F358071

General Info

Members Datasets Scaffolds Average Seq Length
246 142 492 122

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_102071280|Ga0068871_1020712802
Length 130
Sequence MLRRYDERMAHNPGFLNLVNDAKSRVPEIDIAAYKKLRDSGEPHILVDTREESEWAGGHVKGAVHLSKGIIERDIETKVPDKGAQLVLYCGGGFRSALVADNLQKMGYTKAISLDGGWRALKESGLEVEK

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
133 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
134 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.63
Rhizosphere 95.12
Stem 0
Stem Tuber 0
Unclassified 13.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_102071280 3300006358 Bacteria 542
2 Ga0058863_11784421 3300004799 Bacteria 1053
3 Ga0070658_10011326 3300005327 Bacteria 7151
4 Ga0070658_10714368 3300005327 Bacteria 870
5 Ga0070683_100000008 3300005329 Bacteria 329206
6 Ga0070670_100549819 3300005331 Bacteria 1030
7 Ga0070670_101861480 3300005331 Bacteria 554
8 Ga0070666_10163923 3300005335 Bacteria 1554
9 Ga0070680_100023699 3300005336 Bacteria 4898
10 Ga0070680_100278940 3300005336 Bacteria 1416
11 Ga0068868_101019246 3300005338 Bacteria 758
12 Ga0070660_100143216 3300005339 Bacteria 1919
13 Ga0070675_101275934 3300005354 Bacteria 677
14 Ga0070674_100760768 3300005356 Bacteria 833
15 Ga0070667_100529480 3300005367 Bacteria 1082
16 Ga0070667_101653915 3300005367 Bacteria 602
17 Ga0070709_10843389 3300005434 Unclassified 722
18 Ga0070714_100057104 3300005435 Bacteria 3340
19 Ga0070713_100001239 3300005436 Bacteria 16326
20 Ga0070713_100052481 3300005436 Bacteria 3376
21 Ga0070711_100327210 3300005439 Bacteria 1226
22 Ga0070711_101475793 3300005439 Archaea 593
23 Ga0070681_10022653 3300005458 Bacteria 6310
24 Ga0070681_10320340 3300005458 Bacteria 1460
25 Ga0068867_101674528 3300005459 Unclassified 596
26 Ga0070684_100000002 3300005535 Bacteria 257669
27 Ga0070684_100120201 3300005535 Bacteria 2363
28 Ga0070684_101450569 3300005535 Unclassified 646
29 Ga0070684_101776318 3300005535 Unclassified 582
30 Ga0070665_101640545 3300005548 Unclassified 651
31 Ga0068855_100001452 3300005563 Bacteria 29563
32 Ga0068855_100108168 3300005563 Bacteria 3194
33 Ga0068855_100267563 3300005563 Bacteria 1902
34 Ga0068855_100491208 3300005563 Bacteria 1335
35 Ga0068852_100031172 3300005616 Bacteria 4396
36 Ga0068852_100167201 3300005616 Bacteria 2058
37 Ga0068852_100380876 3300005616 Bacteria 1384
38 Ga0068852_102630289 3300005616 Bacteria 523
39 Ga0068859_100051466 3300005617 Bacteria 4140
40 Ga0068859_100410506 3300005617 Bacteria 1450
41 Ga0068859_100820695 3300005617 Bacteria 1017
42 Ga0068859_101768124 3300005617 Bacteria 683
43 Ga0068864_102200561 3300005618 Bacteria 558
44 Ga0068863_100034510 3300005841 Bacteria 4819
45 Ga0068863_101387728 3300005841 Unclassified 710
46 Ga0070717_10350875 3300006028 Bacteria 1319
47 Ga0070717_10755607 3300006028 Unclassified 884
48 Ga0097620_100051464 3300006931 Bacteria 4140
49 Ga0097620_100410577 3300006931 Bacteria 1450
50 Ga0097620_100820576 3300006931 Bacteria 1017
51 Ga0097620_101767881 3300006931 Bacteria 683
52 Ga0105240_10192080 3300009093 Bacteria 2400
53 Ga0105240_10434023 3300009093 Bacteria 1473
54 Ga0105245_12213347 3300009098 Bacteria 603
55 Ga0114129_11062208 3300009147 Bacteria 1016
