F357195

General Info

Members Datasets Scaffolds Average Seq Length
245 152 490 328

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100341519|Ga0068855_1003415192
Length 386
Sequence LAFWLGERAEWKPQWASPAEWSASPDCFYDRKMAVRDLLIVGAGPSGLAAAIAAKEHNLDYQVLEQGILVNSIFRFPPHMVFFTTPELLEIGGLPLVSPFEKPTRLEALRYYRRVVDKYELKIAYHEAVVSVSREDEDGGGNVIFAHGYYDHAVMLGIPGEDLPHVSHYYTEAHPFYQRRVVIVGAGNSAAEAALELYRAGAHVTLVHRGAALKSTVKYWVRPDIENRIKEGSVAARFNTCIKEIRPTSVVVNSSGGAAAPLVGSGPNDEAPTALARSPGSAQTPVEACAGGESGRDEEIAADAVFLLTGYRADTGLMQRAGIELTDREGPRYDPETFETNVRGLFVAGGAVAGVDTGTIFIENGRFHGKTIIDVIVGRGQGATSA

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
113 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.67
Rhizosphere 95.92
Stem 0
Stem Tuber 0
Unclassified 12.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100341519 3300005563 Unclassified 1651
2 rootH2_10079437 3300003320 Bacteria 4225
3 Ga0065712_10005191 3300005290 Bacteria 3537
4 Ga0065715_10090052 3300005293 Bacteria 7749
5 Ga0065715_10147895 3300005293 Bacteria 1765
6 Ga0070670_100115645 3300005331 Bacteria 2313
7 Ga0070666_10123393 3300005335 Bacteria 1797
8 Ga0070680_100021009 3300005336 Bacteria 5183
9 Ga0070680_100125458 3300005336 Bacteria 2145
10 Ga0070660_100043392 3300005339 Bacteria 3437
11 Ga0070660_100136681 3300005339 Bacteria 1964
12 Ga0070692_10071162 3300005345 Bacteria 1853
13 Ga0070674_100026607 3300005356 Bacteria 3782
14 Ga0070674_100280755 3300005356 Bacteria 1320
15 Ga0070688_100185303 3300005365 Unclassified 1446
16 Ga0070659_100202049 3300005366 Bacteria 1636
17 Ga0070705_100003142 3300005440 Bacteria 8117
18 Ga0070705_100024287 3300005440 Bacteria 3269
19 Ga0070694_100001141 3300005444 Bacteria 15231
20 Ga0070694_100052469 3300005444 Unclassified 2756
21 Ga0070708_100117336 3300005445 Bacteria 2451
22 Ga0070678_100002433 3300005456 Bacteria 10199
23 Ga0070678_100165056 3300005456 Bacteria 1798
24 Ga0070681_10013555 3300005458 Bacteria 8107
25 Ga0070681_10015002 3300005458 Bacteria 7705
26 Ga0070681_10087353 3300005458 Bacteria 3071
27 Ga0070681_10091170 3300005458 Bacteria 2998
28 Ga0070681_10126086 3300005458 Bacteria 2493
29 Ga0070681_10134960 3300005458 Bacteria 2399
30 Ga0070707_100009015 3300005468 Bacteria 9253
31 Ga0070707_100065001 3300005468 Bacteria 3504
32 Ga0070707_100320708 3300005468 Unclassified 1506
33 Ga0070698_100085528 3300005471 Unclassified 3140
34 Ga0070699_100052516 3300005518 Bacteria 3527
35 Ga0070699_100343760 3300005518 Bacteria 1343
36 Ga0070679_100026650 3300005530 Bacteria 5683
37 Ga0070679_100076680 3300005530 Unclassified 3331
38 Ga0070679_100095246 3300005530 Bacteria 2965
39 Ga0070697_100026070 3300005536 Bacteria 4664
40 Ga0070686_100179436 3300005544 Bacteria 1503
41 Ga0070695_100000442 3300005545 Bacteria 21598
42 Ga0070695_100018877 3300005545 Bacteria 4192
43 Ga0070695_100055253 3300005545 Bacteria 2558
44 Ga0070696_100005003 3300005546 Bacteria 8856
45 Ga0070696_100100693 3300005546 Bacteria 2070
46 Ga0070665_100157906 3300005548 Unclassified 2270
47 Ga0070704_100035422 3300005549 Bacteria 3393
