F361926

General Info

Members Datasets Scaffolds Average Seq Length
250 176 500 236

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0181239|Ga0501036_0181239_58_846
Length 262
Sequence VSVLVPTVAQASSDFFRDRSDSDCIRDNGAFCAGWVIDNFDRYVDPLVQHIVLVAASVGLGFVIAFAMALASHRRRWLVPPFIGATGVLYTIPSVAFFFLLLPITGRGTDTAIIALTAYTLQIIYRNIVTGLANVPAEASDAGRGMGMTDGQLLWRIELPLAVPEIIAGVRIATVSTVAIASLAVFAGGGGLGSEIIAGSNITFRTGVVTASALMIGMAIAFDILLLVAQRRLTRWRSAGAVRRAGRGDFLHTLARSRTRDV

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
172 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.8
Nodule 0
Rhizoplane 4.8
Rhizosphere 88.4
Stem 0
Stem Tuber 0
Unclassified 2.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0181239 3300049572 Bacteria 1773
2 JGI24746J21847_1009549 3300001977 Bacteria 1446
3 Ga0070658_10305522 3300005327 Bacteria 1357
4 Ga0070683_100027515 3300005329 Bacteria 5129
5 Ga0070683_100047648 3300005329 Bacteria 3960
6 Ga0070683_100104138 3300005329 Bacteria 2674
7 Ga0070682_100047503 3300005337 Bacteria 2669
8 Ga0068868_100071907 3300005338 Bacteria 2759
9 Ga0070660_100001908 3300005339 Bacteria 14358
10 Ga0070691_10004043 3300005341 Bacteria 6647
11 Ga0070691_10040759 3300005341 Bacteria 2195
12 Ga0070661_100000005 3300005344 Bacteria 220455
13 Ga0070661_100064172 3300005344 Bacteria 2699
14 Ga0070692_10016545 3300005345 Bacteria 3509
15 Ga0070668_100065188 3300005347 Bacteria 2825
16 Ga0070668_100171254 3300005347 Bacteria 1768
17 Ga0070669_100220821 3300005353 Bacteria 1498
18 Ga0070675_100037967 3300005354 Bacteria 3924
19 Ga0070674_100097423 3300005356 Bacteria 2136
20 Ga0070673_100042333 3300005364 Bacteria 3511
21 Ga0070688_100001703 3300005365 Bacteria 10976
22 Ga0070688_100077320 3300005365 Bacteria 2144
23 Ga0070659_100008190 3300005366 Bacteria 7629
24 Ga0070659_100019461 3300005366 Bacteria 5145
25 Ga0070667_100344923 3300005367 Unclassified 1347
26 Ga0070714_100055753 3300005435 Bacteria 3379
27 Ga0070713_100000138 3300005436 Bacteria 48026
28 Ga0070700_100016024 3300005441 Bacteria 4262
29 Ga0070663_100001885 3300005455 Bacteria 11713
30 Ga0070663_100006599 3300005455 Bacteria 6994
31 Ga0070678_100015439 3300005456 Bacteria 4857
32 Ga0070662_100012866 3300005457 Bacteria 5558
33 Ga0070681_10093029 3300005458 Bacteria 2963
34 Ga0070685_10000293 3300005466 Bacteria 31562
35 Ga0070685_10025977 3300005466 Bacteria 3226
36 Ga0070679_100015795 3300005530 Bacteria 7263
37 Ga0070679_100593272 3300005530 Unclassified 1051
38 Ga0070684_100046934 3300005535 Bacteria 3743
39 Ga0070684_100172967 3300005535 Bacteria 1962
40 Ga0068853_100046213 3300005539 Bacteria 3732
41 Ga0070686_100084552 3300005544 Bacteria 2109
42 Ga0070693_100038570 3300005547 Bacteria 2671
43 Ga0070665_100000202 3300005548 Bacteria 104773
44 Ga0070665_100038122 3300005548 Bacteria 4831
45 Ga0070665_100112099 3300005548 Bacteria 2730
46 Ga0070664_100038271 3300005564 Bacteria 4037
47 Ga0068854_100001309 3300005578 Bacteria 15008
48 Ga0068854_100005379 3300005578 Bacteria 8082
49 Ga0068856_100001818 3300005614 Bacteria 22286
50 Ga0068856_100049249 3300005614 Bacteria 4152
