F366592

General Info

Members Datasets Scaffolds Average Seq Length
256 168 512 243

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10025498|Ga0265323_100254982
Length 279
Sequence MARHFPQKWGLRRGVNPAPCFFRAMMTIERKPPLGKKVQLMATCLCDAFYDDAAVATVQVLEHLGLTVEFPEAQICCGQPAFNAGDWAASRRVARHMVSTFKGELPVIVPSSSCAAMVFHGSLLAFEHEPDLPAVEQLAQRTWELADFIVHGLGVTAWPGRFEAAIAFHRSCHTRGSNSAEAAATLMRSISGLNLVEFGEAEQCCGFGGTFSVSFPHISEAMGRLKLQHLRAAQPQIVVGVDTSCLMHLGGLAEKDGQPIKHLHVAQVLRDALKNGGLL

Samples

Sample ID Description Type Environment
1 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
21 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
22 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
46 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
51 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
52 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
53 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
54 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
55 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
56 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
78 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
79 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
82 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
96 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
97 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
98 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
108 2554235283 Bacillus safensis VK Isolate Rhizosphere
109 2643221729 Bacillus sp. Root11 Isolate Unclassified
110 2643221730 Bacillus sp. Root131 Isolate Unclassified
111 2643221731 Bacillus sp. Root147 Isolate Unclassified
112 2643221732 Bacillus sp. Root239 Isolate Unclassified
113 2643221735 Bacillus sp. Root920 Isolate Unclassified
114 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
115 2684622632 Bacillus cereus 905 Isolate Unclassified
116 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
117 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
118 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
119 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
120 2738541358 Bacillus sp. OV752 Isolate Unclassified
121 2738543006 Bacillus sp. OK077 Isolate Unclassified
122 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
123 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
124 2811994870 Bacillus sp. JB4 Isolate Unclassified
125 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
126 2818991441 Niallia circulans 3243 Isolate Rhizosphere
127 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
128 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
129 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
130 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
131 2842682962 Bacillus sp. R-72492 Isolate Unclassified
132 2842882022 Bacillus sp. R-71893 Isolate Unclassified
133 2849139964 Bacillus sp. R-71875 Isolate Unclassified
134 2857581216 Bacillus sp. R-71922 Isolate Unclassified
135 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
136 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
137 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
138 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
139 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
140 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
141 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
142 2919720352 Priestia megaterium 4340 Isolate Unclassified
143 2919726948 Bacillus pumilus 4489 Isolate Unclassified
144 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
145 2929004312 Priestia megaterium 1104 Isolate Unclassified
146 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
147 2938917290 Bacillus sp. CR71 Isolate Unclassified
