F366251

General Info

Members Datasets Scaffolds Average Seq Length
256 206 512 148

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100969289|Ga0070668_1009692891
Length 148
Sequence MVDILHRIGVEGVTPDKVYDALTTVEGLAGWWTDDTKGTGDEVGGVVAFRFLPGGFDMEVTELKPSERVTWRVADGPEEWIGTTIDWHLRQDGDYTIVLFEHLGWKEPVEFMYHCSTKWGSYLLSLKSLLETGTGAPAPRDVMISDWH

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
96 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
107 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
108 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
171 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
177 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 2517572101 Frankia sp. DC12 Isolate Nodule
188 2643221616 Leifsonia sp. Root227 Isolate Unclassified
189 2671180195 Frankia sp. CcI49 Isolate Nodule
190 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
191 2687453737 Frankia sp. BMG5.36 Isolate Nodule
192 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
193 2773857922 Frankia sp. CcI49 Isolate Nodule
194 2841760612 Bosea sp. Tri-49 Isolate Nodule
195 2844104063 Bosea sp. Tri-39 Isolate Nodule
196 2851182111 Bosea sp. Tri-44 Isolate Nodule
197 2851246043 Bosea sp. Tri-54 Isolate Nodule
198 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
199 2858868258 Micromonospora sp. MH33 Isolate Unclassified
200 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
201 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
202 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
203 2902582711 Micromonospora sp. AP08 Isolate Unclassified
204 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
205 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
206 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.41
Metatranscriptomes 0.78
Isolates 7.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.98
Nodule 4.69
Rhizoplane 12.11
Rhizosphere 69.14
Stem 0
Stem Tuber 0.39
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100969289 3300005347 Bacteria 763
2 JGI25164J39214_1000530 3300002772 Bacteria 18007
3 JGI25159J45721_1005057 3300002987 Bacteria 4204
4 JGI25165J46597_1000004 3300003214 Bacteria 667510
5 JGI25165J46597_1000174 3300003214 Bacteria 100372
6 Ga0058860_11962021 3300004801 Bacteria 833
7 Ga0065165_1000410 3300005262 Bacteria 68475
8 Ga0070669_100302035 3300005353 Bacteria 1288
9 Ga0070674_100086518 3300005356 Bacteria 2252
10 Ga0070673_100262609 3300005364 Bacteria 1509
11 Ga0070688_100957132 3300005365 Bacteria 678
12 Ga0070659_101235884 3300005366 Bacteria 661
13 Ga0070709_10597871 3300005434 Bacteria 849
14 Ga0070714_101804783 3300005435 Bacteria 597
15 Ga0070701_10151259 3300005438 Bacteria 1337
16 Ga0070701_10962514 3300005438 Bacteria 593
17 Ga0070700_100514279 3300005441 Bacteria 923
18 Ga0068867_101324004 3300005459 Bacteria 665
19 Ga0070706_100015226 3300005467 Bacteria 7100
20 Ga0070706_101922044 3300005467 Bacteria 537
21 Ga0070707_100000314 3300005468 Bacteria 47490