51 Ga0068852_100000012 3300005616 Bacteria 140734
52 Ga0068852_100076606 3300005616 Bacteria 2953
53 Ga0068859_100109225 3300005617 Bacteria 2827
54 Ga0068866_10146453 3300005718 Bacteria 1362
55 Ga0068861_100251617 3300005719 Bacteria 1508
56 Ga0068851_10004144 3300005834 Bacteria 6525
57 Ga0068858_100000012 3300005842 Bacteria 216931
58 Ga0068862_100108215 3300005844 Bacteria 2438
59 Ga0081455_10011294 3300005937 Bacteria 8984
60 Ga0081538_10070981 3300005981 Bacteria 1919
61 Ga0075365_10029336 3300006038 Bacteria 3515
62 Ga0075365_10032858 3300006038 Bacteria 3339
63 Ga0075365_10174824 3300006038 Bacteria 1500
64 Ga0075363_100005478 3300006048 Bacteria 5655
65 Ga0075363_100114417 3300006048 Bacteria 1502
66 Ga0075364_10060122 3300006051 Bacteria 2492
67 Ga0075430_100012685 3300006846 Bacteria 7179
68 Ga0075430_100170940 3300006846 Bacteria 1808
69 Ga0075431_100029237 3300006847 Bacteria 5670
70 Ga0075431_100194041 3300006847 Bacteria 2080
71 Ga0075433_10555182 3300006852 Bacteria 1009
72 Ga0068865_100046543 3300006881 Bacteria 2977
73 Ga0097620_100109227 3300006931 Bacteria 2827
74 Ga0111539_10112915 3300009094 Bacteria 3187
75 Ga0105245_10000056 3300009098 Bacteria 124109
76 Ga0105245_10025166 3300009098 Bacteria 5234
77 Ga0114129_10116714 3300009147 Bacteria 3678
78 Ga0114129_10618331 3300009147 Bacteria 1401
79 Ga0105248_10000032 3300009177 Bacteria 201114
80 Ga0105248_10600136 3300009177 Unclassified 1242
81 Ga0105237_10307096 3300009545 Bacteria 1589
82 Ga0105249_10305830 3300009553 Bacteria 1596
83 Ga0105239_10631033 3300010375 Bacteria 1223
84 Ga0105246_10038969 3300011119 Bacteria 3198
85 Ga0157371_10015436 3300013102 Bacteria 5728
86 Ga0157370_10007487 3300013104 Bacteria 11859
87 Ga0157369_10000099 3300013105 Bacteria 120032
88 Ga0157378_10021630 3300013297 Bacteria 5656
89 Ga0163163_10183042 3300014325 Bacteria 2143
90 Ga0157380_10044365 3300014326 Bacteria 3484
91 Ga0157377_10033917 3300014745 Bacteria 2789
92 Ga0157376_10013595 3300014969 Bacteria 6080
93 Ga0207642_10226837 3300025899 Unclassified 1047
94 Ga0207688_10010418 3300025901 Bacteria 5060
95 Ga0207643_10050167 3300025908 Bacteria 2366
96 Ga0207707_10231895 3300025912 Bacteria 1606
97 Ga0207671_10108016 3300025914 Bacteria 2114
98 Ga0207663_10134839 3300025916 Bacteria 1712
99 Ga0207657_10005100 3300025919 Bacteria 13759
100 Ga0207649_10000005 3300025920 Bacteria 356179
101 Ga0207652_10006790 3300025921 Bacteria 9226
102 Ga0207652_10226509 3300025921 Bacteria 1685
103 Ga0207650_10053079 3300025925 Bacteria 3004
104 Ga0207659_10024705 3300025926 Bacteria 4030
105 Ga0207687_10000007 3300025927 Bacteria 604185
106 Ga0207687_10019105 3300025927 Bacteria 4536
107 Ga0207700_10000008 3300025928 Bacteria 341717
108 Ga0207700_10000016 3300025928 Bacteria 202434
109 Ga0207690_10005579 3300025932 Bacteria 7434
110 Ga0207690_10014439 3300025932 Bacteria 4771
111 Ga0207706_10023359 3300025933 Bacteria 5553
112 Ga0207704_10004514 3300025938 Bacteria 6363
113 Ga0207711_10000020 3300025941 Bacteria 363325
114 Ga0207711_10411664 3300025941 Unclassified 1257
