F355816

General Info

Members Datasets Scaffolds Average Seq Length
243 164 486 306

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_0077431|Ga0451853_0077431_107_1078
Length 323
Sequence MTSIDVHELTKEHGTVRAVDRLTFSVGPGRVTGFLGPNGAGKSTTMRLVLGLDRPTHGTATVGGRAYATLREPLRTVGALLDAQAAHGSRTARDHLRALAVGNRIPDRRVDEVLAETGLASVARRRVKAYSLGMRQRLGIAAALLGDPEVVMLDEPSNGLDPEGIVWIRELLRRLAQEGRTVLVSSHLMNETASFADHLVVLGRGRLLADTPMREFIDARVRPRVRVRTPDGAALHRLLTEHGYEATAHGDSHDGHEDHWTVEHARVDDIGRLTSAAGLTVLELAADEGTLEQAYLDLTASATEFTTTSSPAPVPQTPQSQEA

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
9 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
10 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
11 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
12 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
13 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
14 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
18 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
19 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
20 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
21 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
22 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
23 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
24 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
25 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
26 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
27 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
28 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
29 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
30 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
31 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
32 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
33 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
34 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
35 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
36 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
37 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
38 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
39 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
40 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
41 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
42 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
43 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
44 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
45 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
46 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
47 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
48 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
49 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
50 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
51 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
52 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
53 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
54 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
55 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
56 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
57 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
58 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
59 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
60 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
61 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
62 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
63 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
64 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
65 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
66 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
67 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
68 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
69 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
70 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
71 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
72 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
73 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
74 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
77 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
78 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
82 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
83 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
84 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
85 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
86 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
89 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
94 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
95 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
102 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
104 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
107 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
112 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
117 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
118 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
119 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
120 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
121 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
122 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
123 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
124 2643221578 Streptomyces sp. Root63 Isolate Unclassified
125 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
126 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
127 2643221647 Streptomyces sp. Root369 Isolate Unclassified
128 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
129 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
130 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
131 2808606448 Streptomyces sp. 193411 Isolate Unclassified
132 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
133 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
134 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
135 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
136 2862574272 Streptomyces sp. AcE210 Isolate Nodule
137 2867428634 Streptomyces sp. RP5T Isolate Unclassified
138 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
139 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
140 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
141 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
142 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
143 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
144 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
145 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
