F367298

General Info

Members Datasets Scaffolds Average Seq Length
257 130 257 358

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10000011|Ga0157374_10000011323
Length 401
Sequence MLERWSTFAFDHLSNIKKEHYPSILRGGSLSYQHKTISMKPSTTHRSLLLLLFSFVCSLSVLSQEKTFPIDGIILDKSGQPLQGASVFCQNTTIGTLSRADGSFHLRLPNGGYDLIVSYTSYETQSIRIGKDHNPADTLKIQLKEQDKSLEQAVVTGSAEVADGWSKYGQFFFDNFVGTTPNAAQCTLDNKEVLKFYFYKKRNKLRIKATEPLIVTNNALGYRIKYQLDSFVYDYTGNVGSYTGYPLFETLDGSPDQQQTWKQNRLFSYSGSRLHFIRSWYDSTLNDEGFVLELADSGSTTMKRVANPYDPRYYSRDSGDVEINIQGRLRVSYTSQAPDKKYLTQNKYPLGTPAQISALDISSGFVIEENGYFYDQGDVSNIGYWSWKKLAELLPYDYVPE

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
129 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 0.39
Rhizosphere 93
Stem 0
Stem Tuber 0
Unclassified 5.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10001613 3300003320 Bacteria 20111
2 rootH2_10001614 3300003320 Bacteria 29985
3 rootH2_10023604 3300003320 Bacteria 13207
4 rootL2_10346819 3300003322 Bacteria 1582
5 Ga0070658_10000563 3300005327 Bacteria 32232
6 Ga0070676_10000218 3300005328 Bacteria 24620
7 Ga0070676_10062208 3300005328 Unclassified 2220
8 Ga0070683_100006422 3300005329 Bacteria 9858
9 Ga0070690_100055466 3300005330 Bacteria 2538
10 Ga0070670_100217250 3300005331 Bacteria 1663
11 Ga0068869_100023686 3300005334 Bacteria 4245
12 Ga0070666_10000072 3300005335 Bacteria 75356
13 Ga0070666_10000969 3300005335 Bacteria 17521
14 Ga0070666_10015838 3300005335 Bacteria 4816
15 Ga0070682_100005089 3300005337 Bacteria 7306
16 Ga0068868_100000770 3300005338 Bacteria 21666
17 Ga0068868_100180834 3300005338 Unclassified 1749
18 Ga0070691_10019242 3300005341 Bacteria 3149
19 Ga0070668_100000110 3300005347 Bacteria 50766
20 Ga0070675_100073933 3300005354 Bacteria 2830
21 Ga0070675_100096844 3300005354 Bacteria 2479
22 Ga0070671_100126311 3300005355 Bacteria 2153
23 Ga0070674_100046910 3300005356 Bacteria 2958
24 Ga0070674_100049288 3300005356 Bacteria 2895
25 Ga0070673_100000676 3300005364 Bacteria 18803
26 Ga0070673_100028978 3300005364 Bacteria 4124
27 Ga0070673_100038335 3300005364 Unclassified 3659
28 Ga0070667_100000867 3300005367 Bacteria 28069
29 Ga0070667_100005066 3300005367 Bacteria 11030
30 Ga0070667_100044433 3300005367 Bacteria 3731
31 Ga0070700_100029929 3300005441 Bacteria 3250
32 Ga0070662_100054226 3300005457 Unclassified 2905
33 Ga0068867_100002557 3300005459 Bacteria 12824
34 Ga0070685_10163621 3300005466 Unclassified 1420
35 Ga0070684_100011294 3300005535 Bacteria 7109
36 Ga0068853_100001650 3300005539 Bacteria 16317
37 Ga0068853_100047246 3300005539 Bacteria 3693
38 Ga0068853_100066380 3300005539 Unclassified 3133
39 Ga0070672_100000020 3300005543 Bacteria 69277
40 Ga0070672_100014302 3300005543 Bacteria 5623
41 Ga0070672_100272274 3300005543 Unclassified 1430
42 Ga0070693_100012647 3300005547 Unclassified 4276
43 Ga0070665_100000014 3300005548 Bacteria 484881
44 Ga0070665_100000318 3300005548 Bacteria 74326
45 Ga0068855_100001870 3300005563 Bacteria 26178
46 Ga0068855_100145313 3300005563 Unclassified 2700
47 Ga0070664_100194221 3300005564 Bacteria 1809
48 Ga0068857_100004870 3300005577 Bacteria 11389
49 Ga0068854_100012243 3300005578 Bacteria 5615
50 Ga0068854_100271314 3300005578 Bacteria 1362
51 Ga0068856_100030534 3300005614 Bacteria 5268
52 Ga0070702_100006737 3300005615 Bacteria 5460
53 Ga0068852_100021526 3300005616 Bacteria 5151
54 Ga0068852_100069291 3300005616 Bacteria 3091
55 Ga0068859_100000006 3300005617 Bacteria 421509
56 Ga0068859_100008596 3300005617 Bacteria 10325
57 Ga0068864_100008852 3300005618 Bacteria 8297
58 Ga0068864_100010828 3300005618 Bacteria 7537
59 Ga0068864_100115888 3300005618 Bacteria 2390
60 Ga0068861_100140121 3300005719 Bacteria 1973
61 Ga0068851_10002057 3300005834 Bacteria 8863
62 Ga0068851_10028081 3300005834 Bacteria 2777
63 Ga0068863_100037644 3300005841 Bacteria 4605
64 Ga0068858_100001487 3300005842 Bacteria 24140
65 Ga0068858_100004205 3300005842 Bacteria 14172
66 Ga0068858_100119656 3300005842 Bacteria 2462
67 Ga0068860_100000061 3300005843 Bacteria 192548