56 Ga0105241_10361650 3300009174 Bacteria 1263
57 Ga0105242_10250216 3300009176 Bacteria 1597
58 Ga0105242_10567021 3300009176 Bacteria 1091
59 Ga0105242_11851586 3300009176 Bacteria 643
60 Ga0105242_12327881 3300009176 Bacteria 582
61 Ga0105248_10008025 3300009177 Bacteria 11592
62 Ga0105248_10031078 3300009177 Bacteria 5968
63 Ga0105248_10232519 3300009177 Bacteria 2075
64 Ga0105248_10310604 3300009177 Bacteria 1776
65 Ga0105248_10911267 3300009177 Bacteria 993
66 Ga0105248_12039325 3300009177 Unclassified 652
67 Ga0105237_10015919 3300009545 Bacteria 7819
68 Ga0105238_10433927 3300009551 Bacteria 1309
69 Ga0105238_11545252 3300009551 Bacteria 693
70 Ga0105239_11318575 3300010375 Bacteria 833
71 Ga0105239_11973276 3300010375 Bacteria 677
72 Ga0105246_10795232 3300011119 Bacteria 839
73 Ga0105246_11000792 3300011119 Bacteria 757
74 Ga0157370_10040747 3300013104 Bacteria 4484
75 Ga0157370_10051182 3300013104 Bacteria 3946
76 Ga0157370_10983264 3300013104 Bacteria 764
77 Ga0157369_10022301 3300013105 Bacteria 7069
78 Ga0157369_10026709 3300013105 Bacteria 6403
79 Ga0157369_10931281 3300013105 Bacteria 891
80 Ga0157374_10170930 3300013296 Bacteria 2120
81 Ga0157374_10757255 3300013296 Bacteria 986
82 Ga0157378_11770639 3300013297 Bacteria 665
83 Ga0163162_11731291 3300013306 Unclassified 714
84 Ga0163162_13275199 3300013306 Bacteria 519
85 Ga0157372_10055918 3300013307 Bacteria 4408
86 Ga0157372_10169688 3300013307 Bacteria 2524
87 Ga0157372_10233805 3300013307 Bacteria 2131
88 Ga0157372_11111338 3300013307 Bacteria 914
89 Ga0157372_11389756 3300013307 Bacteria 809
90 Ga0157375_10225810 3300013308 Bacteria 2032
91 Ga0157375_11807626 3300013308 Bacteria 724
92 Ga0157375_13783174 3300013308 Bacteria 502
93 Ga0163163_10042238 3300014325 Bacteria 4464
94 Ga0163163_10053197 3300014325 Bacteria 3996
95 Ga0163163_10104105 3300014325 Unclassified 2863
96 Ga0163163_10800348 3300014325 Unclassified 1006
97 Ga0157376_10451035 3300014969 Bacteria 1255
98 Ga0157376_11419556 3300014969 Bacteria 726
99 Ga0157376_11753494 3300014969 Bacteria 657
100 Ga0213875_10023621 3300021388 Bacteria 2936
101 Ga0207680_10142328 3300025903 Bacteria 1591
102 Ga0207680_11380330 3300025903 Bacteria 500
103 Ga0207699_11099106 3300025906 Unclassified 588
104 Ga0207643_10187611 3300025908 Bacteria 1254
105 Ga0207705_10026935 3300025909 Bacteria 4097
106 Ga0207705_10720386 3300025909 Bacteria 775
107 Ga0207707_10060261 3300025912 Bacteria 3302
108 Ga0207707_10836494 3300025912 Bacteria 765
109 Ga0207695_10692231 3300025913 Bacteria 900
110 Ga0207671_10460928 3300025914 Bacteria 1013
111 Ga0207663_10202733 3300025916 Unclassified 1432
112 Ga0207660_10013023 3300025917 Bacteria 5446
113 Ga0207660_10553338 3300025917 Bacteria 936
114 Ga0207657_10174113 3300025919 Bacteria 1742
115 Ga0207657_11147416 3300025919 Unclassified 592
116 Ga0207652_10541592 3300025921 Unclassified 1046
117 Ga0207650_10425869 3300025925 Bacteria 1102
118 Ga0207650_10798284 3300025925 Bacteria 800
119 Ga0207650_11379568 3300025925 Bacteria 600
120 Ga0207700_10002779 3300025928 Bacteria 10081
121 Ga0207700_10010251 3300025928 Bacteria 5899
122 Ga0207664_10052082 3300025929 Bacteria 3236
123 Ga0207664_10176742 3300025929 Bacteria 1831
124 Ga0207644_10645053 3300025931 Bacteria 881