22 Ga0070698_100302550 3300005471 Bacteria 1530
23 Ga0070699_100221227 3300005518 Bacteria 1687
24 Ga0070697_100026602 3300005536 Bacteria 4624
25 Ga0070696_101204079 3300005546 Bacteria 640
26 Ga0070704_100772034 3300005549 Bacteria 857
27 Ga0068855_100650790 3300005563 Bacteria 1132
28 Ga0070664_101313341 3300005564 Bacteria 683
29 Ga0068859_100510408 3300005617 Bacteria 1297
30 Ga0068864_100321115 3300005618 Bacteria 1454
31 Ga0068866_10021649 3300005718 Bacteria 2965
32 Ga0068861_100154749 3300005719 Bacteria 1884
33 Ga0068861_100955514 3300005719 Bacteria 815
34 Ga0068863_100056411 3300005841 Bacteria 3719
35 Ga0068863_100166471 3300005841 Bacteria 2114
36 Ga0068858_101095028 3300005842 Bacteria 782
37 Ga0068860_100913630 3300005843 Bacteria 894
38 Ga0075363_100590632 3300006048 Bacteria 665
39 Ga0075364_10000946 3300006051 Bacteria 15320
40 Ga0075364_10472559 3300006051 Bacteria 857
41 Ga0070716_100291275 3300006173 Bacteria 1131
42 Ga0070712_100881388 3300006175 Bacteria 771
43 Ga0075366_10378707 3300006195 Bacteria 870
44 Ga0097621_100238372 3300006237 Bacteria 1589
45 Ga0075370_10438791 3300006353 Bacteria 785
46 Ga0068871_100041858 3300006358 Bacteria 3675
47 Ga0075431_100507454 3300006847 Bacteria 1196
48 Ga0068865_100089230 3300006881 Bacteria 2232
49 Ga0097620_100510388 3300006931 Bacteria 1297
50 Ga0099794_10011991 3300007265 Bacteria 3727
51 Ga0099794_10443089 3300007265 Bacteria 681
52 Ga0111539_10295612 3300009094 Bacteria 1885
53 Ga0105245_11099446 3300009098 Bacteria 841
54 Ga0105247_10168803 3300009101 Bacteria 1453
55 Ga0105243_10020747 3300009148 Bacteria 4985
56 Ga0105243_10073892 3300009148 Bacteria 2764
57 Ga0105242_10003832 3300009176 Bacteria 11694
58 Ga0105248_10127398 3300009177 Bacteria 2872
59 Ga0105248_11640145 3300009177 Bacteria 729
60 Ga0105248_12077192 3300009177 Bacteria 646
61 Ga0105237_10953971 3300009545 Bacteria 865
62 Ga0105238_12283095 3300009551 Bacteria 576
63 Ga0105249_10989046 3300009553 Bacteria 910
64 Ga0105246_10136510 3300011119 Bacteria 1839
65 Ga0157369_12274036 3300013105 Bacteria 550
66 Ga0157374_10745421 3300013296 Bacteria 994
67 Ga0157374_11195890 3300013296 Bacteria 781
68 Ga0157378_10215810 3300013297 Bacteria 1821
69 Ga0157375_10022621 3300013308 Bacteria 5787
70 Ga0157375_10710030 3300013308 Bacteria 1159
71 Ga0163163_10599135 3300014325 Bacteria 1165
72 Ga0163163_10704723 3300014325 Bacteria 1073
73 Ga0163163_10773481 3300014325 Bacteria 1023
74 Ga0157380_10275845 3300014326 Bacteria 1535
75 Ga0157380_11465589 3300014326 Bacteria 735
76 Ga0157379_10131034 3300014968 Bacteria 2257
77 Ga0157379_10232640 3300014968 Bacteria 1671
78 Ga0157376_10098302 3300014969 Bacteria 2551
79 Ga0207427_100010 3300025231 Bacteria 648610
80 Ga0209437_100290 3300025233 Bacteria 72971
81 Ga0209233_1000001 3300025261 Bacteria 2992747
82 Ga0207666_1018893 3300025271 Bacteria 1003
83 Ga0209130_1000130 3300025284 Bacteria 121749
84 Ga0207426_1018649 3300025302 Bacteria 2441