68 Ga0068860_100001096 3300005843 Bacteria 29818
69 Ga0068860_100001937 3300005843 Bacteria 21898
70 Ga0068860_100002430 3300005843 Bacteria 19567
71 Ga0068860_100004305 3300005843 Bacteria 14551
72 Ga0081540_1010602 3300005983 Bacteria 6223
73 Ga0097621_100004024 3300006237 Bacteria 10191
74 Ga0097621_100064979 3300006237 Bacteria 3001
75 Ga0068871_100009317 3300006358 Bacteria 7107
76 Ga0068871_100013565 3300006358 Bacteria 6050
77 Ga0068871_100044612 3300006358 Bacteria 3567
78 Ga0068865_100003381 3300006881 Bacteria 9557
79 Ga0097620_100000006 3300006931 Bacteria 421509
80 Ga0097620_100008596 3300006931 Bacteria 10325
81 Ga0105240_10000800 3300009093 Bacteria 56989
82 Ga0105240_10004358 3300009093 Bacteria 21601
83 Ga0105240_10004869 3300009093 Bacteria 20203
84 Ga0105240_10006347 3300009093 Bacteria 17410
85 Ga0105240_10006425 3300009093 Bacteria 17277
86 Ga0105240_10027103 3300009093 Bacteria 7508
87 Ga0105240_10030313 3300009093 Bacteria 7030
88 Ga0105240_10063561 3300009093 Bacteria 4591
89 Ga0105240_10098627 3300009093 Bacteria 3557
90 Ga0105240_10117575 3300009093 Bacteria 3205
91 Ga0111539_10065199 3300009094 Bacteria 4305
92 Ga0105245_10030774 3300009098 Bacteria 4747
93 Ga0105247_10011021 3300009101 Bacteria 5456
94 Ga0105243_10168656 3300009148 Bacteria 1894
95 Ga0105241_10000608 3300009174 Bacteria 26997
96 Ga0105241_10002863 3300009174 Bacteria 12889
97 Ga0105241_10007807 3300009174 Bacteria 7866
98 Ga0105242_10068763 3300009176 Bacteria 2931
99 Ga0105242_10165687 3300009176 Bacteria 1939
100 Ga0105237_10000229 3300009545 Bacteria 79571
101 Ga0105237_10003344 3300009545 Bacteria 19091
102 Ga0105237_10005526 3300009545 Bacteria 14250
103 Ga0105237_10022971 3300009545 Bacteria 6397
104 Ga0105237_10046681 3300009545 Bacteria 4357
105 Ga0105237_10125103 3300009545 Bacteria 2565
106 Ga0105237_10226961 3300009545 Bacteria 1868
107 Ga0105237_10250190 3300009545 Bacteria 1774
108 Ga0105238_10001710 3300009551 Bacteria 22126
109 Ga0105238_10047439 3300009551 Bacteria 4330
110 Ga0105249_10005209 3300009553 Bacteria 11220
111 Ga0105249_10005813 3300009553 Bacteria 10667
112 Ga0105239_10000019 3300010375 Bacteria 273836
113 Ga0105239_10004591 3300010375 Bacteria 16454
114 Ga0105239_10004672 3300010375 Bacteria 16278
115 Ga0105239_10027328 3300010375 Bacteria 6281
116 Ga0105239_10172008 3300010375 Bacteria 2422
117 Ga0105246_10211293 3300011119 Bacteria 1515
118 Ga0157370_10005564 3300013104 Bacteria 14125
119 Ga0157370_10046734 3300013104 Unclassified 4150
120 Ga0157370_10188358 3300013104 Bacteria 1915
121 Ga0157369_10037219 3300013105 Bacteria 5328
122 Ga0157369_10117068 3300013105 Bacteria 2829
123 Ga0157374_10000011 3300013296 Bacteria 466749
124 Ga0157374_10001355 3300013296 Bacteria 20853
125 Ga0157374_10383795 3300013296 Unclassified 1400
126 Ga0157378_10005523 3300013297 Bacteria 11078
127 Ga0157378_10009255 3300013297 Bacteria 8579
128 Ga0157378_10047080 3300013297 Bacteria 3833
129 Ga0157378_10067074 3300013297 Unclassified 3215
130 Ga0157378_10128189 3300013297 Bacteria 2346
131 Ga0157378_10217717 3300013297 Bacteria 1814
132 Ga0163162_10000131 3300013306 Bacteria 67924
133 Ga0163162_10001474 3300013306 Bacteria 21898
134 Ga0163162_10022294 3300013306 Bacteria 6242
135 Ga0163162_10025448 3300013306 Bacteria 5848
136 Ga0163162_10102489 3300013306 Bacteria 2955
137 Ga0157372_10005438 3300013307 Bacteria 13535
138 Ga0157372_10012118 3300013307 Bacteria 9184
139 Ga0157372_10087512 3300013307 Unclassified 3535
140 Ga0157372_10113145 3300013307 Bacteria 3110
141 Ga0157372_10271503 3300013307 Bacteria 1971
142 Ga0157372_10477091 3300013307 Bacteria 1454
143 Ga0157375_10001533 3300013308 Bacteria 19889
144 Ga0157375_10049186 3300013308 Bacteria 4130
145 Ga0157375_10409391 3300013308 Unclassified 1522
146 Ga0163163_10004467 3300014325 Bacteria 11931
147 Ga0163163_10232890 3300014325 Bacteria 1891
148 Ga0163163_10364728 3300014325 Unclassified 1501
149 Ga0163163_10417822 3300014325 Bacteria 1400
150 Ga0157379_10000115 3300014968 Bacteria 55499
151 Ga0157379_10137965 3300014968 Bacteria 2198