125 Ga0207686_10174696 3300025934 Bacteria 1518
126 Ga0207670_10104189 3300025936 Bacteria 2031
127 Ga0207670_11451306 3300025936 Unclassified 583
128 Ga0207711_10025587 3300025941 Bacteria 4950
129 Ga0207711_10479718 3300025941 Bacteria 1158
130 Ga0207711_11487939 3300025941 Bacteria 620
131 Ga0207689_10082569 3300025942 Bacteria 2642
132 Ga0207661_10000008 3300025944 Bacteria 451211
133 Ga0207661_11805278 3300025944 Unclassified 557
134 Ga0207667_10040148 3300025949 Bacteria 4983
135 Ga0207667_10050547 3300025949 Bacteria 4385
136 Ga0207658_10491159 3300025986 Bacteria 1092
137 Ga0207658_11361016 3300025986 Bacteria 649
138 Ga0207677_11020437 3300026023 Bacteria 751
139 Ga0207639_10965505 3300026041 Bacteria 798
140 Ga0207702_10709408 3300026078 Unclassified 992
141 Ga0207641_10062104 3300026088 Bacteria 3187
142 Ga0207641_10324454 3300026088 Bacteria 1461
143 Ga0207674_10738354 3300026116 Bacteria 950
144 Ga0207683_10907211 3300026121 Bacteria 818
145 Ga0207683_11899527 3300026121 Bacteria 544
146 Ga0207698_10128613 3300026142 Bacteria 2160
147 Ga0207698_12109893 3300026142 Bacteria 577
148 Ga0265338_10730860 3300028800 Bacteria 682
149 Ga0265329_10345420 3300031242 Bacteria 509
150 Ga0265339_10404909 3300031249 Bacteria 637
151 Ga0265316_10006560 3300031344 Bacteria 11098
152 Ga0265316_10090119 3300031344 Bacteria 2340
153 Ga0265316_10159586 3300031344 Bacteria 1686
154 Ga0265316_11169255 3300031344 Bacteria 533
155 Ga0265314_10023613 3300031711 Bacteria 4684
156 Ga0265342_10323219 3300031712 Bacteria 808
157 Ga0265342_10423054 3300031712 Bacteria 686
158 Ga0265342_10488711 3300031712 Bacteria 629
159 Ga0307413_11477722 3300031824 Unclassified 600
160 Ga0373926_0067951 3300035083 Bacteria 1306
161 Ga0373926_0340832 3300035083 Unclassified 588
162 Ga0373954_0536274 3300035118 Archaea 580
163 Ga0373935_0336587 3300035692 Bacteria 1074
164 Ga0373927_0139561 3300035695 Bacteria 1585
165 Ga0373927_0489991 3300035695 Unclassified 812
166 Ga0373947_0100314 3300035725 Unclassified 1819
167 Ga0373947_0159749 3300035725 Bacteria 1457
168 Ga0373947_1056043 3300035725 Unclassified 554
169 Ga0373937_0423474 3300036401 Bacteria 1264
170 Ga0373937_0702442 3300036401 Unclassified 958
171 Ga0373937_1322779 3300036401 Bacteria 669
172 Ga0373925_0921763 3300037068 Bacteria 720
173 Ga0395900_0837145 3300037418 Unclassified 846
174 Ga0395905_1628070 3300037471 Unclassified 550
175 Ga0436364_0417254 3300037853 Unclassified 544
176 Ga0436364_0619516 3300037853 Bacteria 1819
177 Ga0436364_0924486 3300037853 Bacteria 1291
178 Ga0436365_1004688 3300039437 Unclassified 787
179 Ga0436363_0699038 3300039450 Bacteria 1828
180 Ga0451839_0431905 3300041496 Bacteria 573
181 Ga0451853_0027766 3300041512 Bacteria 782
182 Ga0451577_1154720 3300042876 Bacteria 692
183 Ga0451576_0686855 3300045051 Bacteria 1075
184 Ga0451576_1878889 3300045051 Bacteria 618
185 Ga0466958_0034473 3300045836 Bacteria 3020
186 Ga0466967_0086766 3300045976 Bacteria 2836
187 Ga0495592_0697577 3300046454 Bacteria 611
188 Ga0495651_0008021 3300046462 Bacteria 8096
189 Ga0495651_0985765 3300046462 Unclassified 512
190 Ga0495580_0018396 3300046472 Bacteria 5203
191 Ga0495580_0047240 3300046472 Bacteria 3052