85 Ga0207697_10109231 3300025315 Bacteria 1184
86 Ga0207642_10013685 3300025899 Bacteria 2968
87 Ga0207688_10261875 3300025901 Bacteria 1050
88 Ga0207684_10040803 3300025910 Bacteria 3935
89 Ga0207671_10378536 3300025914 Bacteria 1124
90 Ga0207646_10000022 3300025922 Bacteria 259328
91 Ga0207681_11152699 3300025923 Bacteria 651
92 Ga0207659_11393692 3300025926 Bacteria 601
93 Ga0207687_10027995 3300025927 Bacteria 3784
94 Ga0207664_11205526 3300025929 Bacteria 675
95 Ga0207709_10069830 3300025935 Bacteria 2225
96 Ga0207709_10169711 3300025935 Bacteria 1530
97 Ga0207669_10126476 3300025937 Bacteria 1747
98 Ga0207704_10400160 3300025938 Bacteria 1083
99 Ga0207665_10194456 3300025939 Bacteria 1475
100 Ga0207651_10222858 3300025960 Bacteria 1526
101 Ga0207712_11776106 3300025961 Bacteria 553
102 Ga0207668_10203672 3300025972 Bacteria 1578
103 Ga0207677_10391115 3300026023 Unclassified 1176
104 Ga0207677_11562738 3300026023 Bacteria 610
105 Ga0207703_10112509 3300026035 Bacteria 2326
106 Ga0207708_10197703 3300026075 Bacteria 1603
107 Ga0207648_10012326 3300026089 Bacteria 8004
108 Ga0207676_10466331 3300026095 Bacteria 1193
109 Ga0207675_100060702 3300026118 Bacteria 3530
110 Ga0207675_100189214 3300026118 Bacteria 1974
111 Ga0207675_100385815 3300026118 Bacteria 1378
112 Ga0207675_100909808 3300026118 Bacteria 896
113 Ga0207675_102203534 3300026118 Bacteria 566
114 Ga0207683_10345354 3300026121 Bacteria 1365
115 Ga0209588_1005415 3300027671 Bacteria 3660
116 Ga0268265_10185424 3300028380 Bacteria 1792
117 Ga0307511_10098739 3300030521 Bacteria 1931
118 Ga0265760_10190767 3300031090 Bacteria 688
119 Ga0307508_10471288 3300031616 Bacteria 849
120 Ga0307516_10038109 3300031730 Bacteria 4800
121 Ga0307516_10401776 3300031730 Bacteria 1029
122 Ga0307409_101504570 3300031995 Bacteria 700
123 Ga0307415_100866512 3300032126 Bacteria 830
124 Ga0373934_0000138 3300035086 Bacteria 26971
125 Ga0373956_0029718 3300035119 Bacteria 2384
126 Ga0373955_0014511 3300035172 Bacteria 3834
127 Ga0373933_0001893 3300035724 Bacteria 12068
128 Ga0373937_0005884 3300036401 Bacteria 10549
129 Ga0439453_0039767 3300041408 Bacteria 919
130 Ga0439456_140617 3300042013 Bacteria 560
131 Ga0439457_058430 3300042014 Bacteria 872
132 Ga0466971_0405226 3300044719 Bacteria 665
133 Ga0466960_0255160 3300044901 Bacteria 975
134 Ga0495592_0095470 3300046454 Bacteria 2126
135 Ga0495629_0430112 3300046459 Bacteria 895
136 Ga0495651_0061972 3300046462 Bacteria 2862
137 Ga0495651_0464723 3300046462 Bacteria 815
138 Ga0495653_0046428 3300046463 Bacteria 3363
139 Ga0495580_0061237 3300046472 Bacteria 2643
140 Ga0495580_0365807 3300046472 Bacteria 976
141 Ga0495582_0147116 3300046473 Bacteria 1337
142 Ga0495582_0583615 3300046473 Bacteria 647
143 Ga0495664_0025707 3300046477 Bacteria 3427
144 Ga0495585_0168970 3300046492 Bacteria 1131
145 Ga0495608_0008514 3300046511 Bacteria 7186
146 Ga0495630_0534994 3300046517 Bacteria 898
147 Ga0495666_0002032 3300046526 Bacteria 10009