148 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
149 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
150 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
151 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
152 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
153 2965761152 Bacillus sp. COPE52 Isolate Unclassified
154 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
155 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
156 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
157 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
158 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
159 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
160 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
161 8022792930 Bacillus sp. Xin Isolate Rhizosphere
162 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
163 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
164 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
165 8023438354 Bacillus sp. BH2 Isolate Unclassified
166 8023444577 Bacillus sp. BH32 Isolate Unclassified
167 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
168 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75
Metatranscriptomes 0.78
Isolates 24.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.33
Nodule 0
Rhizoplane 6.64
Rhizosphere 60.16
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265323_10025498 3300028653 Bacteria 2236
2 JGI24033J26618_1000177 3300002155 Bacteria 7807
3 JGI25159J45721_1014124 3300002987 Bacteria 1817
4 JGI25159J45721_1020174 3300002987 Bacteria 1292
5 JGI25151J46595_10000012 3300003187 Bacteria 254028
6 JGI25151J46595_10001358 3300003187 Bacteria 16946
7 JGI25151J46595_10001910 3300003187 Bacteria 13231
8 JGI25151J46595_10030395 3300003187 Bacteria 2125
9 JGI25151J46595_10037543 3300003187 Bacteria 1815
10 rootH1_10011350 3300003316 Bacteria 16310
11 rootH2_10068500 3300003320 Bacteria 8125
12 rootH2_10254517 3300003320 Bacteria 1219
13 rootL2_10019319 3300003322 Bacteria 26434
14 rootH1_10195542 3300003323 Bacteria 4088
15 rootH1_10250351 3300003323 Bacteria 2277
16 Ga0006562J51391_1001573 3300003578 Bacteria 9980
17 Ga0006562J51391_1007014 3300003578 Bacteria 7430
18 Ga0055528_1003493 3300003790 Bacteria 7841
19 Ga0070676_10074383 3300005328 Bacteria 2046
20 Ga0070675_100318852 3300005354 Bacteria 1373
21 Ga0070671_100096937 3300005355 Bacteria 2473
22 Ga0070693_100335420 3300005547 Bacteria 1030
23 Ga0068857_100024488 3300005577 Bacteria 5314
24 Ga0068856_100017654 3300005614 Bacteria 6917
25 Ga0068864_100111698 3300005618 Bacteria 2435
26 Ga0068863_100012774 3300005841 Bacteria 8097
27 Ga0070717_10000029 3300006028 Bacteria 143008
28 Ga0105251_10021771 3300009011 Bacteria 3340
29 Ga0105251_10165360 3300009011 Bacteria 997
30 Ga0105244_10008527 3300009036 Bacteria 6394
31 Ga0105244_10017966 3300009036 Bacteria 3980
32 Ga0105244_10136649 3300009036 Bacteria 1181
33 Ga0105244_10206764 3300009036 Bacteria 924
34 Ga0105244_10278444 3300009036 Bacteria 776
35 Ga0105250_10001293 3300009092 Bacteria 13737
36 Ga0105250_10096306 3300009092 Bacteria 1206
37 Ga0105250_10134120 3300009092 Bacteria 1023
38 Ga0105245_10070044 3300009098 Bacteria 3181
39 Ga0105243_10038346 3300009148 Bacteria 3732
40 Ga0105246_10009271 3300011119 Bacteria 6061
41 Ga0105246_10021859 3300011119 Bacteria 4122
42 Ga0157374_10015715 3300013296 Bacteria 6646
43 Ga0157374_10221661 3300013296 Bacteria 1856
44 Ga0157378_10004929 3300013297 Bacteria 11698
45 Ga0157375_10014731 3300013308 Bacteria 6988
46 Ga0163163_10005949 3300014325 Bacteria 10613
47 Ga0163163_10496981 3300014325 Bacteria 1282
48 Ga0209147_101694 3300025229 Bacteria 7192
49 Ga0209147_102497 3300025229 Bacteria 4513
