F360783
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 249 | 145 | 249 | 392 |
Family's Representative Sequence
| Representative Sequence | 3300025910|Ga0207684_10138383|Ga0207684_101383832 |
| Length | 455 |
| Sequence | LPTASGERATAAPVIAEISAGLFLEKSLVSAAFSASAEGHGAVLAFAHAGPANATALNMTFANAAITSERDDRPAGFPEVHGEVSRGFGAVREAFEENFAHRQELGGACCAYRHGEKVADLWGGIRDKGTGEPWEQDTMVLVYSATKGLAAMTLALAHSRRWLDYEERVAAYWPEFAQHDKGKITVRQLLAHQAGLFAFDEPVDRSVVADLDQLAVVLARQKPAWEPGTRQAYHAITLGFYEGELLRRLDPRHRSLGQFFQDEIATPLGLDVYIRLPEEIPNSRLATLATPSPFRMLLDFPIHLTLDGMNRHSNIYRALITNPGFAIAHDQQRVYARNLEVPSGGAVGTARAIARAYGVFAAGGQELGLRRETLDLLAAPAIPAVHGFYDECMKGELQFSLGFMKPGPGWRFGGPRSFADPDAGIGYAYVTSQMGTRLTGDSRDVALRDALYSAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 110 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 111 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 114 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 116 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 117 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 120 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 121 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 123 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 124 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 125 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 126 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 127 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.22 |
| Rhizosphere | 94.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10000117 | 3300005290 | Bacteria | 235194 |
| 2 | Ga0065712_10006670 | 3300005290 | Bacteria | 3345 |
| 3 | Ga0065712_10070617 | 3300005290 | Bacteria | 5828 |
| 4 | Ga0065712_10070828 | 3300005290 | Bacteria | 5673 |
| 5 | Ga0065712_10074332 | 3300005290 | Unclassified | 4108 |
| 6 | Ga0065715_10001480 | 3300005293 | Bacteria | 8670 |
| 7 | Ga0065715_10104871 | 3300005293 | Bacteria | 2930 |
| 8 | Ga0065715_10178688 | 3300005293 | Unclassified | 1492 |
| 9 | Ga0070676_10013029 | 3300005328 | Bacteria | 4556 |
| 10 | Ga0070683_100000381 | 3300005329 | Bacteria | 30849 |
| 11 | Ga0070690_100000820 | 3300005330 | Bacteria | 15769 |
| 12 | Ga0070690_100005823 | 3300005330 | Bacteria | 6947 |
| 13 | Ga0070670_100012676 | 3300005331 | Bacteria | 7218 |
| 14 | Ga0070670_100060165 | 3300005331 | Bacteria | 3261 |
| 15 | Ga0070677_10004097 | 3300005333 | Bacteria | 4730 |
| 16 | Ga0068869_100018421 | 3300005334 | Bacteria | 4753 |
| 17 | Ga0068869_100203264 | 3300005334 | Unclassified | 1563 |
| 18 | Ga0070666_10002329 | 3300005335 | Bacteria | 11478 |
| 19 | Ga0070666_10031267 | 3300005335 | Bacteria | 3514 |
| 20 | Ga0068868_100004955 | 3300005338 | Bacteria | 9353 |
| 21 | Ga0068868_100006647 | 3300005338 | Bacteria | 8203 |
| 22 | Ga0070689_100008165 | 3300005340 | Bacteria | 7357 |
| 23 | Ga0070689_100109698 | 3300005340 | Bacteria | 2193 |
| 24 | Ga0070687_100000631 | 3300005343 | Bacteria | 11651 |
| 25 | Ga0070661_100015852 | 3300005344 | Bacteria | 5318 |
| 26 | Ga0070661_100029011 | 3300005344 | Bacteria | 3992 |
| 27 | Ga0070669_100007090 | 3300005353 | Bacteria | 8052 |
| 28 | Ga0070669_100014274 | 3300005353 | Bacteria | 5652 |
| 29 | Ga0070675_100000931 | 3300005354 | Bacteria | 20813 |
| 30 | Ga0070675_100065454 | 3300005354 | Bacteria | 3005 |
| 31 | Ga0070671_100007135 | 3300005355 | Bacteria | 8927 |
| 32 | Ga0070671_100014423 | 3300005355 | Bacteria | 6386 |
| 33 | Ga0070674_100048885 | 3300005356 | Unclassified | 2905 |
| 34 | Ga0070673_100020989 | 3300005364 | Bacteria | 4723 |
| 35 | Ga0070673_100121401 | 3300005364 | Bacteria | 2180 |
| 36 | Ga0070673_100150418 | 3300005364 | Bacteria | 1971 |
| 37 | Ga0070673_100167192 | 3300005364 | Bacteria | 1875 |
| 38 | Ga0070688_100021220 | 3300005365 | Bacteria | 3791 |
| 39 | Ga0070688_100044095 | 3300005365 | Unclassified | 2751 |
| 40 | Ga0070667_100010745 | 3300005367 | Bacteria | 7565 |
| 41 | Ga0070667_100047236 | 3300005367 | Bacteria | 3622 |
| 42 | Ga0070667_100057857 | 3300005367 | Unclassified | 3277 |
| 43 | Ga0070701_10035618 | 3300005438 | Bacteria | 2502 |
| 44 | Ga0070700_100009904 | 3300005441 | Bacteria | 5244 |
| 45 | Ga0070663_100056214 | 3300005455 | Bacteria | 2819 |
| 46 | Ga0070678_100009015 | 3300005456 | Bacteria | 6011 |
| 47 | Ga0070662_100008443 | 3300005457 | Bacteria | 6715 |
| 48 | Ga0070681_10171254 | 3300005458 | Bacteria | 2093 |
| 49 | Ga0068867_100033949 | 3300005459 | Bacteria | 3697 |
| 50 | Ga0070685_10005421 | 3300005466 | Bacteria | 6461 |
| 51 | Ga0070706_100161581 | 3300005467 | Bacteria | 2092 |