48 Ga0070704_100061631 3300005549 Bacteria 2685
49 Ga0070704_100178192 3300005549 Bacteria 1698
50 Ga0068855_100099089 3300005563 Unclassified 3357
51 Ga0070664_100021668 3300005564 Bacteria 5299
52 Ga0068857_100067287 3300005577 Bacteria 3189
53 Ga0068857_100139106 3300005577 Unclassified 2194
54 Ga0068854_100095221 3300005578 Bacteria 2222
55 Ga0068856_100008361 3300005614 Bacteria 10083
56 Ga0068856_100030729 3300005614 Bacteria 5251
57 Ga0070702_100113426 3300005615 Unclassified 1685
58 Ga0068852_100346615 3300005616 Bacteria 1449
59 Ga0068859_100006558 3300005617 Bacteria 11814
60 Ga0068859_100022606 3300005617 Bacteria 6305
61 Ga0068864_100101307 3300005618 Bacteria 2554
62 Ga0068864_100406951 3300005618 Unclassified 1294
63 Ga0068861_100047357 3300005719 Bacteria 3245
64 Ga0068863_100504289 3300005841 Bacteria 1192
65 Ga0068858_100017719 3300005842 Bacteria 6672
66 Ga0068862_100279791 3300005844 Bacteria 1529
67 Ga0081539_10000084 3300005985 Bacteria 218801
68 Ga0081539_10007920 3300005985 Bacteria 9464
69 Ga0070717_10277142 3300006028 Bacteria 1486
70 Ga0070712_100084409 3300006175 Bacteria 2309
71 Ga0070712_100181054 3300006175 Bacteria 1642
72 Ga0097621_100007533 3300006237 Bacteria 7794
73 Ga0097621_100041507 3300006237 Bacteria 3704
74 Ga0097621_100305353 3300006237 Bacteria 1406
75 Ga0068871_100002292 3300006358 Bacteria 13029
76 Ga0068871_100014081 3300006358 Bacteria 5948
77 Ga0068871_100046315 3300006358 Unclassified 3503
78 Ga0075428_100000004 3300006844 Bacteria 326694
79 Ga0075431_100054966 3300006847 Bacteria 4106
80 Ga0075433_10009911 3300006852 Bacteria 7638
81 Ga0075433_10039735 3300006852 Bacteria 4070
82 Ga0075433_10218746 3300006852 Unclassified 1692
83 Ga0075434_100007226 3300006871 Bacteria 10276
84 Ga0075434_100239526 3300006871 Bacteria 1834
85 Ga0075434_100543354 3300006871 Unclassified 1182
86 Ga0097620_100006558 3300006931 Bacteria 11814
87 Ga0097620_100022605 3300006931 Bacteria 6305
88 Ga0075435_100053500 3300007076 Bacteria 3256
89 Ga0105240_10234608 3300009093 Bacteria 2130
90 Ga0111539_10000005 3300009094 Bacteria 467342
91 Ga0111539_10000892 3300009094 Bacteria 38949
92 Ga0105245_10037614 3300009098 Bacteria 4303
93 Ga0114129_10012734 3300009147 Bacteria 11973
94 Ga0114129_10072001 3300009147 Bacteria 4819
95 Ga0114129_10642516 3300009147 Unclassified 1370
96 Ga0105241_10149470 3300009174 Bacteria 1909
97 Ga0105242_10198758 3300009176 Bacteria 1779
98 Ga0105248_10029917 3300009177 Bacteria 6077
99 Ga0105248_10115099 3300009177 Bacteria 3033
100 Ga0105248_10142889 3300009177 Bacteria 2700
101 Ga0105246_10149641 3300011119 Bacteria 1765
102 Ga0157373_10038588 3300013100 Bacteria 3423
103 Ga0157373_10134111 3300013100 Bacteria 1741
104 Ga0157371_10068509 3300013102 Bacteria 2512
105 Ga0157369_10003607 3300013105 Bacteria 18397
106 Ga0157374_10001670 3300013296 Bacteria 18591
107 Ga0157374_10019709 3300013296 Bacteria 5974
108 Ga0157374_10116845 3300013296 Unclassified 2571
109 Ga0157372_10061590 3300013307 Bacteria 4202
110 Ga0163163_10017156 3300014325 Bacteria 6746
111 Ga0163163_10028984 3300014325 Bacteria 5322