50 Ga0209673_1002552 3300025273 Bacteria 12431
51 Ga0209130_1000643 3300025284 Bacteria 32629
52 Ga0209130_1001763 3300025284 Bacteria 12811
53 Ga0209130_1008159 3300025284 Bacteria 3125
54 Ga0209130_1010653 3300025284 Bacteria 2516
55 Ga0209676_1008823 3300025292 Bacteria 4436
56 Ga0209025_1000001 3300025294 Bacteria 1888151
57 Ga0209025_1000457 3300025294 Bacteria 79829
58 Ga0209025_1000722 3300025294 Bacteria 56052
59 Ga0209025_1001182 3300025294 Bacteria 36937
60 Ga0209025_1001731 3300025294 Bacteria 26322
61 Ga0209025_1006419 3300025294 Bacteria 9136
62 Ga0209025_1007033 3300025294 Bacteria 8526
63 Ga0209025_1008151 3300025294 Bacteria 7597
64 Ga0209025_1009163 3300025294 Bacteria 6954
65 Ga0209025_1010222 3300025294 Bacteria 6393
66 Ga0209025_1011636 3300025294 Bacteria 5766
67 Ga0209025_1033617 3300025294 Bacteria 2365
68 Ga0207426_1024946 3300025302 Bacteria 2021
69 Ga0207696_1018279 3300025711 Bacteria 2305
70 Ga0207696_1020313 3300025711 Bacteria 2146
71 Ga0207696_1025042 3300025711 Bacteria 1865
72 Ga0207655_1025556 3300025728 Bacteria 2863
73 Ga0207655_1055131 3300025728 Bacteria 1576
74 Ga0207713_1008696 3300025735 Bacteria 5802
75 Ga0207713_1046602 3300025735 Bacteria 1762
76 Ga0207713_1060850 3300025735 Bacteria 1440
77 Ga0207713_1137979 3300025735 Bacteria 799
78 Ga0207649_10000125 3300025920 Bacteria 64941
79 Ga0207644_10311788 3300025931 Bacteria 1270
80 Ga0207702_10001384 3300026078 Bacteria 24187
81 Ga0207641_10043682 3300026088 Bacteria 3765
82 Ga0209973_1026218 3300027252 Bacteria 802
83 Ga0265337_1001044 3300028556 Bacteria 14322
84 Ga0265319_1000462 3300028563 Bacteria 28799
85 Ga0265319_1002473 3300028563 Bacteria 10080
86 Ga0265319_1014970 3300028563 Bacteria 3024
87 Ga0265319_1034525 3300028563 Bacteria 1739
88 Ga0265334_10007951 3300028573 Bacteria 4531
89 Ga0265318_10000573 3300028577 Bacteria 25932
90 Ga0265318_10001341 3300028577 Bacteria 14703
91 Ga0265318_10009854 3300028577 Bacteria 4186
92 Ga0265318_10057061 3300028577 Bacteria 1459
93 Ga0265323_10000004 3300028653 Bacteria 197761
94 Ga0265323_10005143 3300028653 Bacteria 5573
95 Ga0265323_10008177 3300028653 Bacteria 4326
96 Ga0265323_10015043 3300028653 Bacteria 3047
97 Ga0265323_10016299 3300028653 Bacteria 2904
98 Ga0265322_10000123 3300028654 Bacteria 35716
99 Ga0265322_10004712 3300028654 Bacteria 4051
100 Ga0265338_10000416 3300028800 Bacteria 76329
101 Ga0265338_10003487 3300028800 Bacteria 22101
102 Ga0265324_10002051 3300029957 Bacteria 10698
103 Ga0237817_10021 3300030083 Bacteria 63280
104 Ga0237817_10040 3300030083 Bacteria 44341
105 Ga0265330_10000130 3300031235 Bacteria 60078
106 Ga0265330_10030284 3300031235 Bacteria 2431
107 Ga0265328_10013238 3300031239 Bacteria 3270
108 Ga0265320_10000108 3300031240 Bacteria 71696
109 Ga0265320_10000120 3300031240 Bacteria 68719
110 Ga0265320_10001557 3300031240 Bacteria 16541
111 Ga0265320_10003176 3300031240 Bacteria 11143
112 Ga0265320_10045517 3300031240 Bacteria 2155
113 Ga0265325_10001532 3300031241 Bacteria 16176
114 Ga0265325_10021092 3300031241 Bacteria 3584
115 Ga0265325_10059788 3300031241 Bacteria 1937
116 Ga0265329_10000121 3300031242 Bacteria 36998
117 Ga0265329_10070897 3300031242 Bacteria 1102
118 Ga0265340_10009773 3300031247 Bacteria 5143
119 Ga0265340_10015883 3300031247 Bacteria 3905
120 Ga0265339_10001091 3300031249 Bacteria 20585
121 Ga0265331_10000764 3300031250 Bacteria 26866
122 Ga0265327_10000037 3300031251 Bacteria 293502
123 Ga0265316_10006411 3300031344 Bacteria 11242
124 Ga0265316_10007873 3300031344 Bacteria 9973
125 Ga0265316_10023854 3300031344 Bacteria 5137
126 Ga0265316_10063480 3300031344 Bacteria 2864
127 Ga0265316_10072294 3300031344 Bacteria 2657
128 Ga0265316_10111400 3300031344 Bacteria 2072
