F360783

General Info

Members Datasets Scaffolds Average Seq Length
249 145 249 392

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10138383|Ga0207684_101383832
Length 455
Sequence LPTASGERATAAPVIAEISAGLFLEKSLVSAAFSASAEGHGAVLAFAHAGPANATALNMTFANAAITSERDDRPAGFPEVHGEVSRGFGAVREAFEENFAHRQELGGACCAYRHGEKVADLWGGIRDKGTGEPWEQDTMVLVYSATKGLAAMTLALAHSRRWLDYEERVAAYWPEFAQHDKGKITVRQLLAHQAGLFAFDEPVDRSVVADLDQLAVVLARQKPAWEPGTRQAYHAITLGFYEGELLRRLDPRHRSLGQFFQDEIATPLGLDVYIRLPEEIPNSRLATLATPSPFRMLLDFPIHLTLDGMNRHSNIYRALITNPGFAIAHDQQRVYARNLEVPSGGAVGTARAIARAYGVFAAGGQELGLRRETLDLLAAPAIPAVHGFYDECMKGELQFSLGFMKPGPGWRFGGPRSFADPDAGIGYAYVTSQMGTRLTGDSRDVALRDALYSAL

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.22
Rhizosphere 94.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10000117 3300005290 Bacteria 235194
2 Ga0065712_10006670 3300005290 Bacteria 3345
3 Ga0065712_10070617 3300005290 Bacteria 5828
4 Ga0065712_10070828 3300005290 Bacteria 5673
5 Ga0065712_10074332 3300005290 Unclassified 4108
6 Ga0065715_10001480 3300005293 Bacteria 8670
7 Ga0065715_10104871 3300005293 Bacteria 2930
8 Ga0065715_10178688 3300005293 Unclassified 1492
9 Ga0070676_10013029 3300005328 Bacteria 4556
10 Ga0070683_100000381 3300005329 Bacteria 30849
11 Ga0070690_100000820 3300005330 Bacteria 15769
12 Ga0070690_100005823 3300005330 Bacteria 6947
13 Ga0070670_100012676 3300005331 Bacteria 7218
14 Ga0070670_100060165 3300005331 Bacteria 3261
15 Ga0070677_10004097 3300005333 Bacteria 4730
16 Ga0068869_100018421 3300005334 Bacteria 4753
17 Ga0068869_100203264 3300005334 Unclassified 1563
18 Ga0070666_10002329 3300005335 Bacteria 11478
19 Ga0070666_10031267 3300005335 Bacteria 3514
20 Ga0068868_100004955 3300005338 Bacteria 9353
21 Ga0068868_100006647 3300005338 Bacteria 8203
22 Ga0070689_100008165 3300005340 Bacteria 7357
23 Ga0070689_100109698 3300005340 Bacteria 2193
24 Ga0070687_100000631 3300005343 Bacteria 11651
25 Ga0070661_100015852 3300005344 Bacteria 5318
26 Ga0070661_100029011 3300005344 Bacteria 3992
27 Ga0070669_100007090 3300005353 Bacteria 8052
28 Ga0070669_100014274 3300005353 Bacteria 5652
29 Ga0070675_100000931 3300005354 Bacteria 20813
30 Ga0070675_100065454 3300005354 Bacteria 3005
31 Ga0070671_100007135 3300005355 Bacteria 8927
32 Ga0070671_100014423 3300005355 Bacteria 6386
33 Ga0070674_100048885 3300005356 Unclassified 2905
34 Ga0070673_100020989 3300005364 Bacteria 4723
35 Ga0070673_100121401 3300005364 Bacteria 2180
36 Ga0070673_100150418 3300005364 Bacteria 1971
37 Ga0070673_100167192 3300005364 Bacteria 1875
38 Ga0070688_100021220 3300005365 Bacteria 3791
39 Ga0070688_100044095 3300005365 Unclassified 2751
40 Ga0070667_100010745 3300005367 Bacteria 7565
41 Ga0070667_100047236 3300005367 Bacteria 3622
42 Ga0070667_100057857 3300005367 Unclassified 3277
43 Ga0070701_10035618 3300005438 Bacteria 2502
44 Ga0070700_100009904 3300005441 Bacteria 5244
45 Ga0070663_100056214 3300005455 Bacteria 2819
46 Ga0070678_100009015 3300005456 Bacteria 6011
47 Ga0070662_100008443 3300005457 Bacteria 6715
48 Ga0070681_10171254 3300005458 Bacteria 2093
49 Ga0068867_100033949 3300005459 Bacteria 3697
50 Ga0070685_10005421 3300005466 Bacteria 6461
51 Ga0070706_100161581 3300005467 Bacteria 2092
52 Ga0070706_100173076 3300005467 Bacteria 2016
53 Ga0070672_100007420 3300005543 Bacteria 7435
54 Ga0070672_100013397 3300005543 Bacteria 5793
55 Ga0070686_100007108 3300005544 Bacteria 6243
56 Ga0070686_100108353 3300005544 Bacteria 1888
57 Ga0070665_100060521 3300005548 Bacteria 3796
58 Ga0070665_100242406 3300005548 Bacteria 1803
59 Ga0070664_100025202 3300005564 Bacteria 4927
60 Ga0070664_100106957 3300005564 Bacteria 2438
61 Ga0068852_100025186 3300005616 Bacteria 4817