| 52 | Ga0070706_100173076 | 3300005467 | Bacteria | 2016 |
| 53 | Ga0070672_100007420 | 3300005543 | Bacteria | 7435 |
| 54 | Ga0070672_100013397 | 3300005543 | Bacteria | 5793 |
| 55 | Ga0070686_100007108 | 3300005544 | Bacteria | 6243 |
| 56 | Ga0070686_100108353 | 3300005544 | Bacteria | 1888 |
| 57 | Ga0070665_100060521 | 3300005548 | Bacteria | 3796 |
| 58 | Ga0070665_100242406 | 3300005548 | Bacteria | 1803 |
| 59 | Ga0070664_100025202 | 3300005564 | Bacteria | 4927 |
| 60 | Ga0070664_100106957 | 3300005564 | Bacteria | 2438 |
| 61 | Ga0068852_100025186 | 3300005616 | Bacteria | 4817 |
| 62 | Ga0068859_100025844 | 3300005617 | Bacteria | 5891 |
| 63 | Ga0068859_100143812 | 3300005617 | Bacteria | 2459 |
| 64 | Ga0068864_100032862 | 3300005618 | Bacteria | 4409 |
| 65 | Ga0068864_100056327 | 3300005618 | Bacteria | 3396 |
| 66 | Ga0068864_100076462 | 3300005618 | Bacteria | 2926 |
| 67 | Ga0068864_100201021 | 3300005618 | Bacteria | 1830 |
| 68 | Ga0068866_10007118 | 3300005718 | Unclassified | 4677 |
| 69 | Ga0068861_100007392 | 3300005719 | Bacteria | 7527 |
| 70 | Ga0068870_10000623 | 3300005840 | Bacteria | 13495 |
| 71 | Ga0068870_10012886 | 3300005840 | Bacteria | 3916 |
| 72 | Ga0068863_100008405 | 3300005841 | Bacteria | 10081 |
| 73 | Ga0068863_100050777 | 3300005841 | Unclassified | 3930 |
| 74 | Ga0068863_100066807 | 3300005841 | Unclassified | 3401 |
| 75 | Ga0068858_100011837 | 3300005842 | Bacteria | 8225 |
| 76 | Ga0068858_100156408 | 3300005842 | Bacteria | 2145 |
| 77 | Ga0068860_100020974 | 3300005843 | Bacteria | 6331 |
| 78 | Ga0068860_100095007 | 3300005843 | Unclassified | 2841 |
| 79 | Ga0068862_100008998 | 3300005844 | Bacteria | 8265 |
| 80 | Ga0097621_100001181 | 3300006237 | Bacteria | 18107 |
| 81 | Ga0097621_100043534 | 3300006237 | Unclassified | 3619 |
| 82 | Ga0097621_100098773 | 3300006237 | Bacteria | 2453 |
| 83 | Ga0097621_100139602 | 3300006237 | Bacteria | 2070 |
| 84 | Ga0068871_100006872 | 3300006358 | Bacteria | 8102 |
| 85 | Ga0068871_100016404 | 3300006358 | Bacteria | 5577 |
| 86 | Ga0068871_100066255 | 3300006358 | Bacteria | 2960 |
| 87 | Ga0075433_10000700 | 3300006852 | Bacteria | 22873 |
| 88 | Ga0075433_10137251 | 3300006852 | Unclassified | 2174 |
| 89 | Ga0075434_100027634 | 3300006871 | Bacteria | 5571 |
| 90 | Ga0075434_100177156 | 3300006871 | Bacteria | 2152 |
| 91 | Ga0075429_100071497 | 3300006880 | Bacteria | 3021 |
| 92 | Ga0068865_100000259 | 3300006881 | Bacteria | 29371 |
| 93 | Ga0068865_100108109 | 3300006881 | Unclassified | 2046 |
| 94 | Ga0097620_100025845 | 3300006931 | Bacteria | 5891 |
| 95 | Ga0097620_100048025 | 3300006931 | Unclassified | 4288 |
| 96 | Ga0097620_100143813 | 3300006931 | Bacteria | 2459 |
| 97 | Ga0075435_100344884 | 3300007076 | Unclassified | 1276 |
| 98 | Ga0111539_10011876 | 3300009094 | Bacteria | 10916 |
| 99 | Ga0111539_10059097 | 3300009094 | Bacteria | 4548 |
| 100 | Ga0111539_10076625 | 3300009094 | Unclassified | 3937 |
| 101 | Ga0111539_10187372 | 3300009094 | Bacteria | 2416 |
| 102 | Ga0105245_10065143 | 3300009098 | Unclassified | 3295 |
| 103 | Ga0105245_10079029 | 3300009098 | Bacteria | 3003 |
| 104 | Ga0114129_10675615 | 3300009147 | Bacteria | 1330 |
| 105 | Ga0105242_10004686 | 3300009176 | Bacteria | 10585 |
| 106 | Ga0105248_10000855 | 3300009177 | Bacteria | 34244 |
| 107 | Ga0105248_10002166 | 3300009177 | Bacteria | 21736 |
| 108 | Ga0105248_10002306 | 3300009177 | Bacteria | 21143 |
| 109 | Ga0105248_10021153 | 3300009177 | Bacteria | 7208 |
| 110 | Ga0105248_10062582 | 3300009177 | Unclassified | 4178 |
| 111 | Ga0105249_10022817 | 3300009553 | Bacteria | 5610 |
| 112 | Ga0105246_10109450 | 3300011119 | Unclassified | 2027 |
| 113 | Ga0157374_10085220 | 3300013296 | Bacteria | 3004 |
| 114 | Ga0157374_10118873 | 3300013296 | Bacteria | 2549 |
| 115 | Ga0157378_10005992 | 3300013297 | Bacteria | 10655 |
| 116 | Ga0163162_10000682 | 3300013306 | Bacteria | 31472 |
| 117 | Ga0163162_10001897 | 3300013306 | Bacteria | 19696 |
| 118 | Ga0157375_10015022 | 3300013308 | Bacteria | 6926 |
| 119 | Ga0157375_10064292 | 3300013308 | Bacteria | 3653 |
| 120 | Ga0157375_10226532 | 3300013308 | Unclassified | 2028 |
| 121 | Ga0157375_10379746 | 3300013308 | Bacteria | 1580 |
| 122 | Ga0157375_10506248 | 3300013308 | Unclassified | 1372 |
| 123 | Ga0163163_10008840 | 3300014325 | Bacteria | 8966 |
| 124 | Ga0163163_10040312 | 3300014325 | Bacteria | 4560 |
| 125 | Ga0163163_10100321 | 3300014325 | Unclassified | 2917 |