129 Ga0265316_10139835 3300031344 Bacteria 1819
130 Ga0265316_10180237 3300031344 Bacteria 1573
131 Ga0265316_10341994 3300031344 Bacteria 1084
132 Ga0307408_100000833 3300031548 Bacteria 24441
133 Ga0265313_10000128 3300031595 Bacteria 76766
134 Ga0265313_10011589 3300031595 Bacteria 5468
135 Ga0265314_10001019 3300031711 Bacteria 32654
136 Ga0265314_10184294 3300031711 Bacteria 1248
137 Ga0265342_10000737 3300031712 Bacteria 33604
138 Ga0265342_10002458 3300031712 Bacteria 15973
139 Ga0265342_10010136 3300031712 Bacteria 6568
140 Ga0265342_10035123 3300031712 Bacteria 3071
141 Ga0265342_10037064 3300031712 Bacteria 2976
142 Ga0265342_10070792 3300031712 Bacteria 2033
143 Ga0265342_10075024 3300031712 Bacteria 1963
144 Ga0265342_10214232 3300031712 Bacteria 1040
145 Ga0307410_10086628 3300031852 Bacteria 2213
146 Ga0307406_10011483 3300031901 Bacteria 5029
147 Ga0307409_100000244 3300031995 Bacteria 21939
148 Ga0316574_0052160 3300035398 Bacteria 2550
149 Ga0316574_0136887 3300035398 Unclassified 1577
150 Ga0451577_0013266 3300042876 Bacteria 7721
151 Ga0466957_0021203 3300044842 Bacteria 3827
152 Ga0451576_0003259 3300045051 Bacteria 22524
153 Ga0466967_0003627 3300045976 Bacteria 10143
154 Ga0466967_0046640 3300045976 Bacteria 3774
155 Ga0495603_0268057 3300046455 Bacteria 982
156 Ga0495607_0110772 3300046501 Bacteria 1456
157 Ga0495630_0071490 3300046517 Bacteria 2611
158 Ga0495622_0021808 3300046557 Bacteria 2983
159 Ga0495589_0134321 3300046794 Bacteria 1187
160 Ga0495660_0125239 3300046810 Bacteria 1295
161 Ga0495676_0335199 3300047321 Bacteria 1014
162 Ga0496100_0002231 3300048903 Bacteria 9785
163 Ga0496101_0012703 3300048904 Bacteria 5627
164 Ga0496102_0513581 3300048905 Bacteria 1120
165 Ga0496103_0003980 3300048906 Bacteria 8972
166 Ga0496104_0004233 3300048907 Bacteria 12461
167 Ga0496104_0138145 3300048907 Bacteria 2342
168 Ga0496105_0002073 3300048908 Bacteria 14504
169 Ga0496106_0000227 3300048909 Bacteria 39343
170 Ga0496107_0000148 3300048910 Bacteria 35455
171 Ga0496108_0001890 3300048911 Bacteria 16782
172 Ga0496109_0001825 3300048912 Bacteria 17687
173 Ga0496110_0000495 3300048913 Bacteria 26775
174 Ga0496111_0004563 3300048914 Bacteria 8770
175 Ga0496112_0003496 3300048915 Bacteria 13016
176 Ga0496112_0014240 3300048915 Bacteria 7370
177 Ga0496113_0013685 3300048916 Bacteria 5508
178 Ga0496113_0389809 3300048916 Bacteria 1118
179 Ga0496116_0032390 3300048919 Bacteria 3725
180 Ga0496116_0217183 3300048919 Bacteria 984
181 Ga0496117_0091193 3300048920 Bacteria 1961
182 Ga0496122_0018018 3300048925 Bacteria 6549
183 Ga0496123_0041003 3300048926 Bacteria 3216
184 Ga0496124_0030829 3300048927 Bacteria 4752
185 Ga0496125_0000837 3300048928 Bacteria 49469
186 Ga0496125_0013453 3300048928 Bacteria 8040
187 Ga0501033_0000002 3300049570 Bacteria 668574
188 Ga0501033_0000122 3300049570 Bacteria 75161
189 Ga0501038_0026618 3300049574 Bacteria 5150
190 Ga0501067_0221233 3300049583 Bacteria 1054
191 Ga0501083_0000715 3300049744 Bacteria 21644
192 Ga0501044_0029845 3300049823 Bacteria 5749
193 Ga0501044_0400647 3300049823 Bacteria 1285
194 Ga0501082_0016155 3300060353 Bacteria 6423
195 2553393994 2551306519 Bacteria 5465154
196 2555470304 2554235283 Bacteria 3683090
197 2644703797 2643221729 Bacteria 6621700
198 2644708489 2643221730 Bacteria 6523787
199 2644719528 2643221731 Bacteria 5623886
200 2644722031 2643221732 Bacteria 5756404
201 2644740123 2643221735 Bacteria 3676263
202 2672337306 2671180330 Bacteria 5521719
203 2685149222 2684622632 Bacteria 5380049
204 2686996940 2684623153 Bacteria 3878815
205 2687498244 2687453109 Bacteria 3860091
206 2698323957 2695420987 Bacteria 6152737
207 2721504604 2718218445 Bacteria 5113413
208 2739156435 2738541358 Bacteria 5932299