62 Ga0068859_100025844 3300005617 Bacteria 5891
63 Ga0068859_100143812 3300005617 Bacteria 2459
64 Ga0068864_100032862 3300005618 Bacteria 4409
65 Ga0068864_100056327 3300005618 Bacteria 3396
66 Ga0068864_100076462 3300005618 Bacteria 2926
67 Ga0068864_100201021 3300005618 Bacteria 1830
68 Ga0068866_10007118 3300005718 Unclassified 4677
69 Ga0068861_100007392 3300005719 Bacteria 7527
70 Ga0068870_10000623 3300005840 Bacteria 13495
71 Ga0068870_10012886 3300005840 Bacteria 3916
72 Ga0068863_100008405 3300005841 Bacteria 10081
73 Ga0068863_100050777 3300005841 Unclassified 3930
74 Ga0068863_100066807 3300005841 Unclassified 3401
75 Ga0068858_100011837 3300005842 Bacteria 8225
76 Ga0068858_100156408 3300005842 Bacteria 2145
77 Ga0068860_100020974 3300005843 Bacteria 6331
78 Ga0068860_100095007 3300005843 Unclassified 2841
79 Ga0068862_100008998 3300005844 Bacteria 8265
80 Ga0097621_100001181 3300006237 Bacteria 18107
81 Ga0097621_100043534 3300006237 Unclassified 3619
82 Ga0097621_100098773 3300006237 Bacteria 2453
83 Ga0097621_100139602 3300006237 Bacteria 2070
84 Ga0068871_100006872 3300006358 Bacteria 8102
85 Ga0068871_100016404 3300006358 Bacteria 5577
86 Ga0068871_100066255 3300006358 Bacteria 2960
87 Ga0075433_10000700 3300006852 Bacteria 22873
88 Ga0075433_10137251 3300006852 Unclassified 2174
89 Ga0075434_100027634 3300006871 Bacteria 5571
90 Ga0075434_100177156 3300006871 Bacteria 2152
91 Ga0075429_100071497 3300006880 Bacteria 3021
92 Ga0068865_100000259 3300006881 Bacteria 29371
93 Ga0068865_100108109 3300006881 Unclassified 2046
94 Ga0097620_100025845 3300006931 Bacteria 5891
95 Ga0097620_100048025 3300006931 Unclassified 4288
96 Ga0097620_100143813 3300006931 Bacteria 2459
97 Ga0075435_100344884 3300007076 Unclassified 1276
98 Ga0111539_10011876 3300009094 Bacteria 10916
99 Ga0111539_10059097 3300009094 Bacteria 4548
100 Ga0111539_10076625 3300009094 Unclassified 3937
101 Ga0111539_10187372 3300009094 Bacteria 2416
102 Ga0105245_10065143 3300009098 Unclassified 3295
103 Ga0105245_10079029 3300009098 Bacteria 3003
104 Ga0114129_10675615 3300009147 Bacteria 1330
105 Ga0105242_10004686 3300009176 Bacteria 10585
106 Ga0105248_10000855 3300009177 Bacteria 34244
107 Ga0105248_10002166 3300009177 Bacteria 21736
108 Ga0105248_10002306 3300009177 Bacteria 21143
109 Ga0105248_10021153 3300009177 Bacteria 7208
110 Ga0105248_10062582 3300009177 Unclassified 4178
111 Ga0105249_10022817 3300009553 Bacteria 5610
112 Ga0105246_10109450 3300011119 Unclassified 2027
113 Ga0157374_10085220 3300013296 Bacteria 3004
114 Ga0157374_10118873 3300013296 Bacteria 2549
115 Ga0157378_10005992 3300013297 Bacteria 10655
116 Ga0163162_10000682 3300013306 Bacteria 31472
117 Ga0163162_10001897 3300013306 Bacteria 19696
118 Ga0157375_10015022 3300013308 Bacteria 6926
119 Ga0157375_10064292 3300013308 Bacteria 3653
120 Ga0157375_10226532 3300013308 Unclassified 2028
121 Ga0157375_10379746 3300013308 Bacteria 1580
122 Ga0157375_10506248 3300013308 Unclassified 1372
123 Ga0163163_10008840 3300014325 Bacteria 8966
124 Ga0163163_10040312 3300014325 Bacteria 4560
125 Ga0163163_10100321 3300014325 Unclassified 2917
126 Ga0157380_10004940 3300014326 Bacteria 9294
127 Ga0157380_10059571 3300014326 Bacteria 3048
128 Ga0157380_10265899 3300014326 Bacteria 1560
129 Ga0157377_10019080 3300014745 Bacteria 3578
130 Ga0157379_10021773 3300014968 Bacteria 5679
131 Ga0157376_10016924 3300014969 Bacteria 5549
132 Ga0157376_10091072 3300014969 Unclassified 2641
133 Ga0157376_10110602 3300014969 Bacteria 2417
134 Ga0163161_10019089 3300017792 Bacteria 4805
135 Ga0207697_10005141 3300025315 Bacteria 6115
136 Ga0207642_10031159 3300025899 Bacteria 2230