148 Ga0495652_0424923 3300046529 Bacteria 935
149 Ga0495665_0014615 3300046531 Bacteria 4232
150 Ga0495640_0007945 3300046533 Bacteria 8342
151 Ga0495586_0121009 3300046535 Bacteria 1462
152 Ga0495587_0067664 3300046536 Bacteria 2081
153 Ga0495621_0299708 3300046539 Bacteria 666
154 Ga0495667_0033400 3300046559 Bacteria 3443
155 Ga0495635_0027796 3300046663 Bacteria 3933
156 Ga0495635_0241163 3300046663 Bacteria 1220
157 Ga0495657_0024267 3300046675 Bacteria 4321
158 Ga0495599_0337194 3300046678 Bacteria 905
159 Ga0495646_0040583 3300046680 Bacteria 2864
160 Ga0495646_0241389 3300046680 Bacteria 971
161 Ga0495658_0314421 3300046683 Bacteria 992
162 Ga0495600_0054708 3300046809 Bacteria 2606
163 Ga0495604_0044122 3300047317 Bacteria 3487
164 Ga0495674_0028553 3300047319 Bacteria 5084
165 Ga0495676_0163922 3300047321 Bacteria 1570
166 Ga0495676_0167051 3300047321 Bacteria 1551
167 Ga0495680_0119698 3300047322 Bacteria 1945
168 Ga0495675_0027095 3300047444 Bacteria 3652
169 Ga0495684_0032544 3300047471 Bacteria 4003
170 Ga0495602_0015454 3300048088 Bacteria 7701
171 Ga0496100_0076953 3300048903 Bacteria 2242
172 Ga0496100_1095635 3300048903 Bacteria 628
173 Ga0496101_0369808 3300048904 Bacteria 1127
174 Ga0496101_0534586 3300048904 Bacteria 927
175 Ga0496102_0043413 3300048905 Bacteria 4077
176 Ga0496102_0575402 3300048905 Bacteria 1049
177 Ga0496102_1094354 3300048905 Bacteria 717
178 Ga0496104_0002424 3300048907 Bacteria 16066
179 Ga0496104_0092270 3300048907 Bacteria 2896
180 Ga0496104_0113125 3300048907 Bacteria 2603
181 Ga0496105_0079546 3300048908 Bacteria 2707
182 Ga0496106_0018243 3300048909 Bacteria 5189
183 Ga0496107_0093936 3300048910 Bacteria 2194
184 Ga0496108_0011959 3300048911 Bacteria 7060
185 Ga0496108_0244375 3300048911 Bacteria 1561
186 Ga0496109_0004867 3300048912 Bacteria 11210
187 Ga0496109_0027213 3300048912 Bacteria 5104
188 Ga0496109_0319664 3300048912 Bacteria 1465
189 Ga0496109_0648171 3300048912 Bacteria 993
190 Ga0496110_0008243 3300048913 Bacteria 8376
191 Ga0496110_0042394 3300048913 Bacteria 3972
192 Ga0496110_0233235 3300048913 Bacteria 1674
193 Ga0496110_0328473 3300048913 Bacteria 1393
194 Ga0496111_0000232 3300048914 Bacteria 26683
195 Ga0496111_0092784 3300048914 Bacteria 2213
196 Ga0496112_0201585 3300048915 Bacteria 1949
197 Ga0496113_0003587 3300048916 Bacteria 9318
198 Ga0496114_0071180 3300048917 Bacteria 2922
199 Ga0496114_0596919 3300048917 Bacteria 974
200 Ga0496114_0742125 3300048917 Bacteria 859
201 Ga0496115_0195102 3300048918 Bacteria 1673
202 Ga0496121_0017329 3300048924 Bacteria 7369
203 Ga0496126_0151952 3300048929 Bacteria 1984
204 Ga0501036_0378723 3300049572 Bacteria 1181
205 Ga0501038_0068059 3300049574 Bacteria 3028
206 Ga0501038_1108579 3300049574 Bacteria 578
207 Ga0501040_0046490 3300049576 Bacteria 2963
208 Ga0501041_0042668 3300049577 Bacteria 2757
209 Ga0501041_0525045 3300049577 Bacteria 754
210 Ga0501042_0204371 3300049578 Bacteria 1424
211 Ga0501042_0600359 3300049578 Bacteria 800