209 2739210047 2738543006 Bacteria 5904091
210 2787507496 2786546548 Bacteria 4745694
211 2791212969 2788500588 Bacteria 4584915
212 2812316127 2811994870 Bacteria 3776934
213 2816862271 2816332186 Bacteria 5331395
214 2819570010 2818991441 Bacteria 5062707
215 2819579626 2818991443 Bacteria 6598732
216 2819708271 2818991465 Bacteria 5388835
217 2819724869 2818991468 Bacteria 3723169
218 2823528092 2823526263 Bacteria 3765752
219 2842684814 2842682962 Bacteria 5589973
220 2842885485 2842882022 Bacteria 6158489
221 2849141370 2849139964 Bacteria 5613304
222 2857585448 2857581216 Bacteria 5522813
223 2904527922 2904524088 Bacteria 5887454
224 2904607301 2904606771 Bacteria 4684500
225 2908665635 2908665501 Bacteria 3678115
226 2919094259 2919093281 Bacteria 3660974
227 2919148002 2919143609 Bacteria 6219228
228 2919414515 2919414237 Bacteria 5429133
229 2919521033 2919517244 Bacteria 5858162
230 2919724245 2919720352 Bacteria 5986006
231 2919728927 2919726948 Bacteria 3696050
232 2928097727 2928093941 Bacteria 5965005
233 2929004875 2929004312 Bacteria 5678476
234 2929234492 2929233124 Bacteria 5948380
235 2938918673 2938917290 Bacteria 5914775
236 2947428041 2947426588 Bacteria 5357194
237 2954774402 2954773129 Bacteria 3741715
238 2956897890 2956897341 Bacteria 5447711
239 2960322424 2960319331 Bacteria 5502575
240 2960381327 2960375949 Bacteria 5361395
241 2965762523 2965761152 Bacteria 5806513
242 2979084953 2979083700 Bacteria 5894929
243 2990276822 2990275345 Bacteria 4887158
244 3001271359 3001267043 Bacteria 4823521
245 3001893226 3001892409 Bacteria 6328293
246 3006828202 3006826541 Bacteria 4678913
247 3006973647 3006969106 Bacteria 4739423
248 8022622456 8022621104 Bacteria 5241040
249 8022798337 8022792930 Bacteria 5693794
250 8022893871 8022893055 Bacteria 5300455
251 8022915759 8022914991 Bacteria 5584517
252 8022951604 8022948649 Bacteria 5366783
253 8023442654 8023438354 Bacteria 5779374
254 8023449513 8023444577 Bacteria 5661597
255 8055536529 8055531788 Bacteria 5249694
256 8057584041 8057582654 Bacteria 5218944
257 Ga0265323_10025498
258 JGI24033J26618_1000177
259 JGI25159J45721_1014124
260 JGI25159J45721_1020174
261 JGI25151J46595_10000012
262 JGI25151J46595_10001358
263 JGI25151J46595_10001910
264 JGI25151J46595_10030395
265 JGI25151J46595_10037543
266 rootH1_10011350
267 rootH2_10068500
268 rootH2_10254517
269 rootL2_10019319
270 rootH1_10195542
271 rootH1_10250351
272 Ga0006562J51391_1001573
273 Ga0006562J51391_1007014
274 Ga0055528_1003493
275 Ga0070676_10074383
276 Ga0070675_100318852
277 Ga0070671_100096937
278 Ga0070693_100335420
279 Ga0068857_100024488
280 Ga0068856_100017654
281 Ga0068864_100111698
282 Ga0068863_100012774
283 Ga0070717_10000029
284 Ga0105251_10021771
285 Ga0105251_10165360
286 Ga0105244_10008527
287 Ga0105244_10017966
288 Ga0105244_10136649
289 Ga0105244_10206764
290 Ga0105244_10278444
291 Ga0105250_10001293
292 Ga0105250_10096306
293 Ga0105250_10134120
294 Ga0105245_10070044
295 Ga0105243_10038346
296 Ga0105246_10009271
297 Ga0105246_10021859
298 Ga0157374_10015715
299 Ga0157374_10221661
300 Ga0157378_10004929
301 Ga0157375_10014731
302 Ga0163163_10005949
303 Ga0163163_10496981
304 Ga0209147_101694
305 Ga0209147_102497
306 Ga0209673_1002552
307 Ga0209130_1000643
308 Ga0209130_1001763
309 Ga0209130_1008159
310 Ga0209130_1010653
311 Ga0209676_1008823
312 Ga0209025_1000001
313 Ga0209025_1000457
314 Ga0209025_1000722
315 Ga0209025_1001182
316 Ga0209025_1001731
317 Ga0209025_1006419
318 Ga0209025_1007033
319 Ga0209025_1008151
320 Ga0209025_1009163
321 Ga0209025_1010222
322 Ga0209025_1011636
323 Ga0209025_1033617
324 Ga0207426_1024946
325 Ga0207696_1018279
326 Ga0207696_1020313
327 Ga0207696_1025042
328 Ga0207655_1025556