137 Ga0207688_10002488 3300025901 Bacteria 9918
138 Ga0207680_10008085 3300025903 Bacteria 5153
139 Ga0207645_10000934 3300025907 Bacteria 24226
140 Ga0207643_10000549 3300025908 Bacteria 24008
141 Ga0207643_10007175 3300025908 Bacteria 5981
142 Ga0207684_10138383 3300025910 Bacteria 2092
143 Ga0207684_10304688 3300025910 Bacteria 1373
144 Ga0207671_10126896 3300025914 Unclassified 1955
145 Ga0207662_10004054 3300025918 Bacteria 7642
146 Ga0207649_10023345 3300025920 Bacteria 3582
147 Ga0207649_10023440 3300025920 Bacteria 3575
148 Ga0207649_10064228 3300025920 Bacteria 2320
149 Ga0207681_10005153 3300025923 Bacteria 8028
150 Ga0207681_10044404 3300025923 Bacteria 2978
151 Ga0207650_10003387 3300025925 Bacteria 10967
152 Ga0207650_10104529 3300025925 Unclassified 2185
153 Ga0207659_10004028 3300025926 Bacteria 8865
154 Ga0207659_10004416 3300025926 Bacteria 8502
155 Ga0207659_10148594 3300025926 Bacteria 1827
156 Ga0207687_10029525 3300025927 Unclassified 3689
157 Ga0207644_10199612 3300025931 Unclassified 1577
158 Ga0207706_10009160 3300025933 Bacteria 9104
159 Ga0207686_10005405 3300025934 Bacteria 6851
160 Ga0207686_10008696 3300025934 Bacteria 5485
161 Ga0207670_10141993 3300025936 Bacteria 1772
162 Ga0207691_10003732 3300025940 Bacteria 14779
163 Ga0207691_10003783 3300025940 Bacteria 14696
164 Ga0207691_10142610 3300025940 Bacteria 2110
165 Ga0207691_10158271 3300025940 Bacteria 1988
166 Ga0207711_10012726 3300025941 Bacteria 6987
167 Ga0207711_10034305 3300025941 Bacteria 4298
168 Ga0207711_10042184 3300025941 Unclassified 3888
169 Ga0207711_10044451 3300025941 Bacteria 3792
170 Ga0207689_10004838 3300025942 Bacteria 12145
171 Ga0207661_10066688 3300025944 Bacteria 2924
172 Ga0207661_10268178 3300025944 Bacteria 1523
173 Ga0207679_10049934 3300025945 Bacteria 3054
174 Ga0207651_10101220 3300025960 Bacteria 2138
175 Ga0207712_10000700 3300025961 Bacteria 25879
176 Ga0207712_10028010 3300025961 Bacteria 3766
177 Ga0207668_10192622 3300025972 Unclassified 1617
178 Ga0207658_10009498 3300025986 Bacteria 6601
179 Ga0207658_10031468 3300025986 Unclassified 3768
180 Ga0207703_10017657 3300026035 Bacteria 5570
181 Ga0207703_10046107 3300026035 Unclassified 3510
182 Ga0207703_10170034 3300026035 Bacteria 1916
183 Ga0207703_10313806 3300026035 Bacteria 1434
184 Ga0207678_10077531 3300026067 Bacteria 2847
185 Ga0207708_10025687 3300026075 Bacteria 4457
186 Ga0207641_10039932 3300026088 Unclassified 3926
187 Ga0207641_10392295 3300026088 Bacteria 1331
188 Ga0207648_10005542 3300026089 Bacteria 12711
189 Ga0207676_10023630 3300026095 Bacteria 4538
190 Ga0207674_10124153 3300026116 Bacteria 2547
191 Ga0207675_100001646 3300026118 Bacteria 22365
192 Ga0207675_100131088 3300026118 Unclassified 2377
193 Ga0207683_10003465 3300026121 Bacteria 13768
194 Ga0207698_10193563 3300026142 Bacteria 1814
195 Ga0207428_10007845 3300027907 Bacteria 9709
196 Ga0268265_10060593 3300028380 Bacteria 2901
197 Ga0268264_10022426 3300028381 Bacteria 5156
198 Ga0268264_10186292 3300028381 Unclassified 1889
199 Ga0307408_100013146 3300031548 Bacteria 5493
200 Ga0307405_10108183 3300031731 Unclassified 1878
201 Ga0373950_0000022 3300034818 Bacteria 206268
202 Ga0373932_0002676 3300035112 Bacteria 4435
203 Ga0373931_0078455 3300035691 Bacteria 1817
204 Ga0373937_0010326 3300036401 Bacteria 8151
205 Ga0373937_0041355 3300036401 Unclassified 4204
206 Ga0439446_0003963 3300042156 Bacteria 3724
207 Ga0439446_0008863 3300042156 Bacteria 2683
208 Ga0451576_0068336 3300045051 Bacteria 3697
209 Ga0451576_0133546 3300045051 Unclassified 2587
210 Ga0495592_0004599 3300046454 Bacteria 10103
211 Ga0495596_0015950 3300046500 Bacteria 3129
212 Ga0496104_0028993 3300048907 Bacteria 5132