115 Ga0207661_10018962 3300025944 Bacteria 5119
116 Ga0207661_10019224 3300025944 Bacteria 5089
117 Ga0207651_10098527 3300025960 Bacteria 2162
118 Ga0207712_10025194 3300025961 Bacteria 3950
119 Ga0207668_10023389 3300025972 Bacteria 3970
120 Ga0207668_10087098 3300025972 Bacteria 2283
121 Ga0207640_10000137 3300025981 Bacteria 54133
122 Ga0207677_10008940 3300026023 Bacteria 5618
123 Ga0207703_10000740 3300026035 Bacteria 32186
124 Ga0207703_10061704 3300026035 Bacteria 3070
125 Ga0207639_10085262 3300026041 Bacteria 2511
126 Ga0207678_10000994 3300026067 Bacteria 25831
127 Ga0207678_10008257 3300026067 Bacteria 9174
128 Ga0207708_10002088 3300026075 Bacteria 14696
129 Ga0207702_10000016 3300026078 Bacteria 226633
130 Ga0207702_10031633 3300026078 Bacteria 4411
131 Ga0207676_10087524 3300026095 Bacteria 2548
132 Ga0207683_10026972 3300026121 Bacteria 4964
133 Ga0207698_10000012 3300026142 Bacteria 260061
134 Ga0207698_10355519 3300026142 Bacteria 1385
135 Ga0268266_10000020 3300028379 Bacteria 527065
136 Ga0268266_10000553 3300028379 Bacteria 52199
137 Ga0268265_10431536 3300028380 Bacteria 1226
138 Ga0307410_10058076 3300031852 Bacteria 2637
139 Ga0307409_100498036 3300031995 Bacteria 1186
140 Ga0307416_100087495 3300032002 Bacteria 2660
141 Ga0307415_100679490 3300032126 Bacteria 926
142 Ga0373955_0023275 3300035172 Bacteria 3154
143 Ga0451853_3945392 3300041512 Bacteria 6088
144 Ga0466972_0088426 3300044658 Bacteria 1471
145 Ga0466965_0169471 3300044683 Bacteria 1148
146 Ga0466963_0022848 3300044694 Bacteria 3965
147 Ga0466968_0166272 3300044735 Bacteria 1020
148 Ga0466960_0032738 3300044901 Bacteria 2410
149 Ga0466967_0497710 3300045976 Bacteria 1196
150 Ga0495592_0140838 3300046454 Bacteria 1678
151 Ga0495641_0000003 3300046461 Bacteria 242879
152 Ga0495606_0000211 3300046507 Bacteria 103386
153 Ga0495630_0000025 3300046517 Bacteria 152364
154 Ga0495647_0000293 3300046681 Bacteria 13969
155 Ga0495658_0001056 3300046683 Bacteria 14543
156 Ga0495624_0011387 3300046690 Bacteria 6111
157 Ga0495686_0000003 3300047472 Bacteria 899502
158 Ga0495686_0107628 3300047472 Bacteria 1675
159 Ga0495602_0000228 3300048088 Bacteria 52649
160 Ga0496101_0168035 3300048904 Bacteria 1685
161 Ga0496102_0195316 3300048905 Bacteria 1907
162 Ga0496106_0024135 3300048909 Bacteria 4520
163 Ga0496108_0057721 3300048911 Bacteria 3261
164 Ga0496109_0014159 3300048912 Bacteria 6935
165 Ga0496110_0005343 3300048913 Bacteria 10063
166 Ga0496110_0031965 3300048913 Bacteria 4542
167 Ga0496111_0001844 3300048914 Bacteria 12488
168 Ga0496111_0473550 3300048914 Unclassified 923
169 Ga0496112_0005132 3300048915 Bacteria 11255
170 Ga0496113_0002212 3300048916 Bacteria 11219
171 Ga0496113_0170357 3300048916 Bacteria 1724
172 Ga0496122_0089418 3300048925 Bacteria 2106
173 Ga0496124_0094249 3300048927 Bacteria 2435
174 Ga0496126_0045147 3300048929 Bacteria 4052
175 Ga0496126_0206193 3300048929 Bacteria 1657
176 Ga0501031_0003383 3300049568 Bacteria 10245
177 Ga0501031_0010449 3300049568 Bacteria 6046
178 Ga0501032_0008002 3300049569 Bacteria 7705