329 Ga0207655_1055131
330 Ga0207713_1008696
331 Ga0207713_1046602
332 Ga0207713_1060850
333 Ga0207713_1137979
334 Ga0207649_10000125
335 Ga0207644_10311788
336 Ga0207702_10001384
337 Ga0207641_10043682
338 Ga0209973_1026218
339 Ga0265337_1001044
340 Ga0265319_1000462
341 Ga0265319_1002473
342 Ga0265319_1014970
343 Ga0265319_1034525
344 Ga0265334_10007951
345 Ga0265318_10000573
346 Ga0265318_10001341
347 Ga0265318_10009854
348 Ga0265318_10057061
349 Ga0265323_10000004
350 Ga0265323_10005143
351 Ga0265323_10008177
352 Ga0265323_10015043
353 Ga0265323_10016299
354 Ga0265322_10000123
355 Ga0265322_10004712
356 Ga0265338_10000416
357 Ga0265338_10003487
358 Ga0265324_10002051
359 Ga0237817_10021
360 Ga0237817_10040
361 Ga0265330_10000130
362 Ga0265330_10030284
363 Ga0265328_10013238
364 Ga0265320_10000108
365 Ga0265320_10000120
366 Ga0265320_10001557
367 Ga0265320_10003176
368 Ga0265320_10045517
369 Ga0265325_10001532
370 Ga0265325_10021092
371 Ga0265325_10059788
372 Ga0265329_10000121
373 Ga0265329_10070897
374 Ga0265340_10009773
375 Ga0265340_10015883
376 Ga0265339_10001091
377 Ga0265331_10000764
378 Ga0265327_10000037
379 Ga0265316_10006411
380 Ga0265316_10007873
381 Ga0265316_10023854
382 Ga0265316_10063480
383 Ga0265316_10072294
384 Ga0265316_10111400
385 Ga0265316_10139835
386 Ga0265316_10180237
387 Ga0265316_10341994
388 Ga0307408_100000833
389 Ga0265313_10000128
390 Ga0265313_10011589
391 Ga0265314_10001019
392 Ga0265314_10184294
393 Ga0265342_10000737
394 Ga0265342_10002458
395 Ga0265342_10010136
396 Ga0265342_10035123
397 Ga0265342_10037064
398 Ga0265342_10070792
399 Ga0265342_10075024
400 Ga0265342_10214232
401 Ga0307410_10086628
402 Ga0307406_10011483
403 Ga0307409_100000244
404 Ga0316574_0052160
405 Ga0316574_0136887
406 Ga0451577_0013266
407 Ga0466957_0021203
408 Ga0451576_0003259
409 Ga0466967_0003627
410 Ga0466967_0046640
411 Ga0495603_0268057
412 Ga0495607_0110772
413 Ga0495630_0071490
414 Ga0495622_0021808
415 Ga0495589_0134321
416 Ga0495660_0125239
417 Ga0495676_0335199
418 Ga0496100_0002231
419 Ga0496101_0012703
420 Ga0496102_0513581
421 Ga0496103_0003980
422 Ga0496104_0004233
423 Ga0496104_0138145
424 Ga0496105_0002073
425 Ga0496106_0000227
426 Ga0496107_0000148
427 Ga0496108_0001890
428 Ga0496109_0001825
429 Ga0496110_0000495
430 Ga0496111_0004563
431 Ga0496112_0003496
432 Ga0496112_0014240
433 Ga0496113_0013685
434 Ga0496113_0389809
435 Ga0496116_0032390
436 Ga0496116_0217183
437 Ga0496117_0091193
438 Ga0496122_0018018
439 Ga0496123_0041003
440 Ga0496124_0030829
441 Ga0496125_0000837
442 Ga0496125_0013453
443 Ga0501033_0000002
444 Ga0501033_0000122
445 Ga0501038_0026618
446 Ga0501067_0221233
447 Ga0501083_0000715
448 Ga0501044_0029845
449 Ga0501044_0400647
450 Ga0501082_0016155
451 2553393994
452 2555470304
453 2644703797
454 2644708489
455 2644719528
456 2644722031
457 2644740123
458 2672337306
459 2685149222
460 2686996940
461 2687498244
462 2698323957
463 2721504604
464 2739156435
465 2739210047
466 2787507496
467 2791212969
468 2812316127
469 2816862271
470 2819570010
471 2819579626
472 2819708271
473 2819724869
474 2823528092
475 2842684814
476 2842885485
477 2849141370
478 2857585448
479 2904527922
480 2904607301
481 2908665635
482 2919094259
483 2919148002
484 2919414515
485 2919521033
486 2919724245
487 2919728927
488 2928097727
489 2929004875
490 2929234492
491 2938918673
492 2947428041
493 2954774402
494 2956897890
495 2960322424
496 2960381327
497 2965762523
498 2979084953
499 2990276822
500 3001271359
501 3001893226
502 3006828202
503 3006973647
504 8022622456
505 8022798337
506 8022893871
507 8022915759
508 8022951604
509 8023442654
510 8023449513
511 8055536529
512 8057584041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02754