112 Ga0163163_10139319 3300014325 Bacteria 2468
113 Ga0157380_10415632 3300014326 Bacteria 1281
114 Ga0157376_10027987 3300014969 Bacteria 4475
115 Ga0157376_10080901 3300014969 Bacteria 2788
116 Ga0157376_10156328 3300014969 Bacteria 2062
117 Ga0157376_10395075 3300014969 Unclassified 1335
118 Ga0213872_10029649 3300021361 Bacteria 2509
119 Ga0228598_1000417 3300024227 Bacteria 8629
120 Ga0207705_10064807 3300025909 Bacteria 2640
121 Ga0207707_10038641 3300025912 Bacteria 4170
122 Ga0207707_10089566 3300025912 Bacteria 2689
123 Ga0207695_10173780 3300025913 Bacteria 2078
124 Ga0207693_10115184 3300025915 Bacteria 2110
125 Ga0207663_10054949 3300025916 Unclassified 2496
126 Ga0207660_10057589 3300025917 Bacteria 2784
127 Ga0207660_10058175 3300025917 Unclassified 2771
128 Ga0207660_10155511 3300025917 Bacteria 1760
129 Ga0207657_10010358 3300025919 Bacteria 9305
130 Ga0207657_10058196 3300025919 Bacteria 3327
131 Ga0207657_10135813 3300025919 Bacteria 2012
132 Ga0207652_10093770 3300025921 Bacteria 2642
133 Ga0207652_10103384 3300025921 Bacteria 2519
134 Ga0207652_10466213 3300025921 Bacteria 1138
135 Ga0207646_10028641 3300025922 Bacteria 5068
136 Ga0207646_10155740 3300025922 Unclassified 2061
137 Ga0207694_10099547 3300025924 Bacteria 2302
138 Ga0207687_10022199 3300025927 Bacteria 4221
139 Ga0207644_10351509 3300025931 Bacteria 1197
140 Ga0207709_10138601 3300025935 Bacteria 1669
141 Ga0207691_10122999 3300025940 Bacteria 2297
142 Ga0207711_10345541 3300025941 Bacteria 1377
143 Ga0207711_10429112 3300025941 Bacteria 1230
144 Ga0207667_10042040 3300025949 Bacteria 4861
145 Ga0207667_10284226 3300025949 Bacteria 1690
146 Ga0207703_10004775 3300026035 Bacteria 11049
147 Ga0207708_10132951 3300026075 Bacteria 1946
148 Ga0207702_10006066 3300026078 Bacteria 10482
149 Ga0207702_10059652 3300026078 Bacteria 3250
150 Ga0207648_10185062 3300026089 Bacteria 1845
151 Ga0207676_10085577 3300026095 Bacteria 2573
152 Ga0207676_10272819 3300026095 Unclassified 1532
153 Ga0207675_100009916 3300026118 Bacteria 8915
154 Ga0207683_10004055 3300026121 Bacteria 12658
155 Ga0207683_10196648 3300026121 Bacteria 1832
156 Ga0207683_10210529 3300026121 Bacteria 1769
157 Ga0210002_1013899 3300027617 Bacteria 1260
158 Ga0207428_10000024 3300027907 Bacteria 265587
159 Ga0207428_10003437 3300027907 Bacteria 15383
160 Ga0207428_10035896 3300027907 Bacteria 4048
161 Ga0207428_10038089 3300027907 Bacteria 3911
162 Ga0268266_10024356 3300028379 Bacteria 5148
163 Ga0265338_10004307 3300028800 Bacteria 19310
164 Ga0265338_10019776 3300028800 Bacteria 7119
165 Ga0265338_10053892 3300028800 Plasmid 3593
166 Ga0265760_10020495 3300031090 Unclassified 1909
167 Ga0265330_10000598 3300031235 Bacteria 23460
168 Ga0265330_10056289 3300031235 Bacteria 1716
169 Ga0265332_10002387 3300031238 Bacteria 9572
170 Ga0265328_10001766 3300031239 Bacteria 9883
171 Ga0265325_10000076 3300031241 Bacteria 69316
172 Ga0265339_10000028 3300031249 Bacteria 152096
173 Ga0265339_10000834 3300031249 Bacteria 23772
174 Ga0265339_10029588 3300031249 Bacteria 3107