152 Ga0157379_10158902 3300014968 Unclassified 2040
153 Ga0157376_10004633 3300014969 Bacteria 9582
154 Ga0157376_10005109 3300014969 Bacteria 9147
155 Ga0157376_10007481 3300014969 Bacteria 7803
156 Ga0157376_10131432 3300014969 Bacteria 2234
157 Ga0157376_10394063 3300014969 Bacteria 1337
158 Ga0163161_10111731 3300017792 Bacteria 2043
159 Ga0163161_10169507 3300017792 Bacteria 1668
160 Ga0207656_10001813 3300025321 Bacteria 7104
161 Ga0207682_10017546 3300025893 Bacteria 2796
162 Ga0207710_10005534 3300025900 Bacteria 5435
163 Ga0207680_10000024 3300025903 Bacteria 82106
164 Ga0207680_10005400 3300025903 Bacteria 6106
165 Ga0207645_10001052 3300025907 Bacteria 22849
166 Ga0207645_10071121 3300025907 Unclassified 2226
167 Ga0207705_10008349 3300025909 Bacteria 7561
168 Ga0207654_10003181 3300025911 Bacteria 8295
169 Ga0207654_10008261 3300025911 Bacteria 5256
170 Ga0207707_10000747 3300025912 Bacteria 32068
171 Ga0207695_10000087 3300025913 Bacteria 276412
172 Ga0207695_10000863 3300025913 Bacteria 55452
173 Ga0207695_10001230 3300025913 Bacteria 43841
174 Ga0207695_10004034 3300025913 Bacteria 20201
175 Ga0207695_10016157 3300025913 Bacteria 8752
176 Ga0207695_10032339 3300025913 Bacteria 5726
177 Ga0207695_10108415 3300025913 Bacteria 2761
178 Ga0207671_10000931 3300025914 Bacteria 36651
179 Ga0207671_10001508 3300025914 Bacteria 26826
180 Ga0207671_10006637 3300025914 Bacteria 10260
181 Ga0207671_10014628 3300025914 Bacteria 6191
182 Ga0207671_10031959 3300025914 Bacteria 3919
183 Ga0207671_10039949 3300025914 Bacteria 3474
184 Ga0207657_10080469 3300025919 Unclassified 2738
185 Ga0207652_10025159 3300025921 Unclassified 4946
186 Ga0207694_10237971 3300025924 Bacteria 1488
187 Ga0207659_10063943 3300025926 Bacteria 2661
188 Ga0207659_10173062 3300025926 Bacteria 1705
189 Ga0207644_10082996 3300025931 Bacteria 2372
190 Ga0207704_10000955 3300025938 Bacteria 12788
191 Ga0207691_10000673 3300025940 Bacteria 33764
192 Ga0207691_10004686 3300025940 Bacteria 13245
193 Ga0207689_10030935 3300025942 Bacteria 4459
194 Ga0207661_10002997 3300025944 Bacteria 11677
195 Ga0207667_10000098 3300025949 Bacteria 140051
196 Ga0207667_10000279 3300025949 Bacteria 70460
197 Ga0207667_10095108 3300025949 Bacteria 3076
198 Ga0207712_10045496 3300025961 Bacteria 3039
199 Ga0207668_10003855 3300025972 Bacteria 8835
200 Ga0207640_10076602 3300025981 Unclassified 2271
201 Ga0207640_10261551 3300025981 Bacteria 1349
202 Ga0207658_10005210 3300025986 Bacteria 8947
203 Ga0207658_10117470 3300025986 Bacteria 2114
204 Ga0207677_10002707 3300026023 Bacteria 9343
205 Ga0207677_10005874 3300026023 Bacteria 6679
206 Ga0207677_10044993 3300026023 Bacteria 2945
207 Ga0207703_10006076 3300026035 Bacteria 9658
208 Ga0207703_10020213 3300026035 Bacteria 5207
209 Ga0207639_10009858 3300026041 Bacteria 6598
210 Ga0207639_10060563 3300026041 Unclassified 2920
211 Ga0207639_10127587 3300026041 Bacteria 2101
212 Ga0207639_10214035 3300026041 Unclassified 1661
213 Ga0207702_10028899 3300026078 Bacteria 4611
214 Ga0207641_10000058 3300026088 Bacteria 166385
215 Ga0207648_10005503 3300026089 Bacteria 12764
216 Ga0207648_10009112 3300026089 Bacteria 9541
217 Ga0207676_10004887 3300026095 Bacteria 9492
218 Ga0207676_10044933 3300026095 Bacteria 3410
219 Ga0207676_10404263 3300026095 Unclassified 1277
220 Ga0207674_10000969 3300026116 Bacteria 37567
221 Ga0207675_100159378 3300026118 Bacteria 2152
222 Ga0207683_10091532 3300026121 Unclassified 2710
223 Ga0207698_10027998 3300026142 Bacteria 4011
224 Ga0268266_10000068 3300028379 Bacteria 241100
225 Ga0268266_10019825 3300028379 Bacteria 5731
226 Ga0268264_10000079 3300028381 Bacteria 249516
227 Ga0268264_10001477 3300028381 Bacteria 21934
228 Ga0268264_10002921 3300028381 Bacteria 14854
229 Ga0268264_10007355 3300028381 Bacteria 9197
230 Ga0307517_10005822 3300028786 Bacteria 18435
231 Ga0307515_10000059 3300028794 Bacteria 257520
232 Ga0307511_10000201 3300030521 Bacteria 60079
233 Ga0307509_10038239 3300031507 Bacteria 5237
234 Ga0307509_10110788 3300031507 Unclassified 2749