CCG

Cysteine-rich domain

38

119

0.95

PF02754

CCG

Cysteine-rich domain

166

250

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.7678 12 251
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.764 10 251
7bkb-assembly1.cif.gz_B formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.7374 10 251
5odq-assembly1.cif.gz_B heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.7344 12 251
5ixm-assembly3.cif.gz_F the lps transporter lptde from yersinia pestis, core complex 0.6505 2 44
ID Description Score Start End Superfamily
af_P77252_3_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9506 14 89 3.40.30.10
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9332 142 224 3.40.30.10
af_P52074_170_256_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9042 14 91 3.40.30.10
af_P77252_132_217_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8926 142 224 3.40.30.10
af_P0A996_163_249_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.881 14 89 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A842HC25-F1-model_v4 (Fe-S)-binding protein 0.9908 16 250 GO:0005829
GO:0016491
AF-A0A2T6DZW7-F1-model_v4 (Fe-S)-binding protein 0.9884 16 251 GO:0005829
GO:0016491
AF-R7L4W7-F1-model_v4 Fe-S oxidoreductase 0.9836 7 250 GO:0005829
GO:0016491
AF-A0A2T6DZW7-F1-model_v4 (Fe-S)-binding protein 0.9761 16 251 GO:0005829
GO:0016491
AF-A0A1E5G6E4-F1-model_v4 Fe-S oxidoreductase 0.97 12 248 GO:0005829
GO:0016491

Map