| 126 | Ga0157380_10004940 | 3300014326 | Bacteria | 9294 |
| 127 | Ga0157380_10059571 | 3300014326 | Bacteria | 3048 |
| 128 | Ga0157380_10265899 | 3300014326 | Bacteria | 1560 |
| 129 | Ga0157377_10019080 | 3300014745 | Bacteria | 3578 |
| 130 | Ga0157379_10021773 | 3300014968 | Bacteria | 5679 |
| 131 | Ga0157376_10016924 | 3300014969 | Bacteria | 5549 |
| 132 | Ga0157376_10091072 | 3300014969 | Unclassified | 2641 |
| 133 | Ga0157376_10110602 | 3300014969 | Bacteria | 2417 |
| 134 | Ga0163161_10019089 | 3300017792 | Bacteria | 4805 |
| 135 | Ga0207697_10005141 | 3300025315 | Bacteria | 6115 |
| 136 | Ga0207642_10031159 | 3300025899 | Bacteria | 2230 |
| 137 | Ga0207688_10002488 | 3300025901 | Bacteria | 9918 |
| 138 | Ga0207680_10008085 | 3300025903 | Bacteria | 5153 |
| 139 | Ga0207645_10000934 | 3300025907 | Bacteria | 24226 |
| 140 | Ga0207643_10000549 | 3300025908 | Bacteria | 24008 |
| 141 | Ga0207643_10007175 | 3300025908 | Bacteria | 5981 |
| 142 | Ga0207684_10138383 | 3300025910 | Bacteria | 2092 |
| 143 | Ga0207684_10304688 | 3300025910 | Bacteria | 1373 |
| 144 | Ga0207671_10126896 | 3300025914 | Unclassified | 1955 |
| 145 | Ga0207662_10004054 | 3300025918 | Bacteria | 7642 |
| 146 | Ga0207649_10023345 | 3300025920 | Bacteria | 3582 |
| 147 | Ga0207649_10023440 | 3300025920 | Bacteria | 3575 |
| 148 | Ga0207649_10064228 | 3300025920 | Bacteria | 2320 |
| 149 | Ga0207681_10005153 | 3300025923 | Bacteria | 8028 |
| 150 | Ga0207681_10044404 | 3300025923 | Bacteria | 2978 |
| 151 | Ga0207650_10003387 | 3300025925 | Bacteria | 10967 |
| 152 | Ga0207650_10104529 | 3300025925 | Unclassified | 2185 |
| 153 | Ga0207659_10004028 | 3300025926 | Bacteria | 8865 |
| 154 | Ga0207659_10004416 | 3300025926 | Bacteria | 8502 |
| 155 | Ga0207659_10148594 | 3300025926 | Bacteria | 1827 |
| 156 | Ga0207687_10029525 | 3300025927 | Unclassified | 3689 |
| 157 | Ga0207644_10199612 | 3300025931 | Unclassified | 1577 |
| 158 | Ga0207706_10009160 | 3300025933 | Bacteria | 9104 |
| 159 | Ga0207686_10005405 | 3300025934 | Bacteria | 6851 |
| 160 | Ga0207686_10008696 | 3300025934 | Bacteria | 5485 |
| 161 | Ga0207670_10141993 | 3300025936 | Bacteria | 1772 |
| 162 | Ga0207691_10003732 | 3300025940 | Bacteria | 14779 |
| 163 | Ga0207691_10003783 | 3300025940 | Bacteria | 14696 |
| 164 | Ga0207691_10142610 | 3300025940 | Bacteria | 2110 |
| 165 | Ga0207691_10158271 | 3300025940 | Bacteria | 1988 |
| 166 | Ga0207711_10012726 | 3300025941 | Bacteria | 6987 |
| 167 | Ga0207711_10034305 | 3300025941 | Bacteria | 4298 |
| 168 | Ga0207711_10042184 | 3300025941 | Unclassified | 3888 |
| 169 | Ga0207711_10044451 | 3300025941 | Bacteria | 3792 |
| 170 | Ga0207689_10004838 | 3300025942 | Bacteria | 12145 |
| 171 | Ga0207661_10066688 | 3300025944 | Bacteria | 2924 |
| 172 | Ga0207661_10268178 | 3300025944 | Bacteria | 1523 |
| 173 | Ga0207679_10049934 | 3300025945 | Bacteria | 3054 |
| 174 | Ga0207651_10101220 | 3300025960 | Bacteria | 2138 |
| 175 | Ga0207712_10000700 | 3300025961 | Bacteria | 25879 |
| 176 | Ga0207712_10028010 | 3300025961 | Bacteria | 3766 |
| 177 | Ga0207668_10192622 | 3300025972 | Unclassified | 1617 |
| 178 | Ga0207658_10009498 | 3300025986 | Bacteria | 6601 |
| 179 | Ga0207658_10031468 | 3300025986 | Unclassified | 3768 |
| 180 | Ga0207703_10017657 | 3300026035 | Bacteria | 5570 |
| 181 | Ga0207703_10046107 | 3300026035 | Unclassified | 3510 |
| 182 | Ga0207703_10170034 | 3300026035 | Bacteria | 1916 |
| 183 | Ga0207703_10313806 | 3300026035 | Bacteria | 1434 |
| 184 | Ga0207678_10077531 | 3300026067 | Bacteria | 2847 |
| 185 | Ga0207708_10025687 | 3300026075 | Bacteria | 4457 |
| 186 | Ga0207641_10039932 | 3300026088 | Unclassified | 3926 |
| 187 | Ga0207641_10392295 | 3300026088 | Bacteria | 1331 |
| 188 | Ga0207648_10005542 | 3300026089 | Bacteria | 12711 |
| 189 | Ga0207676_10023630 | 3300026095 | Bacteria | 4538 |
| 190 | Ga0207674_10124153 | 3300026116 | Bacteria | 2547 |
| 191 | Ga0207675_100001646 | 3300026118 | Bacteria | 22365 |
| 192 | Ga0207675_100131088 | 3300026118 | Unclassified | 2377 |
| 193 | Ga0207683_10003465 | 3300026121 | Bacteria | 13768 |
| 194 | Ga0207698_10193563 | 3300026142 | Bacteria | 1814 |
| 195 | Ga0207428_10007845 | 3300027907 | Bacteria | 9709 |
| 196 | Ga0268265_10060593 | 3300028380 | Bacteria | 2901 |
| 197 | Ga0268264_10022426 | 3300028381 | Bacteria | 5156 |
| 198 | Ga0268264_10186292 | 3300028381 | Unclassified | 1889 |
| 199 | Ga0307408_100013146 | 3300031548 | Bacteria | 5493 |