212 Ga0501043_0157293 3300049579 Bacteria 1777
213 Ga0501046_0127923 3300049580 Bacteria 1928
214 Ga0501048_0342156 3300049582 Bacteria 1066
215 Ga0501068_0211518 3300049584 Bacteria 1231
216 Ga0501071_0023425 3300049587 Bacteria 4312
217 Ga0501076_0000922 3300049592 Bacteria 19182
218 Ga0501076_0819614 3300049592 Bacteria 768
219 Ga0501219_000107 3300049703 Bacteria 14616
220 Ga0501225_0090649 3300049705 Unclassified 885
221 Ga0501079_1543482 3300049741 Bacteria 522
222 Ga0501081_0002100 3300049743 Bacteria 12452
223 Ga0501241_007954 3300049758 Bacteria 1940
224 Ga0501045_0060705 3300049824 Bacteria 2772
225 Ga0501284_00075 3300050005 Bacteria 28010
226 nmdc:mga03683_3674_c1 3300050489 Bacteria 4995
227 nmdc:mga00v17_58595_c1 3300050491 Bacteria 2360
228 nmdc:mga00v17_745128_c1 3300050491 Bacteria 626
229 nmdc:mga0yw44_5183_c1 3300050492 Bacteria 6109
230 nmdc:mga04h51_182046_c1 3300050495 Bacteria 818
231 Ga0495601_0022729 3300053077 Bacteria 3853
232 Ga0500568_0061283 3300053139 Bacteria 1455
233 Ga0500616_0000157 3300053153 Bacteria 114082
234 Ga0500645_081687 3300053730 Bacteria 922
235 Ga0501084_0491569 3300054114 Bacteria 1037
236 Ga0530510_0000977 3300061734 Bacteria 18901
237 2517760293 2517572101 Bacteria 6884336
238 2644096687 2643221616 Bacteria 4066575
239 2671839788 2671180195 Bacteria 9757215
240 2676202431 2675902999 Bacteria 9438463
241 2689959234 2687453737 Bacteria 11203906
242 2774847007 2773857921 Bacteria 9435764
243 2774857944 2773857922 Bacteria 9757215
244 2841762867 2841760612 Bacteria 6454112
245 2844110125 2844104063 Bacteria 6440972
246 2851182159 2851182111 Bacteria 6047226
247 2851251787 2851246043 Bacteria 6439203
248 2852628454 2852627209 Bacteria 5896285
249 2858872045 2858868258 Bacteria 7683772
250 2861523423 2861520306 Bacteria 8348283
251 2884766090 2884763398 Bacteria 4091164
252 2891397562 2891395885 Bacteria 9251614
253 2902582904 2902582711 Bacteria 6187705
254 2917554823 2917554339 Bacteria 4987857
255 8024491759 8024486573 Bacteria 6540512
256 8057535123 8057529695 Bacteria 6306553
257 Ga0070668_100969289
258 JGI25164J39214_1000530
259 JGI25159J45721_1005057
260 JGI25165J46597_1000004
261 JGI25165J46597_1000174
262 Ga0058860_11962021
263 Ga0065165_1000410
264 Ga0070669_100302035
265 Ga0070674_100086518
266 Ga0070673_100262609
267 Ga0070688_100957132
268 Ga0070659_101235884
269 Ga0070709_10597871
270 Ga0070714_101804783
271 Ga0070701_10151259
272 Ga0070701_10962514
273 Ga0070700_100514279
274 Ga0068867_101324004
275 Ga0070706_100015226
276 Ga0070706_101922044
277 Ga0070707_100000314
278 Ga0070698_100302550
279 Ga0070699_100221227
280 Ga0070697_100026602
281 Ga0070696_101204079
282 Ga0070704_100772034
283 Ga0068855_100650790
284 Ga0070664_101313341
285 Ga0068859_100510408
286 Ga0068864_100321115
287 Ga0068866_10021649
288 Ga0068861_100154749
289 Ga0068861_100955514
290 Ga0068863_100056411
291 Ga0068863_100166471
292 Ga0068858_101095028
293 Ga0068860_100913630