235 Ga0307508_10001083 3300031616 Bacteria 31499
236 Ga0307508_10269969 3300031616 Bacteria 1295
237 Ga0307516_10005469 3300031730 Bacteria 15179
238 Ga0307516_10121643 3300031730 Bacteria 2400
239 Ga0307510_10008700 3300033180 Bacteria 12090
240 Ga0466972_0041287 3300044658 Unclassified 2246
241 Ga0466957_0165585 3300044842 Bacteria 1438
242 Ga0466959_0009260 3300045049 Bacteria 6998
243 Ga0495638_0028216 3300046460 Bacteria 3626
244 Ga0495638_0059621 3300046460 Bacteria 2363
245 Ga0495606_0003421 3300046507 Bacteria 16858
246 Ga0495648_0003136 3300046524 Bacteria 14739
247 Ga0495611_0000026 3300046648 Bacteria 118428
248 Ga0495687_001838 3300047443 Bacteria 18636
249 Ga0495686_0000005 3300047472 Bacteria 827143
250 Ga0496109_0037628 3300048912 Bacteria 4372
251 Ga0501080_0064181 3300049742 Unclassified 3416
252 Ga0501083_0014742 3300049744 Bacteria 5465
253 nmdc:mga08y16_32241_c1 3300050511 Bacteria 5509
254 Ga0500583_0162438 3300053092 Bacteria 1112
255 Ga0500616_0004133 3300053153 Bacteria 10506
256 Ga0500622_0001733 3300053156 Bacteria 16854
257 Ga0501084_0011252 3300054114 Bacteria 7408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053092 Ga0500583_0162438 Ga0500583_0162438_42_935 296
2 3300026041 Ga0207639_10127587 Ga0207639_101275872 320
3 3300013308 Ga0157375_10049186 Ga0157375_100491861 329
4 3300003322 rootL2_10346819 rootL2_103468193 341
5 3300049742 Ga0501080_0064181 Ga0501080_0064181_1923_2999 341
6 3300049744 Ga0501083_0014742 Ga0501083_0014742_2214_3290 341
7 3300054114 Ga0501084_0011252 Ga0501084_0011252_1860_2936 341
8 3300031616 Ga0307508_10269969 Ga0307508_102699691 342
9 3300005539 Ga0068853_100001650 Ga0068853_1000016508 343
10 3300009093 Ga0105240_10004869 Ga0105240_100048692 343
11 3300009093 Ga0105240_10006425 Ga0105240_100064252 343
12 3300009093 Ga0105240_10098627 Ga0105240_100986272 343
13 3300009545 Ga0105237_10125103 Ga0105237_101251032 343
14 3300009551 Ga0105238_10047439 Ga0105238_100474392 343
15 3300010375 Ga0105239_10004591 Ga0105239_100045912 343
16 3300010375 Ga0105239_10027328 Ga0105239_100273282 343
17 3300025913 Ga0207695_10000863 Ga0207695_1000086342 343
18 3300025913 Ga0207695_10004034 Ga0207695_1000403417 343
19 3300025913 Ga0207695_10032339 Ga0207695_100323392 343
20 3300026041 Ga0207639_10009858 Ga0207639_100098583 343
21 3300003320 rootH2_10023604 rootH2_1002360412 345
22 3300009093 Ga0105240_10030313 Ga0105240_100303137 345
23 3300013307 Ga0157372_10271503 Ga0157372_102715032 345
24 3300025913 Ga0207695_10108415 Ga0207695_101084152 345
25 3300009545 Ga0105237_10005526 Ga0105237_100055264 346
26 3300010375 Ga0105239_10000019 Ga0105239_1000001985 346
27 3300025914 Ga0207671_10031959 Ga0207671_100319595 346
28 3300005614 Ga0068856_100030534 Ga0068856_1000305343 347
29 3300026078 Ga0207702_10028899 Ga0207702_100288995 347
30 3300033180 Ga0307510_10008700 Ga0307510_100087007 347
31 3300046507 Ga0495606_0003421 Ga0495606_0003421_4136_5227 347
32 3300047472 Ga0495686_0000005 Ga0495686_0000005_514344_515390 347
33 3300005334 Ga0068869_100023686 Ga0068869_1000236863 352
34 3300005335 Ga0070666_10000072 Ga0070666_1000007218 352
35 3300005338 Ga0068868_100180834 Ga0068868_1001808342 352
36 3300005364 Ga0070673_100028978 Ga0070673_1000289784 352
37 3300005367 Ga0070667_100005066 Ga0070667_1000050662 352
38 3300005466 Ga0070685_10163621 Ga0070685_101636211 352
39 3300005543 Ga0070672_100272274 Ga0070672_1002722742 352
40 3300005578 Ga0068854_100271314 Ga0068854_1002713142 352
41 3300005617 Ga0068859_100000006 Ga0068859_10000000618 352
42 3300005618 Ga0068864_100008852 Ga0068864_1000088522 352
43 3300005834 Ga0068851_10028081 Ga0068851_100280813 352
44 3300005841 Ga0068863_100037644 Ga0068863_1000376442 352
45 3300005842 Ga0068858_100004205 Ga0068858_1000042054 352
46 3300005842 Ga0068858_100119656 Ga0068858_1001196562 352
47 3300005843 Ga0068860_100002430 Ga0068860_1000024306 352
48 3300006237 Ga0097621_100064979 Ga0097621_1000649792 352
49 3300006358 Ga0068871_100044612 Ga0068871_1000446122 352
50 3300006931 Ga0097620_100000006 Ga0097620_10000000618 352