| 200 | Ga0307405_10108183 | 3300031731 | Unclassified | 1878 |
| 201 | Ga0373950_0000022 | 3300034818 | Bacteria | 206268 |
| 202 | Ga0373932_0002676 | 3300035112 | Bacteria | 4435 |
| 203 | Ga0373931_0078455 | 3300035691 | Bacteria | 1817 |
| 204 | Ga0373937_0010326 | 3300036401 | Bacteria | 8151 |
| 205 | Ga0373937_0041355 | 3300036401 | Unclassified | 4204 |
| 206 | Ga0439446_0003963 | 3300042156 | Bacteria | 3724 |
| 207 | Ga0439446_0008863 | 3300042156 | Bacteria | 2683 |
| 208 | Ga0451576_0068336 | 3300045051 | Bacteria | 3697 |
| 209 | Ga0451576_0133546 | 3300045051 | Unclassified | 2587 |
| 210 | Ga0495592_0004599 | 3300046454 | Bacteria | 10103 |
| 211 | Ga0495596_0015950 | 3300046500 | Bacteria | 3129 |
| 212 | Ga0496104_0028993 | 3300048907 | Bacteria | 5132 |
| 213 | Ga0496107_0136260 | 3300048910 | Bacteria | 1814 |
| 214 | Ga0496108_0033185 | 3300048911 | Bacteria | 4288 |
| 215 | Ga0496108_0037887 | 3300048911 | Bacteria | 4017 |
| 216 | Ga0496109_0048575 | 3300048912 | Bacteria | 3861 |
| 217 | Ga0496110_0005898 | 3300048913 | Bacteria | 9642 |
| 218 | Ga0496112_0000921 | 3300048915 | Bacteria | 21264 |
| 219 | Ga0496112_0012410 | 3300048915 | Bacteria | 7832 |
| 220 | Ga0496113_0005194 | 3300048916 | Bacteria | 8098 |
| 221 | Ga0496113_0065109 | 3300048916 | Unclassified | 2758 |
| 222 | Ga0496113_0276596 | 3300048916 | Bacteria | 1342 |
| 223 | Ga0496114_0168217 | 3300048917 | Bacteria | 1909 |
| 224 | Ga0496114_0368527 | 3300048917 | Bacteria | 1271 |
| 225 | Ga0501039_0033673 | 3300049575 | Unclassified | 3952 |
| 226 | Ga0501043_0003390 | 3300049579 | Bacteria | 13115 |
| 227 | Ga0501046_0002667 | 3300049580 | Bacteria | 16642 |
| 228 | Ga0501047_0000027 | 3300049581 | Bacteria | 222226 |
| 229 | Ga0501048_0002385 | 3300049582 | Bacteria | 14348 |
| 230 | Ga0501068_0023988 | 3300049584 | Bacteria | 3578 |
| 231 | Ga0501072_0000035 | 3300049588 | Bacteria | 120775 |
| 232 | Ga0501073_0008088 | 3300049589 | Bacteria | 7801 |
| 233 | Ga0501073_0101303 | 3300049589 | Bacteria | 2000 |
| 234 | Ga0501075_0039664 | 3300049591 | Unclassified | 3524 |
| 235 | Ga0501076_0104827 | 3300049592 | Bacteria | 2282 |
| 236 | Ga0501079_0026651 | 3300049741 | Bacteria | 4431 |
| 237 | Ga0501080_0004020 | 3300049742 | Bacteria | 13024 |
| 238 | Ga0501081_0038767 | 3300049743 | Unclassified | 3258 |
| 239 | Ga0501083_0096817 | 3300049744 | Bacteria | 1947 |
| 240 | nmdc:mga05p37_26508_c1 | 3300050507 | Bacteria | 7049 |
| 241 | nmdc:mga05p37_40975_c1 | 3300050507 | Bacteria | 5687 |
| 242 | nmdc:mga08y16_35153_c1 | 3300050511 | Bacteria | 5264 |
| 243 | nmdc:mga08y16_5927_c1 | 3300050511 | Bacteria | 12813 |
| 244 | nmdc:mga0n895_172816_c1 | 3300050512 | Bacteria | 2192 |
| 245 | nmdc:mga0n895_35648_c1 | 3300050512 | Unclassified | 4798 |
| 246 | nmdc:mga0n895_4950_c1 | 3300050512 | Bacteria | 11051 |
| 247 | nmdc:mga0a205_159203_c1 | 3300050515 | Unclassified | 2155 |
| 248 | nmdc:mga0a205_2715_c1 | 3300050515 | Bacteria | 15633 |
| 249 | Ga0501084_0000012 | 3300054114 | Bacteria | 175851 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005334 | Ga0068869_100203264 | Ga0068869_1002032642 | 333 |
| 2 | 3300006237 | Ga0097621_100001181 | Ga0097621_1000011818 | 357 |
| 3 | 3300006358 | Ga0068871_100006872 | Ga0068871_1000068724 | 357 |
| 4 | 3300006881 | Ga0068865_100000259 | Ga0068865_1000002599 | 357 |
| 5 | 3300025934 | Ga0207686_10008696 | Ga0207686_100086963 | 357 |
| 6 | 3300005455 | Ga0070663_100056214 | Ga0070663_1000562143 | 359 |
| 7 | 3300026067 | Ga0207678_10077531 | Ga0207678_100775312 | 359 |
| 8 | 3300048917 | Ga0496114_0368527 | Ga0496114_0368527_23_1192 | 360 |
| 9 | 3300042156 | Ga0439446_0008863 | Ga0439446_0008863_1194_2387 | 363 |
| 10 | 3300005367 | Ga0070667_100057857 | Ga0070667_1000578574 | 365 |
| 11 | 3300005548 | Ga0070665_100242406 | Ga0070665_1002424062 | 365 |
| 12 | 3300005841 | Ga0068863_100066807 | Ga0068863_1000668073 | 365 |
| 13 | 3300005843 | Ga0068860_100095007 | Ga0068860_1000950074 | 365 |
| 14 | 3300006237 | Ga0097621_100043534 | Ga0097621_1000435344 | 365 |
| 15 | 3300006358 | Ga0068871_100016404 | Ga0068871_1000164044 | 365 |
| 16 | 3300009098 | Ga0105245_10065143 | Ga0105245_100651432 | 365 |
| 17 | 3300009177 | Ga0105248_10062582 | Ga0105248_100625823 | 365 |
| 18 | 3300011119 | Ga0105246_10109450 | Ga0105246_101094501 | 365 |
| 19 | 3300014325 | Ga0163163_10100321 | Ga0163163_101003213 | 365 |
| 20 | 3300014969 | Ga0157376_10091072 | Ga0157376_100910722 | 365 |
| 21 | 3300025903 | Ga0207680_10008085 | Ga0207680_100080854 | 365 |