213 Ga0496107_0136260 3300048910 Bacteria 1814
214 Ga0496108_0033185 3300048911 Bacteria 4288
215 Ga0496108_0037887 3300048911 Bacteria 4017
216 Ga0496109_0048575 3300048912 Bacteria 3861
217 Ga0496110_0005898 3300048913 Bacteria 9642
218 Ga0496112_0000921 3300048915 Bacteria 21264
219 Ga0496112_0012410 3300048915 Bacteria 7832
220 Ga0496113_0005194 3300048916 Bacteria 8098
221 Ga0496113_0065109 3300048916 Unclassified 2758
222 Ga0496113_0276596 3300048916 Bacteria 1342
223 Ga0496114_0168217 3300048917 Bacteria 1909
224 Ga0496114_0368527 3300048917 Bacteria 1271
225 Ga0501039_0033673 3300049575 Unclassified 3952
226 Ga0501043_0003390 3300049579 Bacteria 13115
227 Ga0501046_0002667 3300049580 Bacteria 16642
228 Ga0501047_0000027 3300049581 Bacteria 222226
229 Ga0501048_0002385 3300049582 Bacteria 14348
230 Ga0501068_0023988 3300049584 Bacteria 3578
231 Ga0501072_0000035 3300049588 Bacteria 120775
232 Ga0501073_0008088 3300049589 Bacteria 7801
233 Ga0501073_0101303 3300049589 Bacteria 2000
234 Ga0501075_0039664 3300049591 Unclassified 3524
235 Ga0501076_0104827 3300049592 Bacteria 2282
236 Ga0501079_0026651 3300049741 Bacteria 4431
237 Ga0501080_0004020 3300049742 Bacteria 13024
238 Ga0501081_0038767 3300049743 Unclassified 3258
239 Ga0501083_0096817 3300049744 Bacteria 1947
240 nmdc:mga05p37_26508_c1 3300050507 Bacteria 7049
241 nmdc:mga05p37_40975_c1 3300050507 Bacteria 5687
242 nmdc:mga08y16_35153_c1 3300050511 Bacteria 5264
243 nmdc:mga08y16_5927_c1 3300050511 Bacteria 12813
244 nmdc:mga0n895_172816_c1 3300050512 Bacteria 2192
245 nmdc:mga0n895_35648_c1 3300050512 Unclassified 4798
246 nmdc:mga0n895_4950_c1 3300050512 Bacteria 11051
247 nmdc:mga0a205_159203_c1 3300050515 Unclassified 2155
248 nmdc:mga0a205_2715_c1 3300050515 Bacteria 15633
249 Ga0501084_0000012 3300054114 Bacteria 175851

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100203264 Ga0068869_1002032642 333
2 3300006237 Ga0097621_100001181 Ga0097621_1000011818 357
3 3300006358 Ga0068871_100006872 Ga0068871_1000068724 357
4 3300006881 Ga0068865_100000259 Ga0068865_1000002599 357
5 3300025934 Ga0207686_10008696 Ga0207686_100086963 357
6 3300005455 Ga0070663_100056214 Ga0070663_1000562143 359
7 3300026067 Ga0207678_10077531 Ga0207678_100775312 359
8 3300048917 Ga0496114_0368527 Ga0496114_0368527_23_1192 360
9 3300042156 Ga0439446_0008863 Ga0439446_0008863_1194_2387 363
10 3300005367 Ga0070667_100057857 Ga0070667_1000578574 365
11 3300005548 Ga0070665_100242406 Ga0070665_1002424062 365
12 3300005841 Ga0068863_100066807 Ga0068863_1000668073 365
13 3300005843 Ga0068860_100095007 Ga0068860_1000950074 365
14 3300006237 Ga0097621_100043534 Ga0097621_1000435344 365
15 3300006358 Ga0068871_100016404 Ga0068871_1000164044 365
16 3300009098 Ga0105245_10065143 Ga0105245_100651432 365
17 3300009177 Ga0105248_10062582 Ga0105248_100625823 365
18 3300011119 Ga0105246_10109450 Ga0105246_101094501 365
19 3300014325 Ga0163163_10100321 Ga0163163_101003213 365
20 3300014969 Ga0157376_10091072 Ga0157376_100910722 365
21 3300025903 Ga0207680_10008085 Ga0207680_100080854 365
22 3300025927 Ga0207687_10029525 Ga0207687_100295253 365
23 3300025934 Ga0207686_10005405 Ga0207686_100054055 365
24 3300025941 Ga0207711_10012726 Ga0207711_100127267 365
25 3300025986 Ga0207658_10031468 Ga0207658_100314684 365
26 3300026035 Ga0207703_10046107 Ga0207703_100461073 365
27 3300028381 Ga0268264_10186292 Ga0268264_101862922 365
28 3300005355 Ga0070671_100014423 Ga0070671_1000144234 367
29 3300013308 Ga0157375_10506248 Ga0157375_105062481 367
30 3300025931 Ga0207644_10199612 Ga0207644_101996122 367
31 3300036401 Ga0373937_0010326 Ga0373937_0010326_1051_2229 367
32 3300009147 Ga0114129_10675615 Ga0114129_106756151 368