51 3300009101 Ga0105247_10011021 Ga0105247_100110214 352
52 3300009174 Ga0105241_10002863 Ga0105241_100028633 352
53 3300009176 Ga0105242_10068763 Ga0105242_100687631 352
54 3300009545 Ga0105237_10003344 Ga0105237_1000334414 352
55 3300009553 Ga0105249_10005209 Ga0105249_100052092 352
56 3300011119 Ga0105246_10211293 Ga0105246_102112932 352
57 3300013296 Ga0157374_10383795 Ga0157374_103837951 352
58 3300013297 Ga0157378_10067074 Ga0157378_100670742 352
59 3300013306 Ga0163162_10025448 Ga0163162_100254484 352
60 3300013308 Ga0157375_10409391 Ga0157375_104093912 352
61 3300014325 Ga0163163_10232890 Ga0163163_102328902 352
62 3300014325 Ga0163163_10364728 Ga0163163_103647281 352
63 3300025900 Ga0207710_10005534 Ga0207710_100055341 352
64 3300025903 Ga0207680_10000024 Ga0207680_100000247 352
65 3300025911 Ga0207654_10003181 Ga0207654_100031813 352
66 3300025914 Ga0207671_10039949 Ga0207671_100399492 352
67 3300025931 Ga0207644_10082996 Ga0207644_100829961 352
68 3300025981 Ga0207640_10261551 Ga0207640_102615511 352
69 3300026023 Ga0207677_10002707 Ga0207677_100027078 352
70 3300026023 Ga0207677_10044993 Ga0207677_100449932 352
71 3300026035 Ga0207703_10020213 Ga0207703_100202133 352
72 3300026088 Ga0207641_10000058 Ga0207641_1000005854 352
73 3300026095 Ga0207676_10044933 Ga0207676_100449333 352
74 3300026095 Ga0207676_10404263 Ga0207676_104042632 352
75 3300026142 Ga0207698_10027998 Ga0207698_100279983 352
76 3300028381 Ga0268264_10002921 Ga0268264_100029216 352
77 3300005367 Ga0070667_100044433 Ga0070667_1000444332 353
78 3300005617 Ga0068859_100008596 Ga0068859_1000085969 353
79 3300005843 Ga0068860_100001096 Ga0068860_1000010967 353
80 3300006931 Ga0097620_100008596 Ga0097620_1000085963 353
81 3300013297 Ga0157378_10128189 Ga0157378_101281892 353
82 3300025986 Ga0207658_10117470 Ga0207658_101174702 353
83 3300031507 Ga0307509_10038239 Ga0307509_100382392 353
84 3300006358 Ga0068871_100009317 Ga0068871_1000093178 354
85 3300013297 Ga0157378_10047080 Ga0157378_100470804 354
86 3300014969 Ga0157376_10005109 Ga0157376_100051099 354
87 3300014969 Ga0157376_10394063 Ga0157376_103940632 354
88 3300031616 Ga0307508_10001083 Ga0307508_1000108314 354
89 3300044842 Ga0466957_0165585 Ga0466957_0165585_51_1136 354
90 3300046460 Ga0495638_0059621 Ga0495638_0059621_1018_2094 354
91 3300005327 Ga0070658_10000563 Ga0070658_1000056330 355
92 3300005328 Ga0070676_10000218 Ga0070676_1000021821 355
93 3300005335 Ga0070666_10000969 Ga0070666_1000096918 355
94 3300005338 Ga0068868_100000770 Ga0068868_1000007707 355
95 3300005347 Ga0070668_100000110 Ga0070668_10000011049 355
96 3300005364 Ga0070673_100000676 Ga0070673_10000067619 355
97 3300005367 Ga0070667_100000867 Ga0070667_10000086718 355
98 3300005457 Ga0070662_100054226 Ga0070662_1000542262 355
99 3300005459 Ga0068867_100002557 Ga0068867_1000025579 355
100 3300005543 Ga0070672_100000020 Ga0070672_10000002010 355
101 3300005548 Ga0070665_100000318 Ga0070665_10000031849 355
102 3300005564 Ga0070664_100194221 Ga0070664_1001942212 355
103 3300005616 Ga0068852_100069291 Ga0068852_1000692913 355
104 3300005618 Ga0068864_100010828 Ga0068864_1000108283 355
105 3300005719 Ga0068861_100140121 Ga0068861_1001401212 355
106 3300005834 Ga0068851_10002057 Ga0068851_100020576 355
107 3300005842 Ga0068858_100001487 Ga0068858_10000148721 355
108 3300005843 Ga0068860_100004305 Ga0068860_1000043053 355
109 3300006237 Ga0097621_100004024 Ga0097621_10000402410 355
110 3300006358 Ga0068871_100013565 Ga0068871_1000135657 355
111 3300006881 Ga0068865_100003381 Ga0068865_10000338110 355
112 3300009098 Ga0105245_10030774 Ga0105245_100307744 355
113 3300009148 Ga0105243_10168656 Ga0105243_101686562 355
114 3300009553 Ga0105249_10005813 Ga0105249_100058134 355
115 3300010375 Ga0105239_10172008 Ga0105239_101720082 355
116 3300013104 Ga0157370_10188358 Ga0157370_101883581 355
117 3300013296 Ga0157374_10001355 Ga0157374_100013555 355
118 3300013297 Ga0157378_10009255 Ga0157378_100092555 355
119 3300013306 Ga0163162_10001474 Ga0163162_100014747 355
120 3300013307 Ga0157372_10113145 Ga0157372_101131453 355