| 22 | 3300025927 | Ga0207687_10029525 | Ga0207687_100295253 | 365 |
| 23 | 3300025934 | Ga0207686_10005405 | Ga0207686_100054055 | 365 |
| 24 | 3300025941 | Ga0207711_10012726 | Ga0207711_100127267 | 365 |
| 25 | 3300025986 | Ga0207658_10031468 | Ga0207658_100314684 | 365 |
| 26 | 3300026035 | Ga0207703_10046107 | Ga0207703_100461073 | 365 |
| 27 | 3300028381 | Ga0268264_10186292 | Ga0268264_101862922 | 365 |
| 28 | 3300005355 | Ga0070671_100014423 | Ga0070671_1000144234 | 367 |
| 29 | 3300013308 | Ga0157375_10506248 | Ga0157375_105062481 | 367 |
| 30 | 3300025931 | Ga0207644_10199612 | Ga0207644_101996122 | 367 |
| 31 | 3300036401 | Ga0373937_0010326 | Ga0373937_0010326_1051_2229 | 367 |
| 32 | 3300009147 | Ga0114129_10675615 | Ga0114129_106756151 | 368 |
| 33 | 3300050511 | nmdc:mga08y16_5927_c1 | nmdc:mga08y16_5927_c1_10906_12129 | 368 |
| 34 | 3300050507 | nmdc:mga05p37_40975_c1 | nmdc:mga05p37_40975_c1_1729_2919 | 370 |
| 35 | 3300005353 | Ga0070669_100014274 | Ga0070669_1000142747 | 371 |
| 36 | 3300005354 | Ga0070675_100000931 | Ga0070675_10000093119 | 371 |
| 37 | 3300005364 | Ga0070673_100121401 | Ga0070673_1001214012 | 371 |
| 38 | 3300014326 | Ga0157380_10059571 | Ga0157380_100595713 | 371 |
| 39 | 3300025923 | Ga0207681_10044404 | Ga0207681_100444042 | 371 |
| 40 | 3300025926 | Ga0207659_10004416 | Ga0207659_100044168 | 371 |
| 41 | 3300025960 | Ga0207651_10101220 | Ga0207651_101012202 | 371 |
| 42 | 3300005841 | Ga0068863_100050777 | Ga0068863_1000507773 | 374 |
| 43 | 3300013308 | Ga0157375_10379746 | Ga0157375_103797461 | 374 |
| 44 | 3300025940 | Ga0207691_10158271 | Ga0207691_101582711 | 374 |
| 45 | 3300026088 | Ga0207641_10039932 | Ga0207641_100399324 | 374 |
| 46 | 3300026116 | Ga0207674_10124153 | Ga0207674_101241532 | 375 |
| 47 | 3300045051 | Ga0451576_0133546 | Ga0451576_0133546_570_1781 | 375 |
| 48 | 3300046500 | Ga0495596_0015950 | Ga0495596_0015950_1640_2860 | 375 |
| 49 | 3300005293 | Ga0065715_10178688 | Ga0065715_101786881 | 377 |
| 50 | 3300009176 | Ga0105242_10004686 | Ga0105242_100046864 | 377 |
| 51 | 3300009177 | Ga0105248_10002166 | Ga0105248_100021667 | 377 |
| 52 | 3300009177 | Ga0105248_10021153 | Ga0105248_100211534 | 377 |
| 53 | 3300014325 | Ga0163163_10040312 | Ga0163163_100403127 | 377 |
| 54 | 3300048911 | Ga0496108_0037887 | Ga0496108_0037887_2544_3716 | 377 |
| 55 | 3300048915 | Ga0496112_0000921 | Ga0496112_0000921_1247_2419 | 377 |
| 56 | 3300048916 | Ga0496113_0005194 | Ga0496113_0005194_1786_2958 | 377 |
| 57 | 3300006852 | Ga0075433_10137251 | Ga0075433_101372512 | 378 |
| 58 | 3300049575 | Ga0501039_0033673 | Ga0501039_0033673_932_2269 | 378 |
| 59 | 3300049591 | Ga0501075_0039664 | Ga0501075_0039664_1670_3007 | 378 |
| 60 | 3300049592 | Ga0501076_0104827 | Ga0501076_0104827_161_1498 | 378 |
| 61 | 3300049743 | Ga0501081_0038767 | Ga0501081_0038767_634_1839 | 378 |
| 62 | 3300050507 | nmdc:mga05p37_26508_c1 | nmdc:mga05p37_26508_c1_2542_3768 | 378 |
| 63 | 3300050512 | nmdc:mga0n895_35648_c1 | nmdc:mga0n895_35648_c1_1303_2529 | 378 |
| 64 | 3300050515 | nmdc:mga0a205_159203_c1 | nmdc:mga0a205_159203_c1_690_1916 | 378 |
| 65 | 3300005544 | Ga0070686_100108353 | Ga0070686_1001083533 | 379 |
| 66 | 3300025926 | Ga0207659_10004028 | Ga0207659_100040285 | 379 |
| 67 | 3300005330 | Ga0070690_100000820 | Ga0070690_10000082010 | 380 |
| 68 | 3300005335 | Ga0070666_10031267 | Ga0070666_100312672 | 380 |
| 69 | 3300005338 | Ga0068868_100004955 | Ga0068868_1000049554 | 380 |
| 70 | 3300005344 | Ga0070661_100029011 | Ga0070661_1000290114 | 380 |
| 71 | 3300005355 | Ga0070671_100007135 | Ga0070671_1000071353 | 380 |
| 72 | 3300005364 | Ga0070673_100167192 | Ga0070673_1001671922 | 380 |
| 73 | 3300005367 | Ga0070667_100010745 | Ga0070667_1000107455 | 380 |
| 74 | 3300005543 | Ga0070672_100013397 | Ga0070672_1000133973 | 380 |
| 75 | 3300005564 | Ga0070664_100025202 | Ga0070664_1000252023 | 380 |
| 76 | 3300005617 | Ga0068859_100143812 | Ga0068859_1001438122 | 380 |
| 77 | 3300005618 | Ga0068864_100056327 | Ga0068864_1000563272 | 380 |
| 78 | 3300005842 | Ga0068858_100156408 | Ga0068858_1001564082 | 380 |
| 79 | 3300006931 | Ga0097620_100143813 | Ga0097620_1001438132 | 380 |
| 80 | 3300009177 | Ga0105248_10000855 | Ga0105248_100008559 | 380 |
| 81 | 3300013296 | Ga0157374_10085220 | Ga0157374_100852202 | 380 |
| 82 | 3300013306 | Ga0163162_10000682 | Ga0163162_1000068215 | 380 |
| 83 | 3300013308 | Ga0157375_10015022 | Ga0157375_100150224 | 380 |
| 84 | 3300014745 | Ga0157377_10019080 | Ga0157377_100190803 | 380 |