33 3300050511 nmdc:mga08y16_5927_c1 nmdc:mga08y16_5927_c1_10906_12129 368
34 3300050507 nmdc:mga05p37_40975_c1 nmdc:mga05p37_40975_c1_1729_2919 370
35 3300005353 Ga0070669_100014274 Ga0070669_1000142747 371
36 3300005354 Ga0070675_100000931 Ga0070675_10000093119 371
37 3300005364 Ga0070673_100121401 Ga0070673_1001214012 371
38 3300014326 Ga0157380_10059571 Ga0157380_100595713 371
39 3300025923 Ga0207681_10044404 Ga0207681_100444042 371
40 3300025926 Ga0207659_10004416 Ga0207659_100044168 371
41 3300025960 Ga0207651_10101220 Ga0207651_101012202 371
42 3300005841 Ga0068863_100050777 Ga0068863_1000507773 374
43 3300013308 Ga0157375_10379746 Ga0157375_103797461 374
44 3300025940 Ga0207691_10158271 Ga0207691_101582711 374
45 3300026088 Ga0207641_10039932 Ga0207641_100399324 374
46 3300026116 Ga0207674_10124153 Ga0207674_101241532 375
47 3300045051 Ga0451576_0133546 Ga0451576_0133546_570_1781 375
48 3300046500 Ga0495596_0015950 Ga0495596_0015950_1640_2860 375
49 3300005293 Ga0065715_10178688 Ga0065715_101786881 377
50 3300009176 Ga0105242_10004686 Ga0105242_100046864 377
51 3300009177 Ga0105248_10002166 Ga0105248_100021667 377
52 3300009177 Ga0105248_10021153 Ga0105248_100211534 377
53 3300014325 Ga0163163_10040312 Ga0163163_100403127 377
54 3300048911 Ga0496108_0037887 Ga0496108_0037887_2544_3716 377
55 3300048915 Ga0496112_0000921 Ga0496112_0000921_1247_2419 377
56 3300048916 Ga0496113_0005194 Ga0496113_0005194_1786_2958 377
57 3300006852 Ga0075433_10137251 Ga0075433_101372512 378
58 3300049575 Ga0501039_0033673 Ga0501039_0033673_932_2269 378
59 3300049591 Ga0501075_0039664 Ga0501075_0039664_1670_3007 378
60 3300049592 Ga0501076_0104827 Ga0501076_0104827_161_1498 378
61 3300049743 Ga0501081_0038767 Ga0501081_0038767_634_1839 378
62 3300050507 nmdc:mga05p37_26508_c1 nmdc:mga05p37_26508_c1_2542_3768 378
63 3300050512 nmdc:mga0n895_35648_c1 nmdc:mga0n895_35648_c1_1303_2529 378
64 3300050515 nmdc:mga0a205_159203_c1 nmdc:mga0a205_159203_c1_690_1916 378
65 3300005544 Ga0070686_100108353 Ga0070686_1001083533 379
66 3300025926 Ga0207659_10004028 Ga0207659_100040285 379
67 3300005330 Ga0070690_100000820 Ga0070690_10000082010 380
68 3300005335 Ga0070666_10031267 Ga0070666_100312672 380
69 3300005338 Ga0068868_100004955 Ga0068868_1000049554 380
70 3300005344 Ga0070661_100029011 Ga0070661_1000290114 380
71 3300005355 Ga0070671_100007135 Ga0070671_1000071353 380
72 3300005364 Ga0070673_100167192 Ga0070673_1001671922 380
73 3300005367 Ga0070667_100010745 Ga0070667_1000107455 380
74 3300005543 Ga0070672_100013397 Ga0070672_1000133973 380
75 3300005564 Ga0070664_100025202 Ga0070664_1000252023 380
76 3300005617 Ga0068859_100143812 Ga0068859_1001438122 380
77 3300005618 Ga0068864_100056327 Ga0068864_1000563272 380
78 3300005842 Ga0068858_100156408 Ga0068858_1001564082 380
79 3300006931 Ga0097620_100143813 Ga0097620_1001438132 380
80 3300009177 Ga0105248_10000855 Ga0105248_100008559 380
81 3300013296 Ga0157374_10085220 Ga0157374_100852202 380
82 3300013306 Ga0163162_10000682 Ga0163162_1000068215 380
83 3300013308 Ga0157375_10015022 Ga0157375_100150224 380
84 3300014745 Ga0157377_10019080 Ga0157377_100190803 380
85 3300025920 Ga0207649_10023345 Ga0207649_100233453 380
86 3300025925 Ga0207650_10003387 Ga0207650_100033872 380
87 3300025940 Ga0207691_10003783 Ga0207691_100037834 380
88 3300025941 Ga0207711_10034305 Ga0207711_100343053 380
89 3300025945 Ga0207679_10049934 Ga0207679_100499342 380
90 3300025986 Ga0207658_10009498 Ga0207658_100094985 380
91 3300026035 Ga0207703_10017657 Ga0207703_100176572 380
92 3300026088 Ga0207641_10392295 Ga0207641_103922951 380
93 3300009094 Ga0111539_10187372 Ga0111539_101873722 381