121 3300013308 Ga0157375_10001533 Ga0157375_1000153319 355
122 3300014325 Ga0163163_10004467 Ga0163163_100044677 355
123 3300014968 Ga0157379_10000115 Ga0157379_1000011551 355
124 3300014969 Ga0157376_10004633 Ga0157376_100046336 355
125 3300017792 Ga0163161_10169507 Ga0163161_101695072 355
126 3300025321 Ga0207656_10001813 Ga0207656_100018136 355
127 3300025907 Ga0207645_10001052 Ga0207645_1000105221 355
128 3300025909 Ga0207705_10008349 Ga0207705_100083497 355
129 3300025926 Ga0207659_10173062 Ga0207659_101730622 355
130 3300025938 Ga0207704_10000955 Ga0207704_100009553 355
131 3300025940 Ga0207691_10000673 Ga0207691_1000067316 355
132 3300025942 Ga0207689_10030935 Ga0207689_100309356 355
133 3300025961 Ga0207712_10045496 Ga0207712_100454964 355
134 3300025972 Ga0207668_10003855 Ga0207668_100038557 355
135 3300025986 Ga0207658_10005210 Ga0207658_100052107 355
136 3300026023 Ga0207677_10005874 Ga0207677_100058747 355
137 3300026035 Ga0207703_10006076 Ga0207703_100060767 355
138 3300026089 Ga0207648_10005503 Ga0207648_100055039 355
139 3300026095 Ga0207676_10004887 Ga0207676_100048873 355
140 3300026118 Ga0207675_100159378 Ga0207675_1001593782 355
141 3300028379 Ga0268266_10019825 Ga0268266_100198257 355
142 3300028794 Ga0307515_10000059 Ga0307515_10000059166 355
143 3300048912 Ga0496109_0037628 Ga0496109_0037628_1366_2436 355
144 3300053153 Ga0500616_0004133 Ga0500616_0004133_8473_9549 355
145 3300009094 Ga0111539_10065199 Ga0111539_100651992 356
146 3300013306 Ga0163162_10022294 Ga0163162_100222942 356
147 3300014969 Ga0157376_10131432 Ga0157376_101314322 356
148 3300026121 Ga0207683_10091532 Ga0207683_100915322 356
149 3300050511 nmdc:mga08y16_32241_c1 nmdc:mga08y16_32241_c1_2526_3605 356
150 3300005331 Ga0070670_100217250 Ga0070670_1002172501 357
151 3300005354 Ga0070675_100073933 Ga0070675_1000739332 357
152 3300005356 Ga0070674_100049288 Ga0070674_1000492884 357
153 3300005543 Ga0070672_100014302 Ga0070672_1000143024 357
154 3300009176 Ga0105242_10165687 Ga0105242_101656872 357
155 3300014325 Ga0163163_10417822 Ga0163163_104178222 357
156 3300017792 Ga0163161_10111731 Ga0163161_101117312 357
157 3300025893 Ga0207682_10017546 Ga0207682_100175462 357
158 3300025913 Ga0207695_10001230 Ga0207695_1000123019 357
159 3300025914 Ga0207671_10000931 Ga0207671_1000093118 357
160 3300025940 Ga0207691_10004686 Ga0207691_100046868 357
161 3300005329 Ga0070683_100006422 Ga0070683_1000064224 358
162 3300005337 Ga0070682_100005089 Ga0070682_1000050897 358
163 3300005341 Ga0070691_10019242 Ga0070691_100192423 358
164 3300005535 Ga0070684_100011294 Ga0070684_1000112946 358
165 3300005539 Ga0068853_100047246 Ga0068853_1000472462 358
166 3300005539 Ga0068853_100066380 Ga0068853_1000663802 358
167 3300005547 Ga0070693_100012647 Ga0070693_1000126475 358
168 3300005563 Ga0068855_100001870 Ga0068855_10000187023 358
169 3300005563 Ga0068855_100145313 Ga0068855_1001453132 358
170 3300005578 Ga0068854_100012243 Ga0068854_1000122436 358
171 3300005843 Ga0068860_100001937 Ga0068860_1000019375 358
172 3300005983 Ga0081540_1010602 Ga0081540_10106023 358
173 3300009093 Ga0105240_10004358 Ga0105240_1000435818 358
174 3300009093 Ga0105240_10006347 Ga0105240_1000634718 358
175 3300009174 Ga0105241_10007807 Ga0105241_100078079 358
176 3300009545 Ga0105237_10226961 Ga0105237_102269611 358
177 3300009545 Ga0105237_10250190 Ga0105237_102501902 358
178 3300013104 Ga0157370_10046734 Ga0157370_100467342 358
179 3300013105 Ga0157369_10117068 Ga0157369_101170682 358
180 3300013306 Ga0163162_10000131 Ga0163162_1000013162 358
181 3300013307 Ga0157372_10087512 Ga0157372_100875122 358
182 3300013307 Ga0157372_10477091 Ga0157372_104770912 358
183 3300025912 Ga0207707_10000747 Ga0207707_100007472 358
184 3300025913 Ga0207695_10000087 Ga0207695_1000008746 358
185 3300025919 Ga0207657_10080469 Ga0207657_100804693 358
186 3300025921 Ga0207652_10025159 Ga0207652_100251592 358
187 3300025924 Ga0207694_10237971 Ga0207694_102379712 358
188 3300025944 Ga0207661_10002997 Ga0207661_100029978 358