| 85 | 3300025920 | Ga0207649_10023345 | Ga0207649_100233453 | 380 |
| 86 | 3300025925 | Ga0207650_10003387 | Ga0207650_100033872 | 380 |
| 87 | 3300025940 | Ga0207691_10003783 | Ga0207691_100037834 | 380 |
| 88 | 3300025941 | Ga0207711_10034305 | Ga0207711_100343053 | 380 |
| 89 | 3300025945 | Ga0207679_10049934 | Ga0207679_100499342 | 380 |
| 90 | 3300025986 | Ga0207658_10009498 | Ga0207658_100094985 | 380 |
| 91 | 3300026035 | Ga0207703_10017657 | Ga0207703_100176572 | 380 |
| 92 | 3300026088 | Ga0207641_10392295 | Ga0207641_103922951 | 380 |
| 93 | 3300009094 | Ga0111539_10187372 | Ga0111539_101873722 | 381 |
| 94 | 3300042156 | Ga0439446_0003963 | Ga0439446_0003963_2357_3544 | 381 |
| 95 | 3300009094 | Ga0111539_10076625 | Ga0111539_100766251 | 382 |
| 96 | 3300025941 | Ga0207711_10042184 | Ga0207711_100421842 | 382 |
| 97 | 3300046454 | Ga0495592_0004599 | Ga0495592_0004599_4723_5907 | 382 |
| 98 | 3300005330 | Ga0070690_100005823 | Ga0070690_1000058232 | 383 |
| 99 | 3300005333 | Ga0070677_10004097 | Ga0070677_100040971 | 383 |
| 100 | 3300005334 | Ga0068869_100018421 | Ga0068869_1000184211 | 383 |
| 101 | 3300005335 | Ga0070666_10002329 | Ga0070666_100023293 | 383 |
| 102 | 3300005338 | Ga0068868_100006647 | Ga0068868_1000066473 | 383 |
| 103 | 3300005340 | Ga0070689_100008165 | Ga0070689_1000081652 | 383 |
| 104 | 3300005344 | Ga0070661_100015852 | Ga0070661_1000158521 | 383 |
| 105 | 3300005353 | Ga0070669_100007090 | Ga0070669_1000070904 | 383 |
| 106 | 3300005364 | Ga0070673_100020989 | Ga0070673_1000209892 | 383 |
| 107 | 3300005364 | Ga0070673_100150418 | Ga0070673_1001504182 | 383 |
| 108 | 3300005365 | Ga0070688_100021220 | Ga0070688_1000212202 | 383 |
| 109 | 3300005438 | Ga0070701_10035618 | Ga0070701_100356182 | 383 |
| 110 | 3300005441 | Ga0070700_100009904 | Ga0070700_1000099042 | 383 |
| 111 | 3300005456 | Ga0070678_100009015 | Ga0070678_1000090153 | 383 |
| 112 | 3300005457 | Ga0070662_100008443 | Ga0070662_1000084432 | 383 |
| 113 | 3300005459 | Ga0068867_100033949 | Ga0068867_1000339492 | 383 |
| 114 | 3300005466 | Ga0070685_10005421 | Ga0070685_100054212 | 383 |
| 115 | 3300005543 | Ga0070672_100007420 | Ga0070672_1000074202 | 383 |
| 116 | 3300005544 | Ga0070686_100007108 | Ga0070686_1000071083 | 383 |
| 117 | 3300005616 | Ga0068852_100025186 | Ga0068852_1000251862 | 383 |
| 118 | 3300005617 | Ga0068859_100025844 | Ga0068859_1000258442 | 383 |
| 119 | 3300005719 | Ga0068861_100007392 | Ga0068861_1000073922 | 383 |
| 120 | 3300005841 | Ga0068863_100008405 | Ga0068863_1000084054 | 383 |
| 121 | 3300005842 | Ga0068858_100011837 | Ga0068858_1000118374 | 383 |
| 122 | 3300005843 | Ga0068860_100020974 | Ga0068860_1000209742 | 383 |
| 123 | 3300005844 | Ga0068862_100008998 | Ga0068862_1000089983 | 383 |
| 124 | 3300006237 | Ga0097621_100139602 | Ga0097621_1001396022 | 383 |
| 125 | 3300006358 | Ga0068871_100066255 | Ga0068871_1000662552 | 383 |
| 126 | 3300006852 | Ga0075433_10000700 | Ga0075433_1000070013 | 383 |
| 127 | 3300006871 | Ga0075434_100027634 | Ga0075434_1000276343 | 383 |
| 128 | 3300006880 | Ga0075429_100071497 | Ga0075429_1000714972 | 383 |
| 129 | 3300006881 | Ga0068865_100108109 | Ga0068865_1001081092 | 383 |
| 130 | 3300006931 | Ga0097620_100025845 | Ga0097620_1000258452 | 383 |
| 131 | 3300007076 | Ga0075435_100344884 | Ga0075435_1003448841 | 383 |
| 132 | 3300009094 | Ga0111539_10011876 | Ga0111539_100118764 | 383 |
| 133 | 3300009094 | Ga0111539_10059097 | Ga0111539_100590971 | 383 |
| 134 | 3300009553 | Ga0105249_10022817 | Ga0105249_100228173 | 383 |
| 135 | 3300013296 | Ga0157374_10118873 | Ga0157374_101188731 | 383 |
| 136 | 3300013306 | Ga0163162_10001897 | Ga0163162_100018979 | 383 |
| 137 | 3300014968 | Ga0157379_10021773 | Ga0157379_100217732 | 383 |
| 138 | 3300014969 | Ga0157376_10016924 | Ga0157376_100169242 | 383 |
| 139 | 3300025315 | Ga0207697_10005141 | Ga0207697_100051412 | 383 |
| 140 | 3300025901 | Ga0207688_10002488 | Ga0207688_100024884 | 383 |
| 141 | 3300025907 | Ga0207645_10000934 | Ga0207645_1000093415 | 383 |
| 142 | 3300025920 | Ga0207649_10023440 | Ga0207649_100234401 | 383 |
| 143 | 3300025933 | Ga0207706_10009160 | Ga0207706_100091603 | 383 |
| 144 | 3300025940 | Ga0207691_10003732 | Ga0207691_1000373210 | 383 |
| 145 | 3300025942 | Ga0207689_10004838 | Ga0207689_100048382 | 383 |
| 146 | 3300025961 | Ga0207712_10028010 | Ga0207712_100280102 | 383 |
| 147 | 3300025972 | Ga0207668_10192622 | Ga0207668_101926221 | 383 |
| 148 | 3300026035 | Ga0207703_10170034 | Ga0207703_101700342 | 383 |
