11801591
378 Ga0105249_12281734
379 Ga0105246_10154402
380 Ga0157369_10119487
381 Ga0157372_10542457
382 Ga0157375_10655377
383 Ga0157375_11776909
384 Ga0157375_11920593
385 Ga0157380_10082553
386 Ga0157380_10296274
387 Ga0157377_10282845
388 Ga0157379_10041656
389 Ga0157376_10011217
390 Ga0157376_10064601
391 Ga0206356_11279661
392 Ga0206353_11858587
393 Ga0213876_10402619
394 Ga0207692_10091584
395 Ga0207642_10155532
396 Ga0207680_10516708
397 Ga0207685_10183090
398 Ga0207699_10267097
399 Ga0207699_10434423
400 Ga0207645_10343689
401 Ga0207643_10651084
402 Ga0207705_10046346
403 Ga0207707_10470054
404 Ga0207695_10038633
405 Ga0207695_10708007
406 Ga0207663_10127164
407 Ga0207662_10222080
408 Ga0207657_10001907
409 Ga0207649_10606532
410 Ga0207652_10366960
411 Ga0207646_11390575
412 Ga0207681_10002833
413 Ga0207681_10182980
414 Ga0207650_10037170
415 Ga0207659_10202597
416 Ga0207659_10737979
417 Ga0207687_10271912
418 Ga0207644_10044383
419 Ga0207706_10358548
420 Ga0207706_10492564
421 Ga0207706_10551304
422 Ga0207686_10239263
423 Ga0207686_10561054
424 Ga0207709_10407670
425 Ga0207670_10043284
426 Ga0207669_10214071
427 Ga0207704_10049922
428 Ga0207691_10063783
429 Ga0207711_10016981
430 Ga0207711_10358916
431 Ga0207689_10103386
432 Ga0207689_10256063
433 Ga0207689_10774368
434 Ga0207689_10866922
435 Ga0207651_10015319
436 Ga0207651_10916938
437 Ga0207651_11066719
438 Ga0207651_11204616
439 Ga0207668_10197839
440 Ga0207658_10022939
441 Ga0207677_10432289
442 Ga0207677_10597700
443 Ga0207703_10082113
444 Ga0207703_10131082
445 Ga0207703_10184679
446 Ga0207703_10521071
447 Ga0207708_10100265
448 Ga0207702_10377358
449 Ga0207641_10045110
450 Ga0207641_10282042
451 Ga0207648_10109725
452 Ga0207676_10404935
453 Ga0207675_100166480
454 Ga0207675_101263612
455 Ga0207683_10068499
456 Ga0207683_10522323
457 Ga0207428_10056271
458 Ga0207428_10114116
459 Ga0207428_10121484
460 Ga0207428_10271485
461 Ga0207428_11024567
462 Ga0268265_10006637
463 Ga0268265_10138632
464 Ga0268265_10499567
465 Ga0268264_10112212
466 Ga0268264_10208188
467 Ga0268264_10605264
468 Ga0307509_10718998
469 Ga0373923_0426407
470 Ga0373941_0012238
471 Ga0373941_0192379
472 Ga0373946_0293995
473 Ga0373955_0069612
474 Ga0373937_0172060
475 Ga0373937_1304422
476 Ga0395905_1307195
477 Ga0436365_1637464
478 Ga0466963_0561581
479 Ga0466963_0586647
480 Ga0451576_0243371
481 Ga0451576_1011633
482 Ga0466967_0805070
483 Ga0466967_0851915
484 Ga0495651_0356738
485 Ga0495642_0227496
486 Ga0495586_0708216
487 Ga0495645_0031447
488 Ga0495658_0103481
489 Ga0495613_0115078
490 Ga0495674_0125251
491 Ga0495684_0292547
492 Ga0496102_0823664
493 Ga0496110_0356360
494 Ga0496114_0048088
495 Ga0501047_0380826
496 Ga0501068_0197987
497 nmdc:mga05p37_1013700_c1
498 nmdc:mga05p37_185438_c1
499 nmdc:mga05p37_207909_c1
500 nmdc:mga05p37_20973_c1
501 nmdc:mga05p37_34496_c1
502 nmdc:mga08y16_174979_c1
503 nmdc:mga08y16_17664_c1
504 nmdc:mga08y16_213009_c1
505 nmdc:mga08y16_779979_c1
506 nmdc:mga08y16_90120_c1
507 nmdc:mga0n895_109678_c1
508 nmdc:mga0n895_88192_c1
509 nmdc:mga0rr50_364781_c1
510 nmdc:mga0rr50_860471_c1
511 nmdc:mga08x19_12415_c1
512 nmdc:mga08x19_16976_c1
513 nmdc:mga0a205_184116_c1
514 nmdc:mga0a205_390000_c1
515 nmdc:mga0a205_608659_c1
516 nmdc:mga0a205_9836_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

9

88

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.9193 2 158
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.897 2 158
3f2i-assembly3.cif.gz_E crystal structure of the alr0221 protein from nostoc, northeast structural genomics consortium target nsr422. 0.8929 2 160
2rfl-assembly3.cif.gz_C crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8861 2 157
2rfl-assembly5.cif.gz_E crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8832 2 157
ID Description Score Start End Superfamily
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9185 2 160 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9074 2 160 3.40.50.1240
af_I1L079_52_229_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8719 2 157 3.40.50.1240
3f2iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8612 4 161 3.40.50.1240
3f2iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.846 4 161 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A843T2N7-F1-model_v4 Phosphohistidine phosphatase SixA 0.9917 2 111
AF-A0A1F2SQX3-F1-model_v4 Phosphohistidine phosphatase SixA 0.989 2 164 GO:0005737
GO:0036211
GO:0101006
AF-A0A3N5ZSB9-F1-model_v4 Phosphohistidine phosphatase SixA 0.9837 2 164
AF-A0A1F2SY63-F1-model_v4 Phosphohistidine phosphatase SixA 0.9815 2 163 GO:0005737
GO:0036211
GO:0101006
AF-A0A6A7KX87-F1-model_v4 Phosphohistidine phosphatase SixA 0.9769 2 163 GO:0005737
GO:0036211
GO:0101006

Map