189 3300025949 Ga0207667_10000279 Ga0207667_1000027946 358
190 3300025981 Ga0207640_10076602 Ga0207640_100766022 358
191 3300026041 Ga0207639_10060563 Ga0207639_100605632 358
192 3300026041 Ga0207639_10214035 Ga0207639_102140352 358
193 3300028381 Ga0268264_10001477 Ga0268264_100014774 358
194 3300005328 Ga0070676_10062208 Ga0070676_100622082 359
195 3300005330 Ga0070690_100055466 Ga0070690_1000554662 359
196 3300005335 Ga0070666_10015838 Ga0070666_100158383 359
197 3300005354 Ga0070675_100096844 Ga0070675_1000968441 359
198 3300005355 Ga0070671_100126311 Ga0070671_1001263112 359
199 3300005356 Ga0070674_100046910 Ga0070674_1000469103 359
200 3300005364 Ga0070673_100038335 Ga0070673_1000383353 359
201 3300005441 Ga0070700_100029929 Ga0070700_1000299293 359
202 3300005548 Ga0070665_100000014 Ga0070665_100000014229 359
203 3300005577 Ga0068857_100004870 Ga0068857_1000048709 359
204 3300005615 Ga0070702_100006737 Ga0070702_1000067373 359
205 3300005616 Ga0068852_100021526 Ga0068852_1000215262 359
206 3300005618 Ga0068864_100115888 Ga0068864_1001158882 359
207 3300005843 Ga0068860_100000061 Ga0068860_10000006131 359
208 3300009093 Ga0105240_10000800 Ga0105240_1000080049 359
209 3300009093 Ga0105240_10027103 Ga0105240_100271034 359
210 3300009093 Ga0105240_10063561 Ga0105240_100635614 359
211 3300009093 Ga0105240_10117575 Ga0105240_101175751 359
212 3300009174 Ga0105241_10000608 Ga0105241_1000060817 359
213 3300009545 Ga0105237_10022971 Ga0105237_100229714 359
214 3300009545 Ga0105237_10046681 Ga0105237_100466814 359
215 3300009551 Ga0105238_10001710 Ga0105238_100017106 359
216 3300010375 Ga0105239_10004672 Ga0105239_1000467215 359
217 3300013104 Ga0157370_10005564 Ga0157370_100055646 359
218 3300013105 Ga0157369_10037219 Ga0157369_100372193 359
219 3300013296 Ga0157374_10000011 Ga0157374_10000011323 359
220 3300013297 Ga0157378_10005523 Ga0157378_100055232 359
221 3300013297 Ga0157378_10217717 Ga0157378_102177171 359
222 3300013306 Ga0163162_10102489 Ga0163162_101024892 359
223 3300013307 Ga0157372_10005438 Ga0157372_100054383 359
224 3300013307 Ga0157372_10012118 Ga0157372_100121188 359
225 3300014968 Ga0157379_10137965 Ga0157379_101379652 359
226 3300014968 Ga0157379_10158902 Ga0157379_101589022 359
227 3300014969 Ga0157376_10007481 Ga0157376_100074818 359
228 3300025903 Ga0207680_10005400 Ga0207680_100054003 359
229 3300025907 Ga0207645_10071121 Ga0207645_100711214 359
230 3300025911 Ga0207654_10008261 Ga0207654_100082612 359
231 3300025913 Ga0207695_10016157 Ga0207695_100161578 359
232 3300025914 Ga0207671_10006637 Ga0207671_100066374 359
233 3300025914 Ga0207671_10014628 Ga0207671_100146284 359
234 3300025926 Ga0207659_10063943 Ga0207659_100639434 359
235 3300025949 Ga0207667_10000098 Ga0207667_1000009882 359
236 3300025949 Ga0207667_10095108 Ga0207667_100951083 359
237 3300026089 Ga0207648_10009112 Ga0207648_100091128 359
238 3300026116 Ga0207674_10000969 Ga0207674_1000096915 359
239 3300028379 Ga0268266_10000068 Ga0268266_10000068205 359
240 3300028381 Ga0268264_10000079 Ga0268264_10000079152 359
241 3300028381 Ga0268264_10007355 Ga0268264_100073554 359
242 3300030521 Ga0307511_10000201 Ga0307511_1000020140 359
243 3300031730 Ga0307516_10005469 Ga0307516_100054692 359
244 3300044658 Ga0466972_0041287 Ga0466972_0041287_913_2004 359
245 3300045049 Ga0466959_0009260 Ga0466959_0009260_1130_2212 359
246 3300046524 Ga0495648_0003136 Ga0495648_0003136_3836_4927 359
247 3300047443 Ga0495687_001838 Ga0495687_001838_5900_6991 359
248 3300053156 Ga0500622_0001733 Ga0500622_0001733_9119_10210 359
249 3300028786 Ga0307517_10005822 Ga0307517_100058222 360
250 3300031730 Ga0307516_10121643 Ga0307516_101216432 360
251 3300046460 Ga0495638_0028216 Ga0495638_0028216_1428_2522 360
252 3300003320 rootH2_10001613 rootH2_1000161311 361
253 3300003320 rootH2_10001614 rootH2_1000161411 361
254 3300009545 Ga0105237_10000229 Ga0105237_100002292 361
255 3300025914 Ga0207671_10001508 Ga0207671_100015082 361
256 3300031507 Ga0307509_10110788 Ga0307509_101107883 361
257 3300046648 Ga0495611_0000026 Ga0495611_0000026_8496_9620 361