| 149 | 3300026075 | Ga0207708_10025687 | Ga0207708_100256872 | 383 |
| 150 | 3300026089 | Ga0207648_10005542 | Ga0207648_100055426 | 383 |
| 151 | 3300026118 | Ga0207675_100001646 | Ga0207675_1000016468 | 383 |
| 152 | 3300026121 | Ga0207683_10003465 | Ga0207683_100034652 | 383 |
| 153 | 3300027907 | Ga0207428_10007845 | Ga0207428_100078455 | 383 |
| 154 | 3300028381 | Ga0268264_10022426 | Ga0268264_100224262 | 383 |
| 155 | 3300035112 | Ga0373932_0002676 | Ga0373932_0002676_2437_3633 | 383 |
| 156 | 3300035691 | Ga0373931_0078455 | Ga0373931_0078455_525_1721 | 383 |
| 157 | 3300045051 | Ga0451576_0068336 | Ga0451576_0068336_462_1658 | 383 |
| 158 | 3300050511 | nmdc:mga08y16_35153_c1 | nmdc:mga08y16_35153_c1_4019_5215 | 383 |
| 159 | 3300050512 | nmdc:mga0n895_4950_c1 | nmdc:mga0n895_4950_c1_4120_5316 | 383 |
| 160 | 3300050515 | nmdc:mga0a205_2715_c1 | nmdc:mga0a205_2715_c1_9018_10214 | 383 |
| 161 | 3300006237 | Ga0097621_100098773 | Ga0097621_1000987732 | 384 |
| 162 | 3300014969 | Ga0157376_10110602 | Ga0157376_101106022 | 384 |
| 163 | 3300031548 | Ga0307408_100013146 | Ga0307408_1000131465 | 384 |
| 164 | 3300031731 | Ga0307405_10108183 | Ga0307405_101081832 | 384 |
| 165 | 3300048910 | Ga0496107_0136260 | Ga0496107_0136260_310_1515 | 385 |
| 166 | 3300049589 | Ga0501073_0101303 | Ga0501073_0101303_687_1880 | 385 |
| 167 | 3300005328 | Ga0070676_10013029 | Ga0070676_100130292 | 386 |
| 168 | 3300005343 | Ga0070687_100000631 | Ga0070687_1000006315 | 386 |
| 169 | 3300005467 | Ga0070706_100173076 | Ga0070706_1001730762 | 386 |
| 170 | 3300005548 | Ga0070665_100060521 | Ga0070665_1000605212 | 386 |
| 171 | 3300005840 | Ga0068870_10000623 | Ga0068870_100006235 | 386 |
| 172 | 3300009098 | Ga0105245_10079029 | Ga0105245_100790292 | 386 |
| 173 | 3300009177 | Ga0105248_10002306 | Ga0105248_100023064 | 386 |
| 174 | 3300014326 | Ga0157380_10004940 | Ga0157380_100049402 | 386 |
| 175 | 3300025908 | Ga0207643_10000549 | Ga0207643_100005492 | 386 |
| 176 | 3300025910 | Ga0207684_10304688 | Ga0207684_103046882 | 386 |
| 177 | 3300025918 | Ga0207662_10004054 | Ga0207662_100040543 | 386 |
| 178 | 3300025941 | Ga0207711_10044451 | Ga0207711_100444513 | 386 |
| 179 | 3300048912 | Ga0496109_0048575 | Ga0496109_0048575_2111_3307 | 386 |
| 180 | 3300005290 | Ga0065712_10070828 | Ga0065712_100708284 | 387 |
| 181 | 3300005329 | Ga0070683_100000381 | Ga0070683_1000003813 | 387 |
| 182 | 3300005331 | Ga0070670_100012676 | Ga0070670_1000126762 | 387 |
| 183 | 3300005367 | Ga0070667_100047236 | Ga0070667_1000472364 | 387 |
| 184 | 3300005618 | Ga0068864_100076462 | Ga0068864_1000764622 | 387 |
| 185 | 3300014325 | Ga0163163_10008840 | Ga0163163_100088405 | 387 |
| 186 | 3300025920 | Ga0207649_10064228 | Ga0207649_100642283 | 387 |
| 187 | 3300025944 | Ga0207661_10066688 | Ga0207661_100666883 | 387 |
| 188 | 3300048907 | Ga0496104_0028993 | Ga0496104_0028993_545_1768 | 387 |
| 189 | 3300048911 | Ga0496108_0033185 | Ga0496108_0033185_1549_2772 | 387 |
| 190 | 3300048913 | Ga0496110_0005898 | Ga0496110_0005898_7926_9149 | 387 |
| 191 | 3300048915 | Ga0496112_0012410 | Ga0496112_0012410_5608_6831 | 387 |
| 192 | 3300048916 | Ga0496113_0276596 | Ga0496113_0276596_108_1331 | 387 |
| 193 | 3300005290 | Ga0065712_10074332 | Ga0065712_100743322 | 388 |
| 194 | 3300005718 | Ga0068866_10007118 | Ga0068866_100071185 | 388 |
| 195 | 3300013297 | Ga0157378_10005992 | Ga0157378_100059922 | 388 |
| 196 | 3300025899 | Ga0207642_10031159 | Ga0207642_100311593 | 388 |
| 197 | 3300048916 | Ga0496113_0065109 | Ga0496113_0065109_182_1384 | 388 |
| 198 | 3300006871 | Ga0075434_100177156 | Ga0075434_1001771562 | 390 |
| 199 | 3300050512 | nmdc:mga0n895_172816_c1 | nmdc:mga0n895_172816_c1_685_1914 | 390 |
| 200 | 3300025940 | Ga0207691_10142610 | Ga0207691_101426102 | 391 |
| 201 | 3300005340 | Ga0070689_100109698 | Ga0070689_1001096983 | 392 |
| 202 | 3300013308 | Ga0157375_10226532 | Ga0157375_102265321 | 392 |
| 203 | 3300025936 | Ga0207670_10141993 | Ga0207670_101419932 | 392 |
| 204 | 3300026035 | Ga0207703_10313806 | Ga0207703_103138061 | 392 |
| 205 | 3300036401 | Ga0373937_0041355 | Ga0373937_0041355_2424_3668 | 392 |
| 206 | 3300005467 | Ga0070706_100161581 | Ga0070706_1001615812 | 393 |
| 207 | 3300025910 | Ga0207684_10138383 | Ga0207684_101383832 | 393 |
| 208 | 3300034818 | Ga0373950_0000022 | Ga0373950_0000022_146637_147908 | 394 |
| 209 | 3300048917 | Ga0496114_0168217 | Ga0496114_0168217_422_1693 | 394 |
| 210 | 3300049579 | Ga0501043_0003390 | Ga0501043_0003390_1224_2507 | 394 |