294 Ga0075363_100590632
295 Ga0075364_10000946
296 Ga0075364_10472559
297 Ga0070716_100291275
298 Ga0070712_100881388
299 Ga0075366_10378707
300 Ga0097621_100238372
301 Ga0075370_10438791
302 Ga0068871_100041858
303 Ga0075431_100507454
304 Ga0068865_100089230
305 Ga0097620_100510388
306 Ga0099794_10011991
307 Ga0099794_10443089
308 Ga0111539_10295612
309 Ga0105245_11099446
310 Ga0105247_10168803
311 Ga0105243_10020747
312 Ga0105243_10073892
313 Ga0105242_10003832
314 Ga0105248_10127398
315 Ga0105248_11640145
316 Ga0105248_12077192
317 Ga0105237_10953971
318 Ga0105238_12283095
319 Ga0105249_10989046
320 Ga0105246_10136510
321 Ga0157369_12274036
322 Ga0157374_10745421
323 Ga0157374_11195890
324 Ga0157378_10215810
325 Ga0157375_10022621
326 Ga0157375_10710030
327 Ga0163163_10599135
328 Ga0163163_10704723
329 Ga0163163_10773481
330 Ga0157380_10275845
331 Ga0157380_11465589
332 Ga0157379_10131034
333 Ga0157379_10232640
334 Ga0157376_10098302
335 Ga0207427_100010
336 Ga0209437_100290
337 Ga0209233_1000001
338 Ga0207666_1018893
339 Ga0209130_1000130
340 Ga0207426_1018649
341 Ga0207697_10109231
342 Ga0207642_10013685
343 Ga0207688_10261875
344 Ga0207684_10040803
345 Ga0207671_10378536
346 Ga0207646_10000022
347 Ga0207681_11152699
348 Ga0207659_11393692
349 Ga0207687_10027995
350 Ga0207664_11205526
351 Ga0207709_10069830
352 Ga0207709_10169711
353 Ga0207669_10126476
354 Ga0207704_10400160
355 Ga0207665_10194456
356 Ga0207651_10222858
357 Ga0207712_11776106
358 Ga0207668_10203672
359 Ga0207677_10391115
360 Ga0207677_11562738
361 Ga0207703_10112509
362 Ga0207708_10197703
363 Ga0207648_10012326
364 Ga0207676_10466331
365 Ga0207675_100060702
366 Ga0207675_100189214
367 Ga0207675_100385815
368 Ga0207675_100909808
369 Ga0207675_102203534
370 Ga0207683_10345354
371 Ga0209588_1005415
372 Ga0268265_10185424
373 Ga0307511_10098739
374 Ga0265760_10190767
375 Ga0307508_10471288
376 Ga0307516_10038109
377 Ga0307516_10401776
378 Ga0307409_101504570
379 Ga0307415_100866512
380 Ga0373934_0000138
381 Ga0373956_0029718
382 Ga0373955_0014511
383 Ga0373933_0001893
384 Ga0373937_0005884
385 Ga0439453_0039767
386 Ga0439456_140617
387 Ga0439457_058430
388 Ga0466971_0405226
389 Ga0466960_0255160
390 Ga0495592_0095470
391 Ga0495629_0430112
392 Ga0495651_0061972
393 Ga0495651_0464723
394 Ga0495653_0046428
395 Ga0495580_0061237
396 Ga0495580_0365807
397 Ga0495582_0147116
398 Ga0495582_0583615
399 Ga0495664_0025707
400 Ga0495585_0168970
401 Ga0495608_0008514
402 Ga0495630_0534994
403 Ga0495666_0002032
404 Ga0495652_0424923
405 Ga0495665_0014615
406 Ga0495640_0007945
407 Ga0495586_0121009
408 Ga0495587_0067664
409 Ga0495621_0299708
410 Ga0495667_0033400
411 Ga0495635_0027796
412 Ga0495635_0241163
413 Ga0495657_0024267
414 Ga0495599_0337194
415 Ga0495646_0040583
416 Ga0495646_0241389
417 Ga0495658_0314421
418 Ga0495600_0054708
419 Ga0495604_0044122
420 Ga0495674_0028553
421 Ga0495676_0163922
422 Ga0495676_0167051
423 Ga0495680_0119698
424 Ga0495675_0027095