175 Ga0265316_10004000 3300031344 Bacteria 14759
176 Ga0265316_10023851 3300031344 Bacteria 5138
177 Ga0265316_10024600 3300031344 Bacteria 5040
178 Ga0307408_100167473 3300031548 Bacteria 1752
179 Ga0265313_10000889 3300031595 Bacteria 30069
180 Ga0265314_10000047 3300031711 Bacteria 194061
181 Ga0265342_10000574 3300031712 Bacteria 38843
182 Ga0265342_10016007 3300031712 Unclassified 4913
183 Ga0307405_10252015 3300031731 Bacteria 1314
184 Ga0307413_10041504 3300031824 Bacteria 2695
185 Ga0307413_10171614 3300031824 Bacteria 1536
186 Ga0307412_10162101 3300031911 Bacteria 1663
187 Ga0373948_0019516 3300034817 Bacteria 1283
188 Ga0373937_0018142 3300036401 Bacteria 6277
189 Ga0439460_0041093 3300042461 Bacteria 1358
190 Ga0450916_010515 3300042530 Unclassified 1158
191 Ga0451577_0033288 3300042876 Bacteria 4645
192 Ga0495629_0132045 3300046459 Bacteria 1739
193 Ga0495580_0108795 3300046472 Bacteria 1924
194 Ga0495643_0001948 3300046522 Bacteria 17369
195 Ga0495642_0003239 3300046528 Bacteria 6449
196 Ga0495609_0028906 3300046538 Bacteria 2527
197 Ga0495621_0027183 3300046539 Bacteria 1935
198 Ga0495645_0045370 3300046543 Bacteria 3206
199 Ga0495645_0129395 3300046543 Bacteria 1771
200 Ga0495656_0085293 3300046615 Bacteria 1434
201 Ga0495659_0019153 3300046664 Bacteria 2288
202 Ga0495658_0067470 3300046683 Bacteria 2069
203 Ga0495658_0124793 3300046683 Bacteria 1561
204 Ga0495600_0026443 3300046809 Bacteria 3745
205 Ga0495636_0103057 3300047318 Bacteria 1249
206 Ga0495674_0172146 3300047319 Bacteria 1806
207 Ga0496101_0587704 3300048904 Bacteria 880
208 Ga0496104_0176796 3300048907 Bacteria 2045
209 Ga0496104_0231026 3300048907 Bacteria 1762
210 Ga0496104_0412233 3300048907 Unclassified 1263
211 Ga0496109_0319444 3300048912 Bacteria 1465
212 Ga0496111_0344339 3300048914 Bacteria 1103
213 Ga0496112_0156082 3300048915 Bacteria 2249
214 Ga0496112_0191209 3300048915 Unclassified 2009
215 Ga0496115_0035031 3300048918 Unclassified 3970
216 Ga0501031_0018487 3300049568 Bacteria 4536
217 Ga0501034_0267377 3300049571 Bacteria 1652
218 Ga0501039_0061866 3300049575 Bacteria 2900
219 Ga0501042_0108612 3300049578 Bacteria 1997
220 Ga0501047_0008652 3300049581 Bacteria 9615
221 Ga0501048_0049917 3300049582 Bacteria 2981
222 Ga0501076_0042145 3300049592 Bacteria 3594
223 Ga0501076_0183687 3300049592 Archaea 1705
224 Ga0501076_0183840 3300049592 Bacteria 1705
225 Ga0501044_0001549 3300049823 Bacteria 26965
226 Ga0501045_0009364 3300049824 Bacteria 6849
227 Ga0501045_0083553 3300049824 Bacteria 2356
228 nmdc:mga05p37_150962_c1 3300050507 Bacteria 2842
229 nmdc:mga05p37_70176_c1 3300050507 Bacteria 4310
230 nmdc:mga06r32_49438_c1 3300050510 Bacteria 4020
231 nmdc:mga08y16_16619_c1 3300050511 Bacteria 7739
232 nmdc:mga08y16_24574_c1 3300050511 Bacteria 6358
233 nmdc:mga08y16_6_c1 3300050511 Bacteria 622294
234 nmdc:mga0n895_297384_c1 3300050512 Bacteria 1637
235 nmdc:mga0rr50_14890_c1 3300050513 Bacteria 5118
236 nmdc:mga0rr50_158332_c1 3300050513 Unclassified 1836
237 nmdc:mga0a205_170539_c1 3300050515 Unclassified 2072