146 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
147 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
148 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
149 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
150 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
151 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
152 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
153 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
154 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
155 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
156 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
157 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
158 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
159 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
160 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
161 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
162 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
163 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
164 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.66
Metatranscriptomes 0.41
Isolates 18.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.47
Nodule 0.41
Rhizoplane 1.23
Rhizosphere 76.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_0077431 3300041512 Bacteria 1401
2 Ga0006562J51391_1047095 3300003578 Bacteria 2180
3 Ga0070668_100003435 3300005347 Bacteria 11697
4 Ga0070667_100698874 3300005367 Bacteria 938
5 Ga0070714_100210432 3300005435 Bacteria 1782
6 Ga0070663_100001205 3300005455 Bacteria 14217
7 Ga0081538_10000388 3300005981 Bacteria 49943
8 Ga0075370_10052113 3300006353 Bacteria 2321
9 Ga0105251_10048168 3300009011 Bacteria 2044
10 Ga0183367_1003 3300015688 Bacteria 814276
11 Ga0213873_10000108 3300021358 Bacteria 16096
12 Ga0213875_10003699 3300021388 Bacteria 8625
13 Ga0207426_1021817 3300025302 Bacteria 2208
14 Ga0207664_10333930 3300025929 Bacteria 1339
15 Ga0207658_10214333 3300025986 Bacteria 1616
16 Ga0207678_10000045 3300026067 Bacteria 91982
17 Ga0307517_10016151 3300028786 Bacteria 9836
18 Ga0307515_10006537 3300028794 Bacteria 23308
19 Ga0307515_10022762 3300028794 Bacteria 11026
20 Ga0307511_10000093 3300030521 Bacteria 76097
21 Ga0307511_10082558 3300030521 Bacteria 2246
22 Ga0307512_10071704 3300030522 Bacteria 2569
23 Ga0307509_10001655 3300031507 Bacteria 37324
24 Ga0307509_10021961 3300031507 Bacteria 7205
25 Ga0307509_10233008 3300031507 Bacteria 1642
26 Ga0307508_10012797 3300031616 Bacteria 7671
27 Ga0307508_10030089 3300031616 Bacteria 4906
28 Ga0307508_10214506 3300031616 Bacteria 1525
29 Ga0307514_10000838 3300031649 Bacteria 49655
30 Ga0307514_10228320 3300031649 Bacteria 1132
31 Ga0307516_10007169 3300031730 Bacteria 12870
32 Ga0307516_10082235 3300031730 Bacteria 3062
33 Ga0307518_10000658 3300031838 Bacteria 25952
34 Ga0307507_10013288 3300033179 Bacteria 10017
35 Ga0307507_10017761 3300033179 Bacteria 8145
36 Ga0307510_10052137 3300033180 Bacteria 4318
37 Ga0307510_10304631 3300033180 Bacteria 1054
38 Ga0395900_0606263 3300037418 Bacteria 1035
39 Ga0436364_0367657 3300037853 Bacteria 32383
40 Ga0436362_0388883 3300039453 Bacteria 29572
41 Ga0451797_0550485 3300041453 Bacteria 2513
42 Ga0451837_0647781 3300041494 Bacteria 4762
43 Ga0451853_0301526 3300041512 Bacteria 3742
44 Ga0451853_2387336 3300041512 Bacteria 3454
45 Ga0439449_0010497 3300042007 Bacteria 3499
46 Ga0450903_000071 3300042138 Bacteria 20404
47 Ga0439458_0000246 3300042157 Bacteria 13118
48 Ga0466969_0048559 3300044656 Bacteria 2098
49 Ga0466972_0010312 3300044658 Bacteria 4691
50 Ga0466972_0028446 3300044658 Bacteria 2757
51 Ga0466972_0146392 3300044658 Bacteria 1111
52 Ga0466966_0221319 3300044684 Bacteria 1143
53 Ga0466961_0118868 3300044693 Bacteria 1660
54 Ga0466971_0027839 3300044719 Bacteria 2531
55 Ga0466970_0018634 3300044765 Bacteria 3597
56 Ga0466957_0027486 3300044842 Bacteria 3382
57 Ga0466957_0309522 3300044842 Bacteria 1063
58 Ga0466958_0074304 3300045836 Bacteria 2083
59 Ga0495617_026048 3300046452 Bacteria 1969
60 Ga0495592_0027911 3300046454 Bacteria 4276
61 Ga0495592_0028287 3300046454 Bacteria 4246
62 Ga0495603_0001004 3300046455 Bacteria 16298
63 Ga0495603_0006047 3300046455 Bacteria 7237
64 Ga0495603_0014229 3300046455 Bacteria 4813
65 Ga0495603_0016208 3300046455 Bacteria 4508
66 Ga0495603_0080050 3300046455 Bacteria 1914
67 Ga0495590_0041451 3300046457 Bacteria 1605
68 Ga0495629_0003811 3300046459 Bacteria 11364
69 Ga0495629_0004889 3300046459 Bacteria 10060
70 Ga0495629_0014517 3300046459 Bacteria 5667
71 Ga0495629_0031425 3300046459 Bacteria 3760
72 Ga0495629_0035181 3300046459 Bacteria 3540
73 Ga0495638_0015684 3300046460 Bacteria 5082
74 Ga0495638_0092950 3300046460 Bacteria 1815
75 Ga0495651_0002110 3300046462 Bacteria 15346
76 Ga0495651_0036444 3300046462 Bacteria 3830
77 Ga0495582_0198588 3300046473 Bacteria 1145
78 Ga0495605_0003408 3300046474 Bacteria 9470
79 Ga0495605_0010702 3300046474 Bacteria 5127
80 Ga0495639_0097417 3300046475 Bacteria 1386
81 Ga0495662_0001847 3300046476 Bacteria 10614
82 Ga0495662_0018957 3300046476 Bacteria 3330
83 Ga0495662_0024738 3300046476 Bacteria 2897
84 Ga0495662_0233344 3300046476 Bacteria 907
85 Ga0495664_0011086 3300046477 Bacteria 5071
86 Ga0495664_0069306 3300046477 Bacteria 2105
87 Ga0495585_0062747 3300046492 Bacteria 2041
88 Ga0495594_0001800 3300046499 Bacteria 11135
89 Ga0495594_0012764 3300046499 Bacteria 4383
90 Ga0495594_0016901 3300046499 Bacteria 3849
91 Ga0495594_0019010 3300046499 Bacteria 3647
92 Ga0495594_0035086 3300046499 Bacteria 2731
93 Ga0495596_0014501 3300046500 Bacteria 3322
94 Ga0495583_0011849 3300046506 Bacteria 4981
95 Ga0495606_0002917 3300046507 Bacteria 18880
96 Ga0495606_0093832 3300046507 Bacteria 1840
97 Ga0495616_0087749 3300046513 Bacteria 1477
98 Ga0495618_0017803 3300046514 Bacteria 4360
99 Ga0495620_0018089 3300046515 Bacteria 3495
100 Ga0495630_0052431 3300046517 Bacteria 3054
101 Ga0495631_0002488 3300046518 Bacteria 10371
102 Ga0495632_0066718 3300046519 Bacteria 1736
103 Ga0495637_0138884 3300046520 Bacteria 923
104 Ga0495643_0058751 3300046522 Bacteria 2045
105 Ga0495666_0070755 3300046526 Bacteria 1658
106 Ga0495654_0093777 3300046530 Bacteria 1390
107 Ga0495640_0028782 3300046533 Bacteria 3996
108 Ga0495587_0020220 3300046536 Bacteria 4111
109 Ga0495609_0020026 3300046538 Bacteria 3092
110 Ga0495597_0010182 3300046542 Bacteria 4607
111 Ga0495645_0052895 3300046543 Bacteria 2953
112 Ga0495622_0003389 3300046557 Bacteria 7518
113 Ga0495633_0062345 3300046558 Bacteria 1745
114 Ga0495633_0129054 3300046558 Bacteria 1170
115 Ga0495668_0005469 3300046616 Bacteria 8594
116 