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13715

CarbopepD_reg_2

CarboxypepD_reg-like domain

70

155

0.95

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

69

144

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5aq0-assembly1.cif.gz_A the structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d 0.8842 28 105
1qmu-assembly1.cif.gz_A duck carboxypeptidase d domain ii 0.8476 28 105
5aq0-assembly1.cif.gz_A the structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d 0.8443 28 105
2nsm-assembly1.cif.gz_A crystal structure of the human carboxypeptidase n (kininase i) catalytic domain 0.8389 28 105
3mn8-assembly3.cif.gz_C structure of drosophila melanogaster carboxypeptidase d isoform 1b short 0.8031 28 105
ID Description Score Start End Superfamily
af_Q9JHW1_795_903_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.9034 28 105 2.60.40.1120
af_E7FFQ7_717_794_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8972 28 105 2.60.40.1120
af_O75976_383_462_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8923 28 105 2.60.40.1120
af_E7FFQ7_717_794_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8866 28 105 2.60.40.1120
af_P91359_377_465_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8809 28 106 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A3P1CKP4-F1-model_v4 TonB-dependent receptor 0.9491 25 106 GO:0009279
GO:0015344
AF-A0A371QIP5-F1-model_v4 Carboxypeptidase-like regulatory domain-containing protein 0.9481 27 106 GO:0004180
AF-A0A7W1QM96-F1-model_v4 Carboxypeptidase-like regulatory domain-containing protein 0.938 22 88 GO:0004180
AF-A0A2V7Q1H6-F1-model_v4 SusC/RagA family TonB-linked outer membrane protein 0.9326 25 104 GO:0009279
GO:0015344
AF-A0A4Q7N371-F1-model_v4 TonB-linked SusC/RagA family outer membrane protein 0.9264 27 104 GO:0009279

Feature Viewer

pLDDT pTM Quality
75.33 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map