238 nmdc:mga0a205_4843_c1 3300050515 Bacteria 12103
239 Ga0495619_0092045 3300053085 Bacteria 2054
240 Ga0501084_0102072 3300054114 Archaea 2409
241 Ga0501084_0237005 3300054114 Bacteria 1540
242 Ga0501084_0351310 3300054114 Bacteria 1246
243 Ga0501082_0193951 3300060353 Bacteria 1767
244 Ga0501082_0257169 3300060353 Archaea 1519
245 Ga0530510_0247850 3300061734 Unclassified 1327
246 Ga0068855_100341519
247 rootH2_10079437
248 Ga0065712_10005191
249 Ga0065715_10090052
250 Ga0065715_10147895
251 Ga0070670_100115645
252 Ga0070666_10123393
253 Ga0070680_100021009
254 Ga0070680_100125458
255 Ga0070660_100043392
256 Ga0070660_100136681
257 Ga0070692_10071162
258 Ga0070674_100026607
259 Ga0070674_100280755
260 Ga0070688_100185303
261 Ga0070659_100202049
262 Ga0070705_100003142
263 Ga0070705_100024287
264 Ga0070694_100001141
265 Ga0070694_100052469
266 Ga0070708_100117336
267 Ga0070678_100002433
268 Ga0070678_100165056
269 Ga0070681_10013555
270 Ga0070681_10015002
271 Ga0070681_10087353
272 Ga0070681_10091170
273 Ga0070681_10126086
274 Ga0070681_10134960
275 Ga0070707_100009015
276 Ga0070707_100065001
277 Ga0070707_100320708
278 Ga0070698_100085528
279 Ga0070699_100052516
280 Ga0070699_100343760
281 Ga0070679_100026650
282 Ga0070679_100076680
283 Ga0070679_100095246
284 Ga0070697_100026070
285 Ga0070686_100179436
286 Ga0070695_100000442
287 Ga0070695_100018877
288 Ga0070695_100055253
289 Ga0070696_100005003
290 Ga0070696_100100693
291 Ga0070665_100157906
292 Ga0070704_100035422
293 Ga0070704_100061631
294 Ga0070704_100178192
295 Ga0068855_100099089
296 Ga0070664_100021668
297 Ga0068857_100067287
298 Ga0068857_100139106
299 Ga0068854_100095221
300 Ga0068856_100008361
301 Ga0068856_100030729
302 Ga0070702_100113426
303 Ga0068852_100346615
304 Ga0068859_100006558
305 Ga0068859_100022606
306 Ga0068864_100101307
307 Ga0068864_100406951
308 Ga0068861_100047357
309 Ga0068863_100504289
310 Ga0068858_100017719
311 Ga0068862_100279791
312 Ga0081539_10000084
313 Ga0081539_10007920
314 Ga0070717_10277142
315 Ga0070712_100084409
316 Ga0070712_100181054
317 Ga0097621_100007533
318 Ga0097621_100041507
319 Ga0097621_100305353
320 Ga0068871_100002292
321 Ga0068871_100014081
322 Ga0068871_100046315
323 Ga0075428_100000004
324 Ga0075431_100054966
325 Ga0075433_10009911
326 Ga0075433_10039735
327 Ga0075433_10218746
328 Ga0075434_100007226
329 Ga0075434_100239526
330 Ga0075434_100543354
331 Ga0097620_100006558
332 Ga0097620_100022605
333 Ga0075435_100053500
334 Ga0105240_10234608
335 Ga0111539_10000005
336 Ga0111539_10000892
337 Ga0105245_10037614
338 Ga0114129_10012734
339 Ga0114129_10072001
340 Ga0114129_10642516
341 Ga0105241_10149470
342 Ga0105242_10198758
343 Ga0105248_10029917
344 Ga0105248_10115099
345 Ga0105248_10142889
346 Ga0105246_10149641
347 Ga0157373_10038588
348 Ga0157373_10134111
349 Ga0157371_10068509
350 Ga0157369_10003607
351 Ga0157374_10001670
352 Ga0157374_10019709
353 Ga0157374_10116845
354 Ga0157372_10061590
355 Ga0163163_10017156
356 Ga0163163_10028984
357 Ga0163163_10139319
358 Ga0157380_10415632
359 Ga0157376_10027987