| 211 | 3300049580 | Ga0501046_0002667 | Ga0501046_0002667_1333_2616 | 394 |
| 212 | 3300049581 | Ga0501047_0000027 | Ga0501047_0000027_118406_119689 | 394 |
| 213 | 3300049582 | Ga0501048_0002385 | Ga0501048_0002385_1071_2354 | 394 |
| 214 | 3300049584 | Ga0501068_0023988 | Ga0501068_0023988_1776_3059 | 394 |
| 215 | 3300049588 | Ga0501072_0000035 | Ga0501072_0000035_107489_108772 | 394 |
| 216 | 3300049589 | Ga0501073_0008088 | Ga0501073_0008088_461_1744 | 394 |
| 217 | 3300049741 | Ga0501079_0026651 | Ga0501079_0026651_1344_2627 | 394 |
| 218 | 3300049742 | Ga0501080_0004020 | Ga0501080_0004020_11510_12793 | 394 |
| 219 | 3300054114 | Ga0501084_0000012 | Ga0501084_0000012_56163_57446 | 394 |
| 220 | 3300049744 | Ga0501083_0096817 | Ga0501083_0096817_675_1922 | 395 |
| 221 | 3300005290 | Ga0065712_10070617 | Ga0065712_100706174 | 396 |
| 222 | 3300005618 | Ga0068864_100032862 | Ga0068864_1000328623 | 396 |
| 223 | 3300026095 | Ga0207676_10023630 | Ga0207676_100236304 | 396 |
| 224 | 3300025925 | Ga0207650_10104529 | Ga0207650_101045294 | 397 |
| 225 | 3300013308 | Ga0157375_10064292 | Ga0157375_100642923 | 403 |
| 226 | 3300014326 | Ga0157380_10265899 | Ga0157380_102658991 | 405 |
| 227 | 3300005331 | Ga0070670_100060165 | Ga0070670_1000601653 | 406 |
| 228 | 3300005564 | Ga0070664_100106957 | Ga0070664_1001069572 | 406 |
| 229 | 3300025926 | Ga0207659_10148594 | Ga0207659_101485942 | 406 |
| 230 | 3300025944 | Ga0207661_10268178 | Ga0207661_102681781 | 406 |
| 231 | 3300005293 | Ga0065715_10104871 | Ga0065715_101048712 | 407 |
| 232 | 3300005354 | Ga0070675_100065454 | Ga0070675_1000654542 | 407 |
| 233 | 3300005356 | Ga0070674_100048885 | Ga0070674_1000488852 | 407 |
| 234 | 3300005365 | Ga0070688_100044095 | Ga0070688_1000440952 | 407 |
| 235 | 3300017792 | Ga0163161_10019089 | Ga0163161_100190894 | 407 |
| 236 | 3300005290 | Ga0065712_10006670 | Ga0065712_100066703 | 418 |
| 237 | 3300005458 | Ga0070681_10171254 | Ga0070681_101712542 | 418 |
| 238 | 3300005618 | Ga0068864_100201021 | Ga0068864_1002010212 | 418 |
| 239 | 3300005840 | Ga0068870_10012886 | Ga0068870_100128863 | 418 |
| 240 | 3300006931 | Ga0097620_100048025 | Ga0097620_1000480254 | 418 |
| 241 | 3300025908 | Ga0207643_10007175 | Ga0207643_100071756 | 418 |
| 242 | 3300025914 | Ga0207671_10126896 | Ga0207671_101268962 | 418 |
| 243 | 3300025923 | Ga0207681_10005153 | Ga0207681_100051535 | 418 |
| 244 | 3300026142 | Ga0207698_10193563 | Ga0207698_101935631 | 418 |
| 245 | 3300028380 | Ga0268265_10060593 | Ga0268265_100605932 | 418 |
| 246 | 3300026118 | Ga0207675_100131088 | Ga0207675_1001310882 | 422 |
| 247 | 3300005290 | Ga0065712_10000117 | Ga0065712_100001179 | 423 |
| 248 | 3300005293 | Ga0065715_10001480 | Ga0065715_1000148010 | 423 |
| 249 | 3300025961 | Ga0207712_10000700 | Ga0207712_100007006 | 423 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zyt-assembly1.cif.gz_A | structure determination of esta from arthrobacter nitroguajacolicus rue61a | 0.856 | 44 | 416 |
| 5gmx-assembly2.cif.gz_B | crystal structure of a family viii carboxylesterase | 0.8551 | 39 | 413 |
| 5gkv-assembly1.cif.gz_A | crystal structure of a novel penicillin-binding protein (pbp) homolog from caulobacter crescentus | 0.8493 | 39 | 413 |
| 5gmx-assembly2.cif.gz_B | crystal structure of a family viii carboxylesterase | 0.8484 | 39 | 413 |
| 5gkv-assembly1.cif.gz_A | crystal structure of a novel penicillin-binding protein (pbp) homolog from caulobacter crescentus | 0.8429 | 39 | 413 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q21523_36_427_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8789 | 41 | 414 | 3.40.710.10 |
| af_Q21569_36_429_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8687 | 41 | 418 | 3.40.710.10 |
| 3zytA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.856 | 44 | 416 | 3.40.710.10 |
| af_Q09621_65_456_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8555 | 41 | 416 | 3.40.710.10 |
| af_Q18384_35_423_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8456 | 41 | 415 | 3.40.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7QB96-F1-model_v4 | Beta-lactamase family protein | 0.9776 | 40 | 253 |
|
| AF-A0A100JEI2-F1-model_v4 | deleted | 0.9689 | 38 | 252 |
|
| AF-A0A535TA19-F1-model_v4 | Beta-lactamase family protein | 0.9672 | 36 | 227 |
|
| AF-A0A535TA19-F1-model_v4 | Beta-lactamase family protein | 0.9623 | 36 | 227 |
|
| AF-A0A6I2VWQ9-F1-model_v4 | Serine hydrolase | 0.961 | 38 | 238 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar