F359150

General Info

Members Datasets Scaffolds Average Seq Length
247 168 247 365

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10080714|Ga0307410_100807142
Length 400
Sequence MSRAALIVLAALAVLLPGCGLGGGDDXXXAVSGGDGRETTRVEVIHDDGGSSDGVGFNPQSIYESESPGVVTVVSVFKGADLGALGRQEGGESGVGSGFVLNGEGEIATNAHVVTTGEVPNLEQAEQVYVEFADGNQVEAEVRGYDPEADVALLKVDPKGLTLRPLPLGESGKVAVGEPVAAIGSPFNERQSLSIGVVSAVDRSIAGLTAFQISGAIQTDAAINPGNSGGPLVDADGKVIGINQQIKSASGASEGVGFAVPIDVAKRSLEQLQASGDVKYSYLGVETVEIYPQLRERFDLPVGEGAWIQGVSDDGPAATAGLRGGDGSQTVFQVRPYRDGGDVITSIDGRPVRDPDDLSLAVAQLDPGRTVTVEAWRDDSKRQFEVKLGERPLSGPAVAG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.96
Rhizosphere 87.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000757 3300003373 Bacteria 6793
2 Ga0070658_10022746 3300005327 Bacteria 5031
3 Ga0070683_100003147 3300005329 Bacteria 13297
4 Ga0070683_100007131 3300005329 Bacteria 9420
5 Ga0070670_100168386 3300005331 Bacteria 1900
6 Ga0070680_100000746 3300005336 Bacteria 22718
7 Ga0070682_100018093 3300005337 Bacteria 4114
8 Ga0070660_100008007 3300005339 Bacteria 7382
9 Ga0070691_10034890 3300005341 Bacteria 2368
10 Ga0070661_100002426 3300005344 Bacteria 12801
11 Ga0070661_100177235 3300005344 Bacteria 1621
12 Ga0070692_10057387 3300005345 Bacteria 2041
13 Ga0070659_100001090 3300005366 Bacteria 19781
14 Ga0070713_100192054 3300005436 Bacteria 1840
15 Ga0070678_100092119 3300005456 Bacteria 2328
16 Ga0070681_10006683 3300005458 Bacteria 11222
17 Ga0070681_10092740 3300005458 Bacteria 2968
18 Ga0068867_100194938 3300005459 Bacteria 1619
19 Ga0070679_100147129 3300005530 Bacteria 2333
20 Ga0070684_100074784 3300005535 Bacteria 2986
21 Ga0068853_100071535 3300005539 Bacteria 3021
22 Ga0070665_100134347 3300005548 Bacteria 2476
23 Ga0070665_100150403 3300005548 Bacteria 2331
24 Ga0070704_100143683 3300005549 Bacteria 1867
25 Ga0068855_100024017 3300005563 Bacteria 7298
26 Ga0068857_100046736 3300005577 Bacteria 3842
27 Ga0068856_100011634 3300005614 Bacteria 8534
28 Ga0068852_100007252 3300005616 Bacteria 8086
29 Ga0068852_100182236 3300005616 Bacteria 1976
30 Ga0068852_100304414 3300005616 Bacteria 1544
31 Ga0068870_10051288 3300005840 Bacteria 2184
32 Ga0068858_100032622 3300005842 Bacteria 4835
33 Ga0068860_100030763 3300005843 Bacteria 5162
34 Ga0081455_10058058 3300005937 Bacteria 3277
35 Ga0081538_10000169 3300005981 Bacteria 69684
36 Ga0081538_10001799 3300005981 Bacteria 21643
37 Ga0081538_10006821 3300005981 Bacteria 9960
38 Ga0081538_10016175 3300005981 Bacteria 5735
39 Ga0081538_10060988 3300005981 Bacteria 2163
40 Ga0081540_1051155 3300005983 Bacteria 2045
41 Ga0081539_10001233 3300005985 Bacteria 45611
42 Ga0075428_100069713 3300006844 Bacteria 3844
43 Ga0075428_100074210 3300006844 Bacteria 3716
44 Ga0075430_100008923 3300006846 Bacteria 8464
45 Ga0075434_100000197 3300006871 Bacteria 40436
46 Ga0068865_100085579 3300006881 Bacteria 2274
47 Ga0075435_100010309 3300007076 Bacteria 6828
48 Ga0105240_10007232 3300009093 Bacteria 16160
49 Ga0111539_10022248 3300009094 Bacteria 7792
50 Ga0111539_10097182 3300009094 Bacteria 3460
51 Ga0111539_10207654 3300009094 Bacteria 2282
52 Ga0111539_10488254 3300009094 Bacteria 1435
53 Ga0105245_10025296 3300009098 Bacteria 5219
54 Ga0105245_10144504 3300009098 Bacteria 2243
55 Ga0105245_10228714 3300009098 Bacteria 1798
56 Ga0105245_10423479 3300009098 Bacteria 1335
57 Ga0105247_10024752 3300009101 Bacteria 3619
58 Ga0114129_10008915 3300009147 Bacteria 14302
59 Ga0114129_10325597 3300009147 Bacteria 2042
60 Ga0105243_10054601 3300009148 Bacteria 3172
61 Ga0105237_10031494 3300009545 Bacteria 5377
62 Ga0105238_10013021 3300009551 Bacteria 8395
63 Ga0105249_10331041 3300009553 Bacteria 1537
64 Ga0105239_10137156 3300010375 Bacteria 2724
65 Ga0105239_10221843 3300010375 Bacteria 2120
66 Ga0105239_10266733 3300010375 Bacteria 1925
67 Ga0157370_10017385 3300013104 Bacteria 7258
68 Ga0157370_10021490 3300013104 Bacteria 6430
69 Ga0157369_10006254 3300013105 Bacteria 13819
70 Ga0157378_10224647 3300013297 Bacteria 1786
71 Ga0157372_10055368 3300013307 Bacteria 4429
72 Ga0157372_10545950 3300013307 Bacteria 1351
73 Ga0157375_10000076 3300013308 Bacteria 101715
74 Ga0163163_10000440 3300014325 Bacteria 37944
75 Ga0157377_10001634 3300014745 Bacteria 9770
76 Ga0157379_10086788 3300014968 Bacteria 2806
77 Ga0157376_10040476 3300014969 Bacteria 3809
78 Ga0206353_10005236 3300020082 Bacteria 4971
79 Ga0207688_10001872 3300025901 Bacteria 11268
80 Ga0207688_10027722 3300025901 Bacteria 3115
81 Ga0207647_10110943 3300025904 Bacteria 1622
82 Ga0207699_10139321 3300025906 Bacteria 1593
83 Ga0207707_10006326 3300025912 Bacteria 10343
84 Ga0207657_10007520 3300025919 Bacteria 11165
85 Ga0207652_10012718 3300025921 Bacteria 6805
86 Ga0207652_10060702 3300025921 Bacteria 3262
87 Ga0207650_10126306 3300025925 Bacteria 1997
88 Ga0207687_10000186 3300025927 Bacteria 41355
89 Ga0207700_10094565 3300025928 Bacteria 2368
90 Ga0207664_10055403 3300025929 Bacteria 3146
91 Ga0207706_10019816 3300025933 Bacteria 6047
92 Ga0207706_10082496 3300025933 Bacteria 2826
93 Ga0207665_10025269 3300025939 Bacteria 3918
94 Ga0207691_10147353 3300025940 Bacteria 2071
95 Ga0207711_10156200 3300025941 Bacteria 2062
96 Ga0207689_10007422 3300025942 Bacteria 9614
97 Ga0207661_10000599 3300025944 Bacteria 22999
98 Ga0207679_10156502 3300025945 Bacteria 1861
99 Ga0207667_10040782 3300025949 Bacteria 4941
100 Ga0207640_10012328 3300025981 Bacteria 4864
101 Ga0207703_10030288 3300026035 Bacteria 4276
102 Ga0207678_10054712 3300026067 Bacteria 3437
103 Ga0207678_10165534 3300026067 Bacteria 1888
104 Ga0207708_10001859 3300026075 Bacteria 15555
105 Ga0207702_10224334 3300026078 Bacteria 1752
106 Ga0207648_10092899 3300026089 Bacteria 2639
107 Ga0207683_10026772 3300026121 Bacteria 4981
108 Ga0207683_10058035 3300026121 Bacteria 3398
109 Ga0207428_10037179 3300027907 Bacteria 3963
110 Ga0268266_10008906 3300028379 Bacteria 8883
111 Ga0268264_10044351 3300028381 Bacteria 3689
112 Ga0265338_10006672 3300028800 Bacteria 14592
113 Ga0265327_10002055 3300031251 Bacteria 22591
114 Ga0307405_10061612 3300031731 Bacteria 2372
115 Ga0307405_10141750 3300031731 Bacteria 1677
116 Ga0307413_10112396 3300031824 Bacteria 1826
117 Ga0307410_10080714 3300031852 Bacteria 2283
118 Ga0307410_10105556 3300031852 Bacteria 2028
119 Ga0307407_10020291 3300031903 Bacteria 3402
120 Ga0307407_10100104 3300031903 Bacteria 1797
121 Ga0307409_100001709 3300031995 Bacteria 11063
122 Ga0307409_100007323 3300031995 Bacteria 6591
123 Ga0307409_100058967 3300031995 Bacteria 2984
124 Ga0307409_100233551 3300031995 Bacteria 1669
125 Ga0307416_100001189 3300032002 Bacteria 13989
126 Ga0307416_100159915 3300032002 Bacteria 2080
127 Ga0307415_100000762 3300032126 Bacteria 14540
128 Ga0307415_100011358 3300032126 Bacteria 5092
129 Ga0307415_100019540 3300032126 Bacteria 4115
130 Ga0373923_0001421 3300035111 Bacteria 6850
131 Ga0373943_0011067 3300035170 Bacteria 4052
132 Ga0373924_0012599 3300035410 Bacteria 3163
133 Ga0373927_0005736 3300035695 Bacteria 8528
134 Ga0373947_0008090 3300035725 Bacteria 6062
135 Ga0373925_0063542 3300037068 Bacteria 2777
136 Ga0373925_0480013 3300037068 Bacteria 1020
137 Ga0436362_0629257 3300039453 Bacteria 3325
138 Ga0466961_0065956 3300044693 Bacteria 2300
139 Ga0466963_0008560 3300044694 Bacteria 6140
140 Ga0466963_0024341 3300044694 Bacteria 3854
141 Ga0466963_0034128 3300044694 Bacteria 3309
142 Ga0466963_0067218 3300044694 Bacteria 2405
143 Ga0466963_0094993 3300044694 Bacteria 2034
144 Ga0466957_0073492 3300044842 Bacteria 2119
145 Ga0466960_0007715 3300044901 Bacteria 4383
146 Ga0466967_0006264 3300045976 Bacteria 8392
147 Ga0466967_0025053 3300045976 Bacteria 4913
148 Ga0466967_0049826 3300045976 Bacteria 3665
149 Ga0466967_0057777 3300045976 Bacteria 3426
150 Ga0466967_0087952 3300045976 Bacteria 2818
151 Ga0466967_0088745 3300045976 Bacteria 2806
152 Ga0466967_0123071 3300045976 Bacteria 2400
153 Ga0466967_0127529 3300045976 Bacteria 2358
154 Ga0466967_0305249 3300045976 Bacteria 1532
155 Ga0495651_0045460 3300046462 Bacteria 3401
156 Ga0495580_0086113 3300046472 Bacteria 2188
157 Ga0495582_0093522 3300046473 Bacteria 1678
158 Ga0495639_0000332 3300046475 Bacteria 22718
159 Ga0495664_0033746 3300046477 Bacteria 3009
160 Ga0495594_0005206 3300046499 Bacteria 6684
161 Ga0495608_0041417 3300046511 Bacteria 3082
162 Ga0495618_0024381 3300046514 Bacteria 3746
163 Ga0495666_0003736 3300046526 Bacteria 7694
164 Ga0495665_0012867 3300046531 Bacteria 4528
165 Ga0495640_0027624 3300046533 Bacteria 4090
166 Ga0495634_0004830 3300046642 Bacteria 10458
167 Ga0495635_0078591 3300046663 Bacteria 2258
168 Ga0495588_0007853 3300046674 Bacteria 4872
169 Ga0495657_0013328 3300046675 Bacteria 6071
170 Ga0495646_0116788 3300046680 Bacteria 1513
171 Ga0495647_0023472 3300046681 Bacteria 2236
172 Ga0495658_0017877 3300046683 Bacteria 3674
173 Ga0495658_0101840 3300046683 Bacteria 1715
174 Ga0495613_0000485 3300046689 Bacteria 33724
175 Ga0495624_0041107 3300046690 Bacteria 2959
176 Ga0495604_0094592 3300047317 Bacteria 2209
177 Ga0495674_0014106 3300047319 Bacteria 7486
178 Ga0495674_0145019 3300047319 Bacteria 1993
179 Ga0495614_0027761 3300048089 Bacteria 2440
180 Ga0496100_0001573 3300048903 Bacteria 11242
181 Ga0496100_0021792 3300048903 Bacteria 3866
182 Ga0496101_0018887 3300048904 Bacteria 4695
183 Ga0496102_0006412 3300048905 Bacteria 10029
184 Ga0496102_0077012 3300048905 Bacteria 3069
185 Ga0496104_0082879 3300048907 Bacteria 3058
186 Ga0496105_0113293 3300048908 Bacteria 2238
187 Ga0496106_0003818 3300048909 Bacteria 11233
188 Ga0496106_0012547 3300048909 Bacteria 6257
189 Ga0496106_0035277 3300048909 Bacteria 3740
190 Ga0496107_0003729 3300048910 Bacteria 10239
191 Ga0496108_0000897 3300048911 Bacteria 23179
192 Ga0496108_0002889 3300048911 Bacteria 13787
193 Ga0496108_0072432 3300048911 Bacteria 2908
194 Ga0496109_0000300 3300048912 Bacteria 46637
195 Ga0496109_0003780 3300048912 Bacteria 12638
196 Ga0496109_0007984 3300048912 Bacteria 8971
197 Ga0496109_0110783 3300048912 Bacteria 2552
198 Ga0496109_0187226 3300048912 Bacteria 1945
199 Ga0496110_0000348 3300048913 Bacteria 30872
200 Ga0496110_0017028 3300048913 Bacteria 6076
201 Ga0496111_0000902 3300048914 Bacteria 16180
202 Ga0496111_0006367 3300048914 Bacteria 7663
203 Ga0496111_0069097 3300048914 Bacteria 2568
204 Ga0496112_0010942 3300048915 Bacteria 8261
205 Ga0496112_0087440 3300048915 Bacteria 3083
206 Ga0496112_0423249 3300048915 Bacteria 1270
207 Ga0496113_0001811 3300048916 Bacteria 12137
208 Ga0496113_0010339 3300048916 Bacteria 6166
209 Ga0496114_0014633 3300048917 Bacteria 6303
210 Ga0496115_0019110 3300048918 Bacteria 5269
211 Ga0496115_0045565 3300048918 Bacteria 3501
212 Ga0501031_0015387 3300049568 Bacteria 4967
213 Ga0501036_0236927 3300049572 Bacteria 1531
214 Ga0501038_0132079 3300049574 Bacteria 2049
215 Ga0501038_0137459 3300049574 Bacteria 2001
216 Ga0501039_0030372 3300049575 Bacteria 4167
217 Ga0501040_0020840 3300049576 Bacteria 4371
218 Ga0501040_0188050 3300049576 Bacteria 1465
219 Ga0501041_0098187 3300049577 Bacteria 1811
220 Ga0501042_0022709 3300049578 Bacteria 4383
221 Ga0501068_0209477 3300049584 Bacteria 1238
222 Ga0501072_0042984 3300049588 Bacteria 3551
223 Ga0501075_0044769 3300049591 Bacteria 3320
224 Ga0501075_0096437 3300049591 Bacteria 2244
225 Ga0501076_0037292 3300049592 Bacteria 3811
226 Ga0501076_0096488 3300049592 Bacteria 2381
227 Ga0501079_0034615 3300049741 Bacteria 3887
228 Ga0501035_0258378 3300049822 Bacteria 1477
229 Ga0501045_0150398 3300049824 Bacteria 1732
230 nmdc:mga05p37_36443_c1 3300050507 Bacteria 6035
231 nmdc:mga05p37_398584_c1 3300050507 Bacteria 1607
232 nmdc:mga0qj67_6975_c1 3300050509 Bacteria 8320
233 nmdc:mga06r32_151629_c1 3300050510 Bacteria 2297
234 nmdc:mga08y16_283895_c1 3300050511 Bacteria 1707
235 nmdc:mga08y16_35990_c1 3300050511 Bacteria 5199
236 nmdc:mga08y16_78267_c1 3300050511 Bacteria 3447
237 nmdc:mga0n895_858_c1 3300050512 Bacteria 21847
238 nmdc:mga0rr50_45331_c1 3300050513 Bacteria 3231
239 Ga0495601_0014711 3300053077 Bacteria 4720
240 Ga0495612_0013107 3300053078 Bacteria 3338
241 Ga0501084_0041649 3300054114 Bacteria 3842
242 Ga0501084_0064461 3300054114 Bacteria 3066
243 Ga0501084_0189446 3300054114 Bacteria 1735
244 Ga0501082_0101098 3300060353 Bacteria 2494
245 Ga0530510_0040908 3300061734 Bacteria 3346
246 Ga0530510_0116164 3300061734 Bacteria 1962
247 Ga0530510_0187238 3300061734 Bacteria 1536

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005341 Ga0070691_10034890 Ga0070691_100348902 301
2 3300025901 Ga0207688_10027722 Ga0207688_100277222 301
3 3300025940 Ga0207691_10147353 Ga0207691_101473532 301
4 3300025945 Ga0207679_10156502 Ga0207679_101565022 301
5 3300026075 Ga0207708_10001859 Ga0207708_100018594 301
6 3300050511 nmdc:mga08y16_283895_c1 nmdc:mga08y16_283895_c1_401_1606 301
7 3300037068 Ga0373925_0480013 Ga0373925_0480013_59_1009 310
8 3300026067 Ga0207678_10165534 Ga0207678_101655341 317
9 3300031824 Ga0307413_10112396 Ga0307413_101123962 317
10 3300031852 Ga0307410_10105556 Ga0307410_101055562 317
11 3300031995 Ga0307409_100007323 Ga0307409_1000073234 317
12 3300045976 Ga0466967_0006264 Ga0466967_0006264_960_2183 317
13 3300048915 Ga0496112_0423249 Ga0496112_0423249_68_1141 318
14 3300044694 Ga0466963_0067218 Ga0466963_0067218_167_1369 319
15 3300013104 Ga0157370_10021490 Ga0157370_100214903 320
16 3300005981 Ga0081538_10001799 Ga0081538_1000179921 321
17 3300005459 Ga0068867_100194938 Ga0068867_1001949382 322
18 3300009098 Ga0105245_10423479 Ga0105245_104234792 322
19 3300026089 Ga0207648_10092899 Ga0207648_100928992 322
20 3300048911 Ga0496108_0000897 Ga0496108_0000897_3282_4433 322
21 3300048912 Ga0496109_0000300 Ga0496109_0000300_2137_3288 322
22 3300028800 Ga0265338_10006672 Ga0265338_100066723 323
23 3300031251 Ga0265327_10002055 Ga0265327_100020553 323
24 3300013307 Ga0157372_10545950 Ga0157372_105459502 326
25 3300013308 Ga0157375_10000076 Ga0157375_1000007685 326
26 3300009098 Ga0105245_10228714 Ga0105245_102287142 328
27 3300025981 Ga0207640_10012328 Ga0207640_100123282 328
28 3300026121 Ga0207683_10058035 Ga0207683_100580353 328
29 3300046511 Ga0495608_0041417 Ga0495608_0041417_1476_2648 328
30 3300048912 Ga0496109_0187226 Ga0496109_0187226_436_1647 328
31 3300031995 Ga0307409_100058967 Ga0307409_1000589672 330
32 3300005983 Ga0081540_1051155 Ga0081540_10511552 331
33 3300005329 Ga0070683_100003147 Ga0070683_1000031477 334
34 3300025921 Ga0207652_10060702 Ga0207652_100607022 334
35 3300048911 Ga0496108_0072432 Ga0496108_0072432_962_2116 337
36 3300048914 Ga0496111_0069097 Ga0496111_0069097_1083_2237 337
37 3300049574 Ga0501038_0137459 Ga0501038_0137459_715_1881 338
38 3300049576 Ga0501040_0020840 Ga0501040_0020840_2093_3253 338
39 3300049576 Ga0501040_0188050 Ga0501040_0188050_67_1233 338
40 3300049577 Ga0501041_0098187 Ga0501041_0098187_581_1744 338
41 3300049591 Ga0501075_0044769 Ga0501075_0044769_237_1397 338
42 3300049592 Ga0501076_0096488 Ga0501076_0096488_155_1321 338
43 3300049824 Ga0501045_0150398 Ga0501045_0150398_41_1207 338
44 3300054114 Ga0501084_0064461 Ga0501084_0064461_267_1427 338
45 3300054114 Ga0501084_0189446 Ga0501084_0189446_520_1686 338
46 3300061734 Ga0530510_0040908 Ga0530510_0040908_1705_2865 338
47 3300061734 Ga0530510_0187238 Ga0530510_0187238_103_1269 338
48 3300050507 nmdc:mga05p37_398584_c1 nmdc:mga05p37_398584_c1_467_1588 339
49 3300044694 Ga0466963_0024341 Ga0466963_0024341_729_1913 340
50 3300005331 Ga0070670_100168386 Ga0070670_1001683862 341
51 3300005339 Ga0070660_100008007 Ga0070660_1000080073 341
52 3300005436 Ga0070713_100192054 Ga0070713_1001920542 341
53 3300005456 Ga0070678_100092119 Ga0070678_1000921192 341
54 3300005458 Ga0070681_10092740 Ga0070681_100927402 341
55 3300005548 Ga0070665_100150403 Ga0070665_1001504032 341
56 3300005549 Ga0070704_100143683 Ga0070704_1001436832 341
57 3300005563 Ga0068855_100024017 Ga0068855_1000240178 341
58 3300005616 Ga0068852_100304414 Ga0068852_1003044142 341
59 3300005842 Ga0068858_100032622 Ga0068858_1000326223 341
60 3300005843 Ga0068860_100030763 Ga0068860_1000307634 341
61 3300006871 Ga0075434_100000197 Ga0075434_10000019742 341
62 3300006881 Ga0068865_100085579 Ga0068865_1000855792 341
63 3300007076 Ga0075435_100010309 Ga0075435_1000103096 341
64 3300009101 Ga0105247_10024752 Ga0105247_100247523 341
65 3300009148 Ga0105243_10054601 Ga0105243_100546012 341
66 3300009551 Ga0105238_10013021 Ga0105238_100130212 341
67 3300010375 Ga0105239_10221843 Ga0105239_102218432 341
68 3300013297 Ga0157378_10224647 Ga0157378_102246472 341
69 3300014325 Ga0163163_10000440 Ga0163163_1000044025 341
70 3300014745 Ga0157377_10001634 Ga0157377_100016347 341
71 3300014968 Ga0157379_10086788 Ga0157379_100867882 341
72 3300014969 Ga0157376_10040476 Ga0157376_100404763 341
73 3300025901 Ga0207688_10001872 Ga0207688_100018727 341
74 3300025904 Ga0207647_10110943 Ga0207647_101109432 341
75 3300025925 Ga0207650_10126306 Ga0207650_101263062 341
76 3300025927 Ga0207687_10000186 Ga0207687_100001864 341
77 3300025928 Ga0207700_10094565 Ga0207700_100945652 341
78 3300025933 Ga0207706_10019816 Ga0207706_100198164 341
79 3300025939 Ga0207665_10025269 Ga0207665_100252692 341
80 3300025941 Ga0207711_10156200 Ga0207711_101562002 341
81 3300025942 Ga0207689_10007422 Ga0207689_100074229 341
82 3300025949 Ga0207667_10040782 Ga0207667_100407822 341
83 3300026035 Ga0207703_10030288 Ga0207703_100302882 341
84 3300026121 Ga0207683_10026772 Ga0207683_100267723 341
85 3300028381 Ga0268264_10044351 Ga0268264_100443513 341
86 3300035111 Ga0373923_0001421 Ga0373923_0001421_3145_4308 341
87 3300035170 Ga0373943_0011067 Ga0373943_0011067_1010_2173 341
88 3300035410 Ga0373924_0012599 Ga0373924_0012599_114_1277 341
89 3300035695 Ga0373927_0005736 Ga0373927_0005736_6904_8067 341
90 3300037068 Ga0373925_0063542 Ga0373925_0063542_863_2026 341
91 3300044693 Ga0466961_0065956 Ga0466961_0065956_513_1721 341
92 3300045976 Ga0466967_0057777 Ga0466967_0057777_319_1503 341
93 3300045976 Ga0466967_0123071 Ga0466967_0123071_406_1602 341
94 3300046462 Ga0495651_0045460 Ga0495651_0045460_142_1305 341
95 3300046472 Ga0495580_0086113 Ga0495580_0086113_49_1212 341
96 3300046473 Ga0495582_0093522 Ga0495582_0093522_303_1469 341
97 3300046475 Ga0495639_0000332 Ga0495639_0000332_3632_4795 341
98 3300046499 Ga0495594_0005206 Ga0495594_0005206_5302_6465 341
99 3300046514 Ga0495618_0024381 Ga0495618_0024381_2051_3214 341
100 3300046526 Ga0495666_0003736 Ga0495666_0003736_155_1318 341
101 3300046531 Ga0495665_0012867 Ga0495665_0012867_3210_4373 341
102 3300046533 Ga0495640_0027624 Ga0495640_0027624_57_1220 341
103 3300046642 Ga0495634_0004830 Ga0495634_0004830_8644_9807 341
104 3300046663 Ga0495635_0078591 Ga0495635_0078591_121_1284 341
105 3300046674 Ga0495588_0007853 Ga0495588_0007853_2811_3974 341
106 3300046675 Ga0495657_0013328 Ga0495657_0013328_710_1873 341
107 3300046681 Ga0495647_0023472 Ga0495647_0023472_883_2046 341
108 3300046683 Ga0495658_0017877 Ga0495658_0017877_1985_3148 341
109 3300046689 Ga0495613_0000485 Ga0495613_0000485_24093_25256 341
110 3300047317 Ga0495604_0094592 Ga0495604_0094592_429_1592 341
111 3300047319 Ga0495674_0014106 Ga0495674_0014106_623_1786 341
112 3300048089 Ga0495614_0027761 Ga0495614_0027761_654_1817 341
113 3300048903 Ga0496100_0001573 Ga0496100_0001573_2461_3624 341
114 3300048903 Ga0496100_0021792 Ga0496100_0021792_715_1878 341
115 3300048904 Ga0496101_0018887 Ga0496101_0018887_2044_3207 341
116 3300048905 Ga0496102_0006412 Ga0496102_0006412_7851_9014 341
117 3300048905 Ga0496102_0077012 Ga0496102_0077012_893_2056 341
118 3300048907 Ga0496104_0082879 Ga0496104_0082879_1021_2184 341
119 3300048908 Ga0496105_0113293 Ga0496105_0113293_582_1745 341
120 3300048909 Ga0496106_0003818 Ga0496106_0003818_268_1431 341
121 3300048909 Ga0496106_0012547 Ga0496106_0012547_4380_5543 341
122 3300048909 Ga0496106_0035277 Ga0496106_0035277_477_1640 341
123 3300048910 Ga0496107_0003729 Ga0496107_0003729_8023_9186 341
124 3300048911 Ga0496108_0002889 Ga0496108_0002889_2221_3384 341
125 3300048912 Ga0496109_0003780 Ga0496109_0003780_9965_11128 341
126 3300048912 Ga0496109_0007984 Ga0496109_0007984_6992_8155 341
127 3300048912 Ga0496109_0110783 Ga0496109_0110783_748_1911 341
128 3300048913 Ga0496110_0000348 Ga0496110_0000348_27820_28983 341
129 3300048913 Ga0496110_0017028 Ga0496110_0017028_472_1635 341
130 3300048914 Ga0496111_0000902 Ga0496111_0000902_5071_6234 341
131 3300048914 Ga0496111_0006367 Ga0496111_0006367_3494_4657 341
132 3300048915 Ga0496112_0010942 Ga0496112_0010942_5620_6783 341
133 3300048915 Ga0496112_0087440 Ga0496112_0087440_410_1573 341
134 3300048916 Ga0496113_0001811 Ga0496113_0001811_348_1511 341
135 3300048916 Ga0496113_0010339 Ga0496113_0010339_4429_5592 341
136 3300048917 Ga0496114_0014633 Ga0496114_0014633_3179_4342 341
137 3300048918 Ga0496115_0019110 Ga0496115_0019110_970_2133 341
138 3300048918 Ga0496115_0045565 Ga0496115_0045565_307_1470 341
139 3300050512 nmdc:mga0n895_858_c1 nmdc:mga0n895_858_c1_2566_3729 341
140 3300050513 nmdc:mga0rr50_45331_c1 nmdc:mga0rr50_45331_c1_723_1886 341
141 3300045976 Ga0466967_0025053 Ga0466967_0025053_600_1793 342
142 3300045976 Ga0466967_0049826 Ga0466967_0049826_208_1314 342
143 3300039453 Ga0436362_0629257 Ga0436362_0629257_694_1749 343
144 3300044694 Ga0466963_0094993 Ga0466963_0094993_783_1904 343
145 3300044901 Ga0466960_0007715 Ga0466960_0007715_1804_2928 343
146 3300045976 Ga0466967_0088745 Ga0466967_0088745_1484_2662 343
147 3300035725 Ga0373947_0008090 Ga0373947_0008090_4206_5369 344
148 3300045976 Ga0466967_0087952 Ga0466967_0087952_245_1426 344
149 3300046477 Ga0495664_0033746 Ga0495664_0033746_517_1680 344
150 3300046680 Ga0495646_0116788 Ga0495646_0116788_55_1218 344
151 3300046683 Ga0495658_0101840 Ga0495658_0101840_220_1383 344
152 3300046690 Ga0495624_0041107 Ga0495624_0041107_388_1551 344
153 3300047319 Ga0495674_0145019 Ga0495674_0145019_730_1893 344
154 3300053077 Ga0495601_0014711 Ga0495601_0014711_2594_3757 344
155 3300053078 Ga0495612_0013107 Ga0495612_0013107_420_1583 344
156 3300005937 Ga0081455_10058058 Ga0081455_100580582 345
157 3300009098 Ga0105245_10025296 Ga0105245_100252963 346
158 3300010375 Ga0105239_10266733 Ga0105239_102667332 346
159 3300049584 Ga0501068_0209477 Ga0501068_0209477_40_1197 346
160 3300005616 Ga0068852_100182236 Ga0068852_1001822362 347
161 3300005840 Ga0068870_10051288 Ga0068870_100512882 347
162 3300005981 Ga0081538_10060988 Ga0081538_100609882 347
163 3300005985 Ga0081539_10001233 Ga0081539_1000123325 347
164 3300009094 Ga0111539_10097182 Ga0111539_100971823 347
165 3300031995 Ga0307409_100233551 Ga0307409_1002335512 347
166 3300050511 nmdc:mga08y16_78267_c1 nmdc:mga08y16_78267_c1_698_1870 347
167 3300005981 Ga0081538_10006821 Ga0081538_100068214 348
168 3300031731 Ga0307405_10141750 Ga0307405_101417501 348
169 3300032002 Ga0307416_100159915 Ga0307416_1001599152 348
170 3300032126 Ga0307415_100019540 Ga0307415_1000195403 348
171 3300006844 Ga0075428_100069713 Ga0075428_1000697133 349
172 3300009094 Ga0111539_10022248 Ga0111539_100222485 349
173 3300009147 Ga0114129_10008915 Ga0114129_1000891516 349
174 3300027907 Ga0207428_10037179 Ga0207428_100371793 349
175 3300044694 Ga0466963_0008560 Ga0466963_0008560_1293_2498 349
176 3300044694 Ga0466963_0034128 Ga0466963_0034128_1468_2670 349
177 3300044842 Ga0466957_0073492 Ga0466957_0073492_523_1728 349
178 3300050507 nmdc:mga05p37_36443_c1 nmdc:mga05p37_36443_c1_1948_3117 349
179 3300050511 nmdc:mga08y16_35990_c1 nmdc:mga08y16_35990_c1_2036_3205 349
180 3300009094 Ga0111539_10207654 Ga0111539_102076542 350
181 3300025906 Ga0207699_10139321 Ga0207699_101393211 350
182 3300025929 Ga0207664_10055403 Ga0207664_100554032 350
183 3300049578 Ga0501042_0022709 Ga0501042_0022709_32_1192 350
184 3300049592 Ga0501076_0037292 Ga0501076_0037292_781_1941 350
185 3300049822 Ga0501035_0258378 Ga0501035_0258378_242_1402 350
186 3300054114 Ga0501084_0041649 Ga0501084_0041649_482_1642 350
187 3300060353 Ga0501082_0101098 Ga0501082_0101098_391_1551 350
188 3300005535 Ga0070684_100074784 Ga0070684_1000747842 351
189 3300045976 Ga0466967_0305249 Ga0466967_0305249_112_1332 351
190 3300006844 Ga0075428_100074210 Ga0075428_1000742104 352
191 3300006846 Ga0075430_100008923 Ga0075430_1000089234 352
192 3300009147 Ga0114129_10325597 Ga0114129_103255972 352
193 3300031903 Ga0307407_10020291 Ga0307407_100202912 352
194 3300045976 Ga0466967_0127529 Ga0466967_0127529_849_2027 352
195 3300050509 nmdc:mga0qj67_6975_c1 nmdc:mga0qj67_6975_c1_4330_5496 352
196 3300050510 nmdc:mga06r32_151629_c1 nmdc:mga06r32_151629_c1_385_1551 352
197 3300005548 Ga0070665_100134347 Ga0070665_1001343472 353
198 3300009545 Ga0105237_10031494 Ga0105237_100314942 353
199 3300049568 Ga0501031_0015387 Ga0501031_0015387_3486_4613 354
200 3300049574 Ga0501038_0132079 Ga0501038_0132079_635_1762 354
201 3300049575 Ga0501039_0030372 Ga0501039_0030372_697_1824 354
202 3300049588 Ga0501072_0042984 Ga0501072_0042984_1771_2898 354
203 3300049591 Ga0501075_0096437 Ga0501075_0096437_1043_2170 354
204 3300049741 Ga0501079_0034615 Ga0501079_0034615_1204_2331 354
205 3300061734 Ga0530510_0116164 Ga0530510_0116164_514_1641 354
206 3300009553 Ga0105249_10331041 Ga0105249_103310412 355
207 3300020082 Ga0206353_10005236 Ga0206353_100052362 355
208 3300049572 Ga0501036_0236927 Ga0501036_0236927_16_1173 355
209 3300005344 Ga0070661_100177235 Ga0070661_1001772352 356
210 3300005981 Ga0081538_10016175 Ga0081538_100161753 356
211 3300009098 Ga0105245_10144504 Ga0105245_101445042 356
212 3300025933 Ga0207706_10082496 Ga0207706_100824962 356
213 3300026067 Ga0207678_10054712 Ga0207678_100547122 356
214 3300028379 Ga0268266_10008906 Ga0268266_100089062 356
215 3300031731 Ga0307405_10061612 Ga0307405_100616122 357
216 3300031995 Ga0307409_100001709 Ga0307409_10000170912 357
217 3300032002 Ga0307416_100001189 Ga0307416_10000118910 357
218 3300032126 Ga0307415_100000762 Ga0307415_10000076210 357
219 3300032126 Ga0307415_100011358 Ga0307415_1000113584 357
220 3300009094 Ga0111539_10488254 Ga0111539_104882542 358
221 3300031852 Ga0307410_10080714 Ga0307410_100807142 359
222 3300031903 Ga0307407_10100104 Ga0307407_101001042 359
223 3300003373 JGI25407J50210_10000757 JGI25407J50210_100007574 361
224 3300005327 Ga0070658_10022746 Ga0070658_100227464 361
225 3300005329 Ga0070683_100007131 Ga0070683_1000071319 361
226 3300005336 Ga0070680_100000746 Ga0070680_10000074618 361
227 3300005337 Ga0070682_100018093 Ga0070682_1000180932 361
228 3300005344 Ga0070661_100002426 Ga0070661_1000024269 361
229 3300005345 Ga0070692_10057387 Ga0070692_100573872 361
230 3300005366 Ga0070659_100001090 Ga0070659_10000109017 361
231 3300005458 Ga0070681_10006683 Ga0070681_100066836 361
232 3300005530 Ga0070679_100147129 Ga0070679_1001471292 361
233 3300005539 Ga0068853_100071535 Ga0068853_1000715353 361
234 3300005577 Ga0068857_100046736 Ga0068857_1000467362 361
235 3300005614 Ga0068856_100011634 Ga0068856_1000116345 361
236 3300005616 Ga0068852_100007252 Ga0068852_1000072528 361
237 3300005981 Ga0081538_10000169 Ga0081538_1000016931 361
238 3300009093 Ga0105240_10007232 Ga0105240_1000723211 361
239 3300010375 Ga0105239_10137156 Ga0105239_101371562 361
240 3300013104 Ga0157370_10017385 Ga0157370_100173852 361
241 3300013105 Ga0157369_10006254 Ga0157369_100062544 361
242 3300013307 Ga0157372_10055368 Ga0157372_100553682 361
243 3300025912 Ga0207707_10006326 Ga0207707_100063266 361
244 3300025919 Ga0207657_10007520 Ga0207657_100075206 361
245 3300025921 Ga0207652_10012718 Ga0207652_100127182 361
246 3300025944 Ga0207661_10000599 Ga0207661_1000059910 361
247 3300026078 Ga0207702_10224334 Ga0207702_102243342 361

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13365

Trypsin_2

Trypsin-like peptidase domain

96

242

0.97

PF13180

PDZ_2

PDZ domain

281

388

0.96

PF00089

Trypsin

Trypsin

84

268

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vge-assembly1.cif.gz_B structure of the pdz deleted variant of htra2 protease (s306a) 0.92 31 232
3nwu-assembly1.cif.gz_B substrate induced remodeling of the active site regulates htra1 activity 0.9132 31 233
3i1e-assembly2.cif.gz_B crystal structure of the pdz domain of the sdrc-like protein (lin2157) from listeria innocua, northeast structural genomics consortium target lkr136c 0.9071 271 352
6z0e-assembly2.cif.gz_B htra1 inactive protease domain s328a with carasil mutation r274q 0.9061 31 240
3nwu-assembly1.cif.gz_C substrate induced remodeling of the active site regulates htra1 activity 0.9042 31 233
ID Description Score Start End Superfamily
5t69A01 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9287 25 238 2.40.10.120
3gdvC03 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9249 246 357 2.30.42.10
af_P0C0V0_287_387_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.921 246 361 2.30.42.10
af_O07175_267_353_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9168 247 357 2.30.42.10
3mh4B01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9123 39 134 2.40.10.10
ID Description Score Start End GO Terms
AF-A0A7Y6CCZ3-F1-model_v4 PDZ domain-containing protein 0.9532 182 357 GO:0004252
GO:0006508
AF-A0A7W1LF20-F1-model_v4 Trypsin-like peptidase domain-containing protein 0.9506 128 359 GO:0004252
GO:0006508
AF-A0A7W0SDR3-F1-model_v4 Trypsin-like peptidase domain-containing protein 0.9316 65 357 GO:0004252
GO:0006508
AF-A0A1M3BI11-F1-model_v4 PDZ domain-containing protein 0.9163 11 361 GO:0004252
GO:0006508
AF-A0A7W1KAA3-F1-model_v4 Trypsin-like peptidase domain-containing protein 0.913 34 233 GO:0004252
GO:0006508

Feature Viewer

pLDDT pTM Quality
84.67 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map