192 Ga0495580_0110117 3300046472 Bacteria 1912
193 Ga0495664_0198130 3300046477 Bacteria 1217
194 Ga0495664_0677177 3300046477 Unclassified 610
195 Ga0495594_0559819 3300046499 Bacteria 649
196 Ga0495618_0138714 3300046514 Bacteria 1555
197 Ga0495628_0107848 3300046516 Bacteria 2144
198 Ga0495628_0147811 3300046516 Bacteria 1791
199 Ga0495628_0293097 3300046516 Bacteria 1206
200 Ga0495628_0717811 3300046516 Bacteria 705
201 Ga0495630_0232350 3300046517 Bacteria 1409
202 Ga0495652_0311757 3300046529 Bacteria 1140
203 Ga0495652_0791600 3300046529 Bacteria 632
204 Ga0495587_0053999 3300046536 Bacteria 2368
205 Ga0495587_0293324 3300046536 Bacteria 910
206 Ga0495587_0335322 3300046536 Bacteria 844
207 Ga0495645_0342486 3300046543 Bacteria 965
208 Ga0495667_0022623 3300046559 Bacteria 4235
209 Ga0495667_0482619 3300046559 Bacteria 777
210 Ga0495635_0251557 3300046663 Bacteria 1191
211 Ga0495657_0461598 3300046675 Unclassified 743
212 Ga0495599_0129311 3300046678 Unclassified 1569
213 Ga0495623_0010682 3300046679 Bacteria 5944
214 Ga0495613_0492293 3300046689 Bacteria 826
215 Ga0495624_0654421 3300046690 Bacteria 625
216 Ga0495604_0079095 3300047317 Bacteria 2466
217 Ga0495604_0124712 3300047317 Bacteria 1859
218 Ga0495674_0013350 3300047319 Bacteria 7725
219 Ga0495674_0771587 3300047319 Bacteria 750
220 Ga0495680_0163462 3300047322 Bacteria 1615
221 Ga0495675_0047198 3300047444 Bacteria 2741
222 Ga0495675_0063718 3300047444 Bacteria 2332
223 Ga0495684_0004626 3300047471 Bacteria 10739
224 Ga0495684_0020265 3300047471 Bacteria 5123
225 Ga0495684_0026217 3300047471 Bacteria 4478
226 Ga0495684_0922562 3300047471 Bacteria 561
227 Ga0495602_0005932 3300048088 Bacteria 12818
228 Ga0495602_0349238 3300048088 Unclassified 1068
229 Ga0496104_0810576 3300048907 Bacteria 842
230 Ga0496112_0651738 3300048915 Bacteria 983
231 Ga0496112_1099751 3300048915 Bacteria 713
232 Ga0496115_0158422 3300048918 Bacteria 1870
233 Ga0501032_0656279 3300049569 Bacteria 666
234 Ga0501047_0213729 3300049581 Bacteria 1786
235 Ga0501048_0143625 3300049582 Bacteria 1688
236 Ga0501239_012707 3300049672 Bacteria 956
237 Ga0501249_045726 3300049679 Bacteria 999
238 Ga0501251_076317 3300049681 Unclassified 580
239 Ga0501045_0097934 3300049824 Bacteria 2170
240 nmdc:mga05p37_818964_c1 3300050507 Bacteria 1016
241 nmdc:mga0n895_709634_c1 3300050512 Bacteria 1001
242 Ga0495595_0138691 3300053084 Bacteria 1192
243 Ga0587073_0127892 3300059492 Bacteria 694
244 Ga0587086_104455 3300059507 Bacteria 526
245 Ga0501082_0000147 3300060353 Bacteria 58883
246 Ga0530510_1262778 3300061734 Bacteria 566
247 Ga0068871_102071280
248 Ga0058863_11784421
249 Ga0070658_10011326
250 Ga0070658_10714368
251 Ga0070683_100000008
252 Ga0070670_100549819
253 Ga0070670_101861480
254 Ga0070666_10163923
255 Ga0070680_100023699
256 Ga0070680_100278940
257 Ga0068868_101019246
258 Ga0070660_100143216
259 Ga0070675_101275934
260 Ga0070674_100760768
261 Ga0070667_100529480
262 Ga0070667_101653915
263 Ga0070709_10843389
264 Ga0070714_100057104
265 Ga0070713_100001239
266 Ga0070713_100052481
267 Ga0070711_100327210
268 Ga0070711_101475793
269 Ga0070681_10022653
270 Ga0070681_10320340
271 Ga0068867_101674528
272 Ga0070684_100000002
273 Ga0070684_100120201
274 Ga0070684_101450569