360 Ga0157376_10080901
361 Ga0157376_10156328
362 Ga0157376_10395075
363 Ga0213872_10029649
364 Ga0228598_1000417
365 Ga0207705_10064807
366 Ga0207707_10038641
367 Ga0207707_10089566
368 Ga0207695_10173780
369 Ga0207693_10115184
370 Ga0207663_10054949
371 Ga0207660_10057589
372 Ga0207660_10058175
373 Ga0207660_10155511
374 Ga0207657_10010358
375 Ga0207657_10058196
376 Ga0207657_10135813
377 Ga0207652_10093770
378 Ga0207652_10103384
379 Ga0207652_10466213
380 Ga0207646_10028641
381 Ga0207646_10155740
382 Ga0207694_10099547
383 Ga0207687_10022199
384 Ga0207644_10351509
385 Ga0207709_10138601
386 Ga0207691_10122999
387 Ga0207711_10345541
388 Ga0207711_10429112
389 Ga0207667_10042040
390 Ga0207667_10284226
391 Ga0207703_10004775
392 Ga0207708_10132951
393 Ga0207702_10006066
394 Ga0207702_10059652
395 Ga0207648_10185062
396 Ga0207676_10085577
397 Ga0207676_10272819
398 Ga0207675_100009916
399 Ga0207683_10004055
400 Ga0207683_10196648
401 Ga0207683_10210529
402 Ga0210002_1013899
403 Ga0207428_10000024
404 Ga0207428_10003437
405 Ga0207428_10035896
406 Ga0207428_10038089
407 Ga0268266_10024356
408 Ga0265338_10004307
409 Ga0265338_10019776
410 Ga0265338_10053892
411 Ga0265760_10020495
412 Ga0265330_10000598
413 Ga0265330_10056289
414 Ga0265332_10002387
415 Ga0265328_10001766
416 Ga0265325_10000076
417 Ga0265339_10000028
418 Ga0265339_10000834
419 Ga0265339_10029588
420 Ga0265316_10004000
421 Ga0265316_10023851
422 Ga0265316_10024600
423 Ga0307408_100167473
424 Ga0265313_10000889
425 Ga0265314_10000047
426 Ga0265342_10000574
427 Ga0265342_10016007
428 Ga0307405_10252015
429 Ga0307413_10041504
430 Ga0307413_10171614
431 Ga0307412_10162101
432 Ga0373948_0019516
433 Ga0373937_0018142
434 Ga0439460_0041093
435 Ga0450916_010515
436 Ga0451577_0033288
437 Ga0495629_0132045
438 Ga0495580_0108795
439 Ga0495643_0001948
440 Ga0495642_0003239
441 Ga0495609_0028906
442 Ga0495621_0027183
443 Ga0495645_0045370
444 Ga0495645_0129395
445 Ga0495656_0085293
446 Ga0495659_0019153
447 Ga0495658_0067470
448 Ga0495658_0124793
449 Ga0495600_0026443
450 Ga0495636_0103057
451 Ga0495674_0172146
452 Ga0496101_0587704
453 Ga0496104_0176796
454 Ga0496104_0231026
455 Ga0496104_0412233
456 Ga0496109_0319444
457 Ga0496111_0344339
458 Ga0496112_0156082
459 Ga0496112_0191209
460 Ga0496115_0035031
461 Ga0501031_0018487
462 Ga0501034_0267377
463 Ga0501039_0061866
464 Ga0501042_0108612
465 Ga0501047_0008652
466 Ga0501048_0049917
467 Ga0501076_0042145
468 Ga0501076_0183687
469 Ga0501076_0183840
470 Ga0501044_0001549
471 Ga0501045_0009364
472 Ga0501045_0083553
473 nmdc:mga05p37_150962_c1
474 nmdc:mga05p37_70176_c1
475 nmdc:mga06r32_49438_c1
476 nmdc:mga08y16_16619_c1
477 nmdc:mga08y16_24574_c1
478 nmdc:mga08y16_6_c1
479 nmdc:mga0n895_297384_c1
480 nmdc:mga0rr50_14890_c1
481 nmdc:mga0rr50_158332_c1
482 nmdc:mga0a205_170539_c1
483 nmdc:mga0a205_4843_c1
484 Ga0495619_0092045
485 Ga0501084_0102072
486 Ga0501084_0237005
487 Ga0501084_0351310
488 Ga0501082_0193951
489 Ga0501082_0257169
490 Ga0530510_0247850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