179 Ga0501033_0006077 3300049570 Bacteria 9470
180 Ga0501033_0088995 3300049570 Bacteria 2258
181 Ga0501033_0253325 3300049570 Bacteria 1247
182 Ga0501034_0009920 3300049571 Bacteria 9951
183 Ga0501034_0102348 3300049571 Bacteria 2857
184 Ga0501036_0006019 3300049572 Bacteria 9837
185 Ga0501037_0005002 3300049573 Bacteria 9639
186 Ga0501038_0007121 3300049574 Bacteria 10333
187 Ga0501038_0343741 3300049574 Bacteria 1163
188 Ga0501039_0233760 3300049575 Bacteria 1445
189 Ga0501040_0169467 3300049576 Bacteria 1546
190 Ga0501042_0216212 3300049578 Bacteria 1382
191 Ga0501042_0242497 3300049578 Bacteria 1300
192 Ga0501042_0267560 3300049578 Bacteria 1234
193 Ga0501042_0332160 3300049578 Bacteria 1099
194 Ga0501043_0005695 3300049579 Bacteria 10038
195 Ga0501043_0006461 3300049579 Bacteria 9411
196 Ga0501046_0007044 3300049580 Bacteria 9904
197 Ga0501046_0037262 3300049580 Bacteria 3908
198 Ga0501047_0001844 3300049581 Bacteria 20430
199 Ga0501047_0069330 3300049581 Bacteria 3396
200 Ga0501048_0005493 3300049582 Bacteria 9644
201 Ga0501048_0015238 3300049582 Bacteria 5679
202 Ga0501048_0063486 3300049582 Bacteria 2612
203 Ga0501068_0043265 3300049584 Bacteria 2709
204 Ga0501070_0005807 3300049586 Bacteria 10531
205 Ga0501070_0007740 3300049586 Bacteria 9107
206 Ga0501071_0006530 3300049587 Bacteria 7573
207 Ga0501071_0065363 3300049587 Bacteria 2641
208 Ga0501072_0006551 3300049588 Bacteria 8869
209 Ga0501072_0030038 3300049588 Bacteria 4248
210 Ga0501072_0074284 3300049588 Bacteria 2688
211 Ga0501072_0075773 3300049588 Bacteria 2661
212 Ga0501073_0005281 3300049589 Bacteria 9688
213 Ga0501074_0064021 3300049590 Bacteria 2648
214 Ga0501074_0101954 3300049590 Bacteria 2055
215 Ga0501074_0170092 3300049590 Bacteria 1555
216 Ga0501075_0034909 3300049591 Bacteria 3748
217 Ga0501076_0023899 3300049592 Bacteria 4716
218 Ga0501077_0054214 3300049593 Bacteria 2546
219 Ga0501077_0117677 3300049593 Bacteria 1684
220 Ga0501079_0003967 3300049741 Bacteria 10933
221 Ga0501079_0043109 3300049741 Bacteria 3482
222 Ga0501079_0047986 3300049741 Bacteria 3295
223 Ga0501081_0756214 3300049743 Bacteria 730
224 Ga0501083_0004654 3300049744 Bacteria 9694
225 Ga0501035_0003153 3300049822 Bacteria 15842
226 Ga0501035_0531697 3300049822 Bacteria 965
227 Ga0501044_0004479 3300049823 Bacteria 15616
228 Ga0501044_0086899 3300049823 Bacteria 3158
229 Ga0501044_0360856 3300049823 Bacteria 1371
230 Ga0501045_0022547 3300049824 Bacteria 4510
231 nmdc:mga00v17_107458_c1 3300050491 Bacteria 1767
232 nmdc:mga00v17_40783_c1 3300050491 Bacteria 2786
233 nmdc:mga0yw44_15873_c1 3300050492 Bacteria 4050
234 nmdc:mga05p37_123152_c1 3300050507 Bacteria 3185
235 nmdc:mga05p37_521041_c1 3300050507 Unclassified 1360
236 nmdc:mga05p37_806586_c1 3300050507 Bacteria 1026
237 nmdc:mga0qj67_194699_c1 3300050509 Bacteria 1647
238 nmdc:mga0qj67_43201_c1 3300050509 Bacteria 3549
239 nmdc:mga06r32_176438_c1 3300050510 Bacteria 2121
240 Ga0495601_0000072 3300053077 Bacteria 56009
241 Ga0495612_0004552 3300053078 Bacteria 5755
242 Ga0495612_0005157 3300053078 Bacteria 5400
243 Ga0495595_0012587 3300053084 Bacteria 3560