275 Ga0070684_101776318
276 Ga0070665_101640545
277 Ga0068855_100001452
278 Ga0068855_100108168
279 Ga0068855_100267563
280 Ga0068855_100491208
281 Ga0068852_100031172
282 Ga0068852_100167201
283 Ga0068852_100380876
284 Ga0068852_102630289
285 Ga0068859_100051466
286 Ga0068859_100410506
287 Ga0068859_100820695
288 Ga0068859_101768124
289 Ga0068864_102200561
290 Ga0068863_100034510
291 Ga0068863_101387728
292 Ga0070717_10350875
293 Ga0070717_10755607
294 Ga0097620_100051464
295 Ga0097620_100410577
296 Ga0097620_100820576
297 Ga0097620_101767881
298 Ga0105240_10192080
299 Ga0105240_10434023
300 Ga0105245_12213347
301 Ga0114129_11062208
302 Ga0105241_10361650
303 Ga0105242_10250216
304 Ga0105242_10567021
305 Ga0105242_11851586
306 Ga0105242_12327881
307 Ga0105248_10008025
308 Ga0105248_10031078
309 Ga0105248_10232519
310 Ga0105248_10310604
311 Ga0105248_10911267
312 Ga0105248_12039325
313 Ga0105237_10015919
314 Ga0105238_10433927
315 Ga0105238_11545252
316 Ga0105239_11318575
317 Ga0105239_11973276
318 Ga0105246_10795232
319 Ga0105246_11000792
320 Ga0157370_10040747
321 Ga0157370_10051182
322 Ga0157370_10983264
323 Ga0157369_10022301
324 Ga0157369_10026709
325 Ga0157369_10931281
326 Ga0157374_10170930
327 Ga0157374_10757255
328 Ga0157378_11770639
329 Ga0163162_11731291
330 Ga0163162_13275199
331 Ga0157372_10055918
332 Ga0157372_10169688
333 Ga0157372_10233805
334 Ga0157372_11111338
335 Ga0157372_11389756
336 Ga0157375_10225810
337 Ga0157375_11807626
338 Ga0157375_13783174
339 Ga0163163_10042238
340 Ga0163163_10053197
341 Ga0163163_10104105
342 Ga0163163_10800348
343 Ga0157376_10451035
344 Ga0157376_11419556
345 Ga0157376_11753494
346 Ga0213875_10023621
347 Ga0207680_10142328
348 Ga0207680_11380330
349 Ga0207699_11099106
350 Ga0207643_10187611
351 Ga0207705_10026935
352 Ga0207705_10720386
353 Ga0207707_10060261
354 Ga0207707_10836494
355 Ga0207695_10692231
356 Ga0207671_10460928
357 Ga0207663_10202733
358 Ga0207660_10013023
359 Ga0207660_10553338
360 Ga0207657_10174113
361 Ga0207657_11147416
362 Ga0207652_10541592
363 Ga0207650_10425869
364 Ga0207650_10798284
365 Ga0207650_11379568
366 Ga0207700_10002779
367 Ga0207700_10010251
368 Ga0207664_10052082
369 Ga0207664_10176742
370 Ga0207644_10645053
371 Ga0207686_10174696
372 Ga0207670_10104189
373 Ga0207670_11451306
374 Ga0207711_10025587
375 Ga0207711_10479718
376 Ga0207711_11487939
377 Ga0207689_10082569
378 Ga0207661_10000008
379 Ga0207661_11805278
380 Ga0207667_10040148
381 Ga0207667_10050547
382 Ga0207658_10491159
383 Ga0207658_11361016
384 Ga0207677_11020437
385 Ga0207639_10965505
386 Ga0207702_10709408
387 Ga0207641_10062104
388 Ga0207641_10324454
389 Ga0207674_10738354
390 Ga0207683_10907211
391 Ga0207683_11899527
392 Ga0207698_10128613
393 Ga0207698_12109893
394 Ga0265338_10730860
395 Ga0265329_10345420
396 Ga0265339_10404909
397 Ga0265316_10006560
398 Ga0265316_10090119
399 Ga0265316_10159586
400 Ga0265316_11169255
401 Ga0265314_10023613
402 Ga0265342_10323219
403 Ga0265342_10423054
404 Ga0265342_10488711
405 Ga0307413_11477722
406 Ga0373926_0067951
407 Ga0373926_0340832
408 Ga0373954_0536274
409 Ga0373935_0336587
410 Ga0373927_0139561
411 Ga0373927_0489991
412 Ga0373947_0100314
413 Ga0373947_0159749
414 Ga0373947_1056043