94 3300042156 Ga0439446_0003963 Ga0439446_0003963_2357_3544 381
95 3300009094 Ga0111539_10076625 Ga0111539_100766251 382
96 3300025941 Ga0207711_10042184 Ga0207711_100421842 382
97 3300046454 Ga0495592_0004599 Ga0495592_0004599_4723_5907 382
98 3300005330 Ga0070690_100005823 Ga0070690_1000058232 383
99 3300005333 Ga0070677_10004097 Ga0070677_100040971 383
100 3300005334 Ga0068869_100018421 Ga0068869_1000184211 383
101 3300005335 Ga0070666_10002329 Ga0070666_100023293 383
102 3300005338 Ga0068868_100006647 Ga0068868_1000066473 383
103 3300005340 Ga0070689_100008165 Ga0070689_1000081652 383
104 3300005344 Ga0070661_100015852 Ga0070661_1000158521 383
105 3300005353 Ga0070669_100007090 Ga0070669_1000070904 383
106 3300005364 Ga0070673_100020989 Ga0070673_1000209892 383
107 3300005364 Ga0070673_100150418 Ga0070673_1001504182 383
108 3300005365 Ga0070688_100021220 Ga0070688_1000212202 383
109 3300005438 Ga0070701_10035618 Ga0070701_100356182 383
110 3300005441 Ga0070700_100009904 Ga0070700_1000099042 383
111 3300005456 Ga0070678_100009015 Ga0070678_1000090153 383
112 3300005457 Ga0070662_100008443 Ga0070662_1000084432 383
113 3300005459 Ga0068867_100033949 Ga0068867_1000339492 383
114 3300005466 Ga0070685_10005421 Ga0070685_100054212 383
115 3300005543 Ga0070672_100007420 Ga0070672_1000074202 383
116 3300005544 Ga0070686_100007108 Ga0070686_1000071083 383
117 3300005616 Ga0068852_100025186 Ga0068852_1000251862 383
118 3300005617 Ga0068859_100025844 Ga0068859_1000258442 383
119 3300005719 Ga0068861_100007392 Ga0068861_1000073922 383
120 3300005841 Ga0068863_100008405 Ga0068863_1000084054 383
121 3300005842 Ga0068858_100011837 Ga0068858_1000118374 383
122 3300005843 Ga0068860_100020974 Ga0068860_1000209742 383
123 3300005844 Ga0068862_100008998 Ga0068862_1000089983 383
124 3300006237 Ga0097621_100139602 Ga0097621_1001396022 383
125 3300006358 Ga0068871_100066255 Ga0068871_1000662552 383
126 3300006852 Ga0075433_10000700 Ga0075433_1000070013 383
127 3300006871 Ga0075434_100027634 Ga0075434_1000276343 383
128 3300006880 Ga0075429_100071497 Ga0075429_1000714972 383
129 3300006881 Ga0068865_100108109 Ga0068865_1001081092 383
130 3300006931 Ga0097620_100025845 Ga0097620_1000258452 383
131 3300007076 Ga0075435_100344884 Ga0075435_1003448841 383
132 3300009094 Ga0111539_10011876 Ga0111539_100118764 383
133 3300009094 Ga0111539_10059097 Ga0111539_100590971 383
134 3300009553 Ga0105249_10022817 Ga0105249_100228173 383
135 3300013296 Ga0157374_10118873 Ga0157374_101188731 383
136 3300013306 Ga0163162_10001897 Ga0163162_100018979 383
137 3300014968 Ga0157379_10021773 Ga0157379_100217732 383
138 3300014969 Ga0157376_10016924 Ga0157376_100169242 383
139 3300025315 Ga0207697_10005141 Ga0207697_100051412 383
140 3300025901 Ga0207688_10002488 Ga0207688_100024884 383
141 3300025907 Ga0207645_10000934 Ga0207645_1000093415 383
142 3300025920 Ga0207649_10023440 Ga0207649_100234401 383
143 3300025933 Ga0207706_10009160 Ga0207706_100091603 383
144 3300025940 Ga0207691_10003732 Ga0207691_1000373210 383
145 3300025942 Ga0207689_10004838 Ga0207689_100048382 383
146 3300025961 Ga0207712_10028010 Ga0207712_100280102 383
147 3300025972 Ga0207668_10192622 Ga0207668_101926221 383
148 3300026035 Ga0207703_10170034 Ga0207703_101700342 383
149 3300026075 Ga0207708_10025687 Ga0207708_100256872 383
150 3300026089 Ga0207648_10005542 Ga0207648_100055426 383
151 3300026118 Ga0207675_100001646 Ga0207675_1000016468 383
152 3300026121 Ga0207683_10003465 Ga0207683_100034652 383
153 3300027907 Ga0207428_10007845 Ga0207428_100078455 383
154 3300028381 Ga0268264_10022426 Ga0268264_100224262 383
155 3300035112 Ga0373932_0002676 Ga0373932_0002676_2437_3633 383
156 3300035691 Ga0373931_0078455 Ga0373931_0078455_525_1721 383