425 Ga0495684_0032544
426 Ga0495602_0015454
427 Ga0496100_0076953
428 Ga0496100_1095635
429 Ga0496101_0369808
430 Ga0496101_0534586
431 Ga0496102_0043413
432 Ga0496102_0575402
433 Ga0496102_1094354
434 Ga0496104_0002424
435 Ga0496104_0092270
436 Ga0496104_0113125
437 Ga0496105_0079546
438 Ga0496106_0018243
439 Ga0496107_0093936
440 Ga0496108_0011959
441 Ga0496108_0244375
442 Ga0496109_0004867
443 Ga0496109_0027213
444 Ga0496109_0319664
445 Ga0496109_0648171
446 Ga0496110_0008243
447 Ga0496110_0042394
448 Ga0496110_0233235
449 Ga0496110_0328473
450 Ga0496111_0000232
451 Ga0496111_0092784
452 Ga0496112_0201585
453 Ga0496113_0003587
454 Ga0496114_0071180
455 Ga0496114_0596919
456 Ga0496114_0742125
457 Ga0496115_0195102
458 Ga0496121_0017329
459 Ga0496126_0151952
460 Ga0501036_0378723
461 Ga0501038_0068059
462 Ga0501038_1108579
463 Ga0501040_0046490
464 Ga0501041_0042668
465 Ga0501041_0525045
466 Ga0501042_0204371
467 Ga0501042_0600359
468 Ga0501043_0157293
469 Ga0501046_0127923
470 Ga0501048_0342156
471 Ga0501068_0211518
472 Ga0501071_0023425
473 Ga0501076_0000922
474 Ga0501076_0819614
475 Ga0501219_000107
476 Ga0501225_0090649
477 Ga0501079_1543482
478 Ga0501081_0002100
479 Ga0501241_007954
480 Ga0501045_0060705
481 Ga0501284_00075
482 nmdc:mga03683_3674_c1
483 nmdc:mga00v17_58595_c1
484 nmdc:mga00v17_745128_c1
485 nmdc:mga0yw44_5183_c1
486 nmdc:mga04h51_182046_c1
487 Ga0495601_0022729
488 Ga0500568_0061283
489 Ga0500616_0000157
490 Ga0500645_081687
491 Ga0501084_0491569
492 Ga0530510_0000977
493 2517760293
494 2644096687
495 2671839788
496 2676202431
497 2689959234
498 2774847007
499 2774857944
500 2841762867
501 2844110125
502 2851182159
503 2851251787
504 2852628454
505 2858872045
506 2861523423
507 2884766090
508 2891397562
509 2902582904
510 2917554823
511 8024491759
512 8057535123

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

12

131

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.9248 1 134
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.9183 1 134
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8661 3 138
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8596 2 134
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.858 2 134
ID Description Score Start End Superfamily
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9248 1 134 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9183 1 134 3.30.530.20
af_Q8T2R4_3_145_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8828 2 129 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8595 4 138 3.30.530.20
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8446 4 134 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A0K1PJL9-F1-model_v4 Aha1 domain protein 0.9916 1 144
AF-A0A401UX18-F1-model_v4 Activator of HSP90 ATPase 0.9906 1 147
AF-A0A0Q7M8Y5-F1-model_v4 Polyketide cyclase 0.9875 2 147
AF-A0A401UX18-F1-model_v4 Activator of HSP90 ATPase 0.9839 1 147
AF-A0A4R9GQP1-F1-model_v4 SRPBCC domain-containing protein 0.983 1 147

Map