415 Ga0373937_0423474
416 Ga0373937_0702442
417 Ga0373937_1322779
418 Ga0373925_0921763
419 Ga0395900_0837145
420 Ga0395905_1628070
421 Ga0436364_0417254
422 Ga0436364_0619516
423 Ga0436364_0924486
424 Ga0436365_1004688
425 Ga0436363_0699038
426 Ga0451839_0431905
427 Ga0451853_0027766
428 Ga0451577_1154720
429 Ga0451576_0686855
430 Ga0451576_1878889
431 Ga0466958_0034473
432 Ga0466967_0086766
433 Ga0495592_0697577
434 Ga0495651_0008021
435 Ga0495651_0985765
436 Ga0495580_0018396
437 Ga0495580_0047240
438 Ga0495580_0110117
439 Ga0495664_0198130
440 Ga0495664_0677177
441 Ga0495594_0559819
442 Ga0495618_0138714
443 Ga0495628_0107848
444 Ga0495628_0147811
445 Ga0495628_0293097
446 Ga0495628_0717811
447 Ga0495630_0232350
448 Ga0495652_0311757
449 Ga0495652_0791600
450 Ga0495587_0053999
451 Ga0495587_0293324
452 Ga0495587_0335322
453 Ga0495645_0342486
454 Ga0495667_0022623
455 Ga0495667_0482619
456 Ga0495635_0251557
457 Ga0495657_0461598
458 Ga0495599_0129311
459 Ga0495623_0010682
460 Ga0495613_0492293
461 Ga0495624_0654421
462 Ga0495604_0079095
463 Ga0495604_0124712
464 Ga0495674_0013350
465 Ga0495674_0771587
466 Ga0495680_0163462
467 Ga0495675_0047198
468 Ga0495675_0063718
469 Ga0495684_0004626
470 Ga0495684_0020265
471 Ga0495684_0026217
472 Ga0495684_0922562
473 Ga0495602_0005932
474 Ga0495602_0349238
475 Ga0496104_0810576
476 Ga0496112_0651738
477 Ga0496112_1099751
478 Ga0496115_0158422
479 Ga0501032_0656279
480 Ga0501047_0213729
481 Ga0501048_0143625
482 Ga0501239_012707
483 Ga0501249_045726
484 Ga0501251_076317
485 Ga0501045_0097934
486 nmdc:mga05p37_818964_c1
487 nmdc:mga0n895_709634_c1
488 Ga0495595_0138691
489 Ga0587073_0127892
490 Ga0587086_104455
491 Ga0501082_0000147
492 Ga0530510_1262778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

30

124

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gn0-assembly1.cif.gz_A escherichia coli glpe sulfurtransferase soaked with kcn 0.879 19 118
6mxv-assembly1.cif.gz_A the crystal structure of a rhodanese-like family protein from francisella tularensis subsp. tularensis schu s4 0.8763 1 122
1gmx-assembly1.cif.gz_A escherichia coli glpe sulfurtransferase 0.8762 19 115
3tp9-assembly1.cif.gz_B crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains 0.875 19 122
6mxv-assembly1.cif.gz_A the crystal structure of a rhodanese-like family protein from francisella tularensis subsp. tularensis schu s4 0.8697 1 122
ID Description Score Start End Superfamily
1gmxA00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8765 19 115 3.40.250.10
3tp9B03 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8693 20 122 3.40.250.10
3hixC00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8672 36 122 3.40.250.10
af_Q59WH7_327_438_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8575 21 116 3.40.250.10
3tp9B03 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8536 20 122 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A257VKD6-F1-model_v4 Sulfurtransferase 0.9644 3 116 GO:0016740
AF-A0A2V8U390-F1-model_v4 Sulfurtransferase 0.9557 2 122 GO:0004792
AF-A0A522KZT8-F1-model_v4 deleted 0.9496 1 122
AF-A0A5C8M0K4-F1-model_v4 Rhodanese domain-containing protein 0.9473 2 122
AF-A0A832I3C5-F1-model_v4 Sulfurtransferase 0.9433 1 122 GO:0016740

Map