157 3300045051 Ga0451576_0068336 Ga0451576_0068336_462_1658 383
158 3300050511 nmdc:mga08y16_35153_c1 nmdc:mga08y16_35153_c1_4019_5215 383
159 3300050512 nmdc:mga0n895_4950_c1 nmdc:mga0n895_4950_c1_4120_5316 383
160 3300050515 nmdc:mga0a205_2715_c1 nmdc:mga0a205_2715_c1_9018_10214 383
161 3300006237 Ga0097621_100098773 Ga0097621_1000987732 384
162 3300014969 Ga0157376_10110602 Ga0157376_101106022 384
163 3300031548 Ga0307408_100013146 Ga0307408_1000131465 384
164 3300031731 Ga0307405_10108183 Ga0307405_101081832 384
165 3300048910 Ga0496107_0136260 Ga0496107_0136260_310_1515 385
166 3300049589 Ga0501073_0101303 Ga0501073_0101303_687_1880 385
167 3300005328 Ga0070676_10013029 Ga0070676_100130292 386
168 3300005343 Ga0070687_100000631 Ga0070687_1000006315 386
169 3300005467 Ga0070706_100173076 Ga0070706_1001730762 386
170 3300005548 Ga0070665_100060521 Ga0070665_1000605212 386
171 3300005840 Ga0068870_10000623 Ga0068870_100006235 386
172 3300009098 Ga0105245_10079029 Ga0105245_100790292 386
173 3300009177 Ga0105248_10002306 Ga0105248_100023064 386
174 3300014326 Ga0157380_10004940 Ga0157380_100049402 386
175 3300025908 Ga0207643_10000549 Ga0207643_100005492 386
176 3300025910 Ga0207684_10304688 Ga0207684_103046882 386
177 3300025918 Ga0207662_10004054 Ga0207662_100040543 386
178 3300025941 Ga0207711_10044451 Ga0207711_100444513 386
179 3300048912 Ga0496109_0048575 Ga0496109_0048575_2111_3307 386
180 3300005290 Ga0065712_10070828 Ga0065712_100708284 387
181 3300005329 Ga0070683_100000381 Ga0070683_1000003813 387
182 3300005331 Ga0070670_100012676 Ga0070670_1000126762 387
183 3300005367 Ga0070667_100047236 Ga0070667_1000472364 387
184 3300005618 Ga0068864_100076462 Ga0068864_1000764622 387
185 3300014325 Ga0163163_10008840 Ga0163163_100088405 387
186 3300025920 Ga0207649_10064228 Ga0207649_100642283 387
187 3300025944 Ga0207661_10066688 Ga0207661_100666883 387
188 3300048907 Ga0496104_0028993 Ga0496104_0028993_545_1768 387
189 3300048911 Ga0496108_0033185 Ga0496108_0033185_1549_2772 387
190 3300048913 Ga0496110_0005898 Ga0496110_0005898_7926_9149 387
191 3300048915 Ga0496112_0012410 Ga0496112_0012410_5608_6831 387
192 3300048916 Ga0496113_0276596 Ga0496113_0276596_108_1331 387
193 3300005290 Ga0065712_10074332 Ga0065712_100743322 388
194 3300005718 Ga0068866_10007118 Ga0068866_100071185 388
195 3300013297 Ga0157378_10005992 Ga0157378_100059922 388
196 3300025899 Ga0207642_10031159 Ga0207642_100311593 388
197 3300048916 Ga0496113_0065109 Ga0496113_0065109_182_1384 388
198 3300006871 Ga0075434_100177156 Ga0075434_1001771562 390
199 3300050512 nmdc:mga0n895_172816_c1 nmdc:mga0n895_172816_c1_685_1914 390
200 3300025940 Ga0207691_10142610 Ga0207691_101426102 391
201 3300005340 Ga0070689_100109698 Ga0070689_1001096983 392
202 3300013308 Ga0157375_10226532 Ga0157375_102265321 392
203 3300025936 Ga0207670_10141993 Ga0207670_101419932 392
204 3300026035 Ga0207703_10313806 Ga0207703_103138061 392
205 3300036401 Ga0373937_0041355 Ga0373937_0041355_2424_3668 392
206 3300005467 Ga0070706_100161581 Ga0070706_1001615812 393
207 3300025910 Ga0207684_10138383 Ga0207684_101383832 393
208 3300034818 Ga0373950_0000022 Ga0373950_0000022_146637_147908 394
209 3300048917 Ga0496114_0168217 Ga0496114_0168217_422_1693 394
210 3300049579 Ga0501043_0003390 Ga0501043_0003390_1224_2507 394
211 3300049580 Ga0501046_0002667 Ga0501046_0002667_1333_2616 394
212 3300049581 Ga0501047_0000027 Ga0501047_0000027_118406_119689 394
213 3300049582 Ga0501048_0002385 Ga0501048_0002385_1071_2354 394
214 3300049584 Ga0501068_0023988 Ga0501068_0023988_1776_3059 394
215 3300049588 Ga0501072_0000035 Ga0501072_0000035_107489_108772 394