37

74

0.93

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

39

262

0.93

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

180

255

0.89

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

36

369

0.85

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

283

349

0.85

PF13241

NAD_binding_7

Putative NAD(P)-binding

173

252

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9595 22 53
7a76-assembly1.cif.gz_C bacillithiol disulfide reductase bdr (ypda) from bacillus cereus 0.9522 20 336
4mo2-assembly1.cif.gz_B-2 crystal structure of udp-n-acetylgalactopyranose mutase from campylobacter jejuni 0.9427 22 53
1wam-assembly1.cif.gz_A structure of udp-galactopyranose mutase from klebsiella pneumoniae with fadh- 0.9426 22 53
7a7b-assembly1.cif.gz_D bacillithiol disulfide reductase bdr (ypda) from staphylococcus aureus 0.9358 20 337
ID Description Score Start End Superfamily
af_Q2FYF3_1_146_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9608 20 169 3.50.50.60
af_Q2FYF3_1_146_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9481 20 169 3.50.50.60
af_Q2FYF3_156_325_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9443 180 338 3.50.50.60
af_Q2FZ31_2_179_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9415 180 212 3.50.50.60
af_O60112_6_422_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9311 22 53 3.30.300.30
ID Description Score Start End GO Terms
AF-A0A0X8X2W0-F1-model_v4 Uncharacterized protein 0.9784 22 121
AF-A0A524LT09-F1-model_v4 FAD-binding protein 0.9766 22 121
AF-A0A3D4V8S1-F1-model_v4 YpdA family putative bacillithiol disulfide reductase 0.9727 22 334 GO:0016491
AF-T0BCU1-F1-model_v4 YpdA family putative bacillithiol disulfide reductase 0.9721 22 337 GO:0004497
GO:0050660
AF-A0A428MH54-F1-model_v4 Thioredoxin reductase (NADPH) 0.9697 15 339 GO:0016491

Map