244 Ga0500556_0000226 3300053104 Bacteria 45612
245 Ga0500614_005921 3300053123 Bacteria 2568
246 Ga0500616_0001741 3300053153 Bacteria 19953
247 Ga0501084_0016640 3300054114 Bacteria 6107
248 Ga0501082_0022662 3300060353 Bacteria 5408
249 Ga0501082_0036837 3300060353 Bacteria 4214
250 Ga0530510_0006377 3300061734 Bacteria 8212
251 Ga0501036_0181239
252 JGI24746J21847_1009549
253 Ga0070658_10305522
254 Ga0070683_100027515
255 Ga0070683_100047648
256 Ga0070683_100104138
257 Ga0070682_100047503
258 Ga0068868_100071907
259 Ga0070660_100001908
260 Ga0070691_10004043
261 Ga0070691_10040759
262 Ga0070661_100000005
263 Ga0070661_100064172
264 Ga0070692_10016545
265 Ga0070668_100065188
266 Ga0070668_100171254
267 Ga0070669_100220821
268 Ga0070675_100037967
269 Ga0070674_100097423
270 Ga0070673_100042333
271 Ga0070688_100001703
272 Ga0070688_100077320
273 Ga0070659_100008190
274 Ga0070659_100019461
275 Ga0070667_100344923
276 Ga0070714_100055753
277 Ga0070713_100000138
278 Ga0070700_100016024
279 Ga0070663_100001885
280 Ga0070663_100006599
281 Ga0070678_100015439
282 Ga0070662_100012866
283 Ga0070681_10093029
284 Ga0070685_10000293
285 Ga0070685_10025977
286 Ga0070679_100015795
287 Ga0070679_100593272
288 Ga0070684_100046934
289 Ga0070684_100172967
290 Ga0068853_100046213
291 Ga0070686_100084552
292 Ga0070693_100038570
293 Ga0070665_100000202
294 Ga0070665_100038122
295 Ga0070665_100112099
296 Ga0070664_100038271
297 Ga0068854_100001309
298 Ga0068854_100005379
299 Ga0068856_100001818
300 Ga0068856_100049249
301 Ga0068852_100000012
302 Ga0068852_100076606
303 Ga0068859_100109225
304 Ga0068866_10146453
305 Ga0068861_100251617
306 Ga0068851_10004144
307 Ga0068858_100000012
308 Ga0068862_100108215
309 Ga0081455_10011294
310 Ga0081538_10070981
311 Ga0075365_10029336
312 Ga0075365_10032858
313 Ga0075365_10174824
314 Ga0075363_100005478
315 Ga0075363_100114417
316 Ga0075364_10060122
317 Ga0075430_100012685
318 Ga0075430_100170940
319 Ga0075431_100029237
320 Ga0075431_100194041
321 Ga0075433_10555182
322 Ga0068865_100046543
323 Ga0097620_100109227
324 Ga0111539_10112915
325 Ga0105245_10000056
326 Ga0105245_10025166
327 Ga0114129_10116714
328 Ga0114129_10618331
329 Ga0105248_10000032
330 Ga0105248_10600136
331 Ga0105237_10307096
332 Ga0105249_10305830
333 Ga0105239_10631033
334 Ga0105246_10038969
335 Ga0157371_10015436
336 Ga0157370_10007487
337 Ga0157369_10000099
338 Ga0157378_10021630
339 Ga0163163_10183042
340 Ga0157380_10044365
341 Ga0157377_10033917
342 Ga0157376_10013595
343 Ga0207642_10226837
344 Ga0207688_10010418
345 Ga0207643_10050167
346 Ga0207707_10231895
347 Ga0207671_10108016
348 Ga0207663_10134839
349 Ga0207657_10005100
350 Ga0207649_10000005
351 Ga0207652_10006790
352 Ga0207652_10226509
353 Ga0207650_10053079
354 Ga0207659_10024705
355 Ga0207687_10000007
356 Ga0207687_10019105
357 Ga0207700_10000008
358 Ga0207700_10000016
359 Ga0207690_10005579
360 Ga0207690_10014439
361 Ga0207706_10023359
362 Ga0207704_10004514
363 Ga0207711_10000020
364 Ga0207711_10411664
365 Ga0207661_10018962
366 Ga0207661_10019224
367 Ga0207651_10098527