216 3300049589 Ga0501073_0008088 Ga0501073_0008088_461_1744 394
217 3300049741 Ga0501079_0026651 Ga0501079_0026651_1344_2627 394
218 3300049742 Ga0501080_0004020 Ga0501080_0004020_11510_12793 394
219 3300054114 Ga0501084_0000012 Ga0501084_0000012_56163_57446 394
220 3300049744 Ga0501083_0096817 Ga0501083_0096817_675_1922 395
221 3300005290 Ga0065712_10070617 Ga0065712_100706174 396
222 3300005618 Ga0068864_100032862 Ga0068864_1000328623 396
223 3300026095 Ga0207676_10023630 Ga0207676_100236304 396
224 3300025925 Ga0207650_10104529 Ga0207650_101045294 397
225 3300013308 Ga0157375_10064292 Ga0157375_100642923 403
226 3300014326 Ga0157380_10265899 Ga0157380_102658991 405
227 3300005331 Ga0070670_100060165 Ga0070670_1000601653 406
228 3300005564 Ga0070664_100106957 Ga0070664_1001069572 406
229 3300025926 Ga0207659_10148594 Ga0207659_101485942 406
230 3300025944 Ga0207661_10268178 Ga0207661_102681781 406
231 3300005293 Ga0065715_10104871 Ga0065715_101048712 407
232 3300005354 Ga0070675_100065454 Ga0070675_1000654542 407
233 3300005356 Ga0070674_100048885 Ga0070674_1000488852 407
234 3300005365 Ga0070688_100044095 Ga0070688_1000440952 407
235 3300017792 Ga0163161_10019089 Ga0163161_100190894 407
236 3300005290 Ga0065712_10006670 Ga0065712_100066703 418
237 3300005458 Ga0070681_10171254 Ga0070681_101712542 418
238 3300005618 Ga0068864_100201021 Ga0068864_1002010212 418
239 3300005840 Ga0068870_10012886 Ga0068870_100128863 418
240 3300006931 Ga0097620_100048025 Ga0097620_1000480254 418
241 3300025908 Ga0207643_10007175 Ga0207643_100071756 418
242 3300025914 Ga0207671_10126896 Ga0207671_101268962 418
243 3300025923 Ga0207681_10005153 Ga0207681_100051535 418
244 3300026142 Ga0207698_10193563 Ga0207698_101935631 418
245 3300028380 Ga0268265_10060593 Ga0268265_100605932 418
246 3300026118 Ga0207675_100131088 Ga0207675_1001310882 422
247 3300005290 Ga0065712_10000117 Ga0065712_100001179 423
248 3300005293 Ga0065715_10001480 Ga0065715_1000148010 423
249 3300025961 Ga0207712_10000700 Ga0207712_100007006 423

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00144

Beta-lactamase

Beta-lactamase

91

452

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zyt-assembly1.cif.gz_A structure determination of esta from arthrobacter nitroguajacolicus rue61a 0.856 44 416
5gmx-assembly2.cif.gz_B crystal structure of a family viii carboxylesterase 0.8551 39 413
5gkv-assembly1.cif.gz_A crystal structure of a novel penicillin-binding protein (pbp) homolog from caulobacter crescentus 0.8493 39 413
5gmx-assembly2.cif.gz_B crystal structure of a family viii carboxylesterase 0.8484 39 413
5gkv-assembly1.cif.gz_A crystal structure of a novel penicillin-binding protein (pbp) homolog from caulobacter crescentus 0.8429 39 413
ID Description Score Start End Superfamily
af_Q21523_36_427_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8789 41 414 3.40.710.10
af_Q21569_36_429_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8687 41 418 3.40.710.10
3zytA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.856 44 416 3.40.710.10
af_Q09621_65_456_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8555 41 416 3.40.710.10
af_Q18384_35_423_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8456 41 415 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A7X7QB96-F1-model_v4 Beta-lactamase family protein 0.9776 40 253
AF-A0A100JEI2-F1-model_v4 deleted 0.9689 38 252
AF-A0A535TA19-F1-model_v4 Beta-lactamase family protein 0.9672 36 227
AF-A0A535TA19-F1-model_v4 Beta-lactamase family protein 0.9623 36 227
AF-A0A6I2VWQ9-F1-model_v4 Serine hydrolase 0.961 38 238 GO:0016787

Feature Viewer

pLDDT pTM Quality
83.2 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map