368 Ga0207712_10025194
369 Ga0207668_10023389
370 Ga0207668_10087098
371 Ga0207640_10000137
372 Ga0207677_10008940
373 Ga0207703_10000740
374 Ga0207703_10061704
375 Ga0207639_10085262
376 Ga0207678_10000994
377 Ga0207678_10008257
378 Ga0207708_10002088
379 Ga0207702_10000016
380 Ga0207702_10031633
381 Ga0207676_10087524
382 Ga0207683_10026972
383 Ga0207698_10000012
384 Ga0207698_10355519
385 Ga0268266_10000020
386 Ga0268266_10000553
387 Ga0268265_10431536
388 Ga0307410_10058076
389 Ga0307409_100498036
390 Ga0307416_100087495
391 Ga0307415_100679490
392 Ga0373955_0023275
393 Ga0451853_3945392
394 Ga0466972_0088426
395 Ga0466965_0169471
396 Ga0466963_0022848
397 Ga0466968_0166272
398 Ga0466960_0032738
399 Ga0466967_0497710
400 Ga0495592_0140838
401 Ga0495641_0000003
402 Ga0495606_0000211
403 Ga0495630_0000025
404 Ga0495647_0000293
405 Ga0495658_0001056
406 Ga0495624_0011387
407 Ga0495686_0000003
408 Ga0495686_0107628
409 Ga0495602_0000228
410 Ga0496101_0168035
411 Ga0496102_0195316
412 Ga0496106_0024135
413 Ga0496108_0057721
414 Ga0496109_0014159
415 Ga0496110_0005343
416 Ga0496110_0031965
417 Ga0496111_0001844
418 Ga0496111_0473550
419 Ga0496112_0005132
420 Ga0496113_0002212
421 Ga0496113_0170357
422 Ga0496122_0089418
423 Ga0496124_0094249
424 Ga0496126_0045147
425 Ga0496126_0206193
426 Ga0501031_0003383
427 Ga0501031_0010449
428 Ga0501032_0008002
429 Ga0501033_0006077
430 Ga0501033_0088995
431 Ga0501033_0253325
432 Ga0501034_0009920
433 Ga0501034_0102348
434 Ga0501036_0006019
435 Ga0501037_0005002
436 Ga0501038_0007121
437 Ga0501038_0343741
438 Ga0501039_0233760
439 Ga0501040_0169467
440 Ga0501042_0216212
441 Ga0501042_0242497
442 Ga0501042_0267560
443 Ga0501042_0332160
444 Ga0501043_0005695
445 Ga0501043_0006461
446 Ga0501046_0007044
447 Ga0501046_0037262
448 Ga0501047_0001844
449 Ga0501047_0069330
450 Ga0501048_0005493
451 Ga0501048_0015238
452 Ga0501048_0063486
453 Ga0501068_0043265
454 Ga0501070_0005807
455 Ga0501070_0007740
456 Ga0501071_0006530
457 Ga0501071_0065363
458 Ga0501072_0006551
459 Ga0501072_0030038
460 Ga0501072_0074284
461 Ga0501072_0075773
462 Ga0501073_0005281
463 Ga0501074_0064021
464 Ga0501074_0101954
465 Ga0501074_0170092
466 Ga0501075_0034909
467 Ga0501076_0023899
468 Ga0501077_0054214
469 Ga0501077_0117677
470 Ga0501079_0003967
471 Ga0501079_0043109
472 Ga0501079_0047986
473 Ga0501081_0756214
474 Ga0501083_0004654
475 Ga0501035_0003153
476 Ga0501035_0531697
477 Ga0501044_0004479
478 Ga0501044_0086899
479 Ga0501044_0360856
480 Ga0501045_0022547
481 nmdc:mga00v17_107458_c1
482 nmdc:mga00v17_40783_c1
483 nmdc:mga0yw44_15873_c1
484 nmdc:mga05p37_123152_c1
485 nmdc:mga05p37_521041_c1
486 nmdc:mga05p37_806586_c1
487 nmdc:mga0qj67_194699_c1
488 nmdc:mga0qj67_43201_c1
489 nmdc:mga06r32_176438_c1
490 Ga0495601_0000072
491 Ga0495612_0004552
492 Ga0495612_0005157
493 Ga0495595_0012587
494 Ga0500556_0000226
495 Ga0500614_005921
496 Ga0500616_0001741
497 Ga0501084_0016640
498 Ga0501082_0022662
499 Ga0501082_0036837
500 Ga0530510_0006377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

57

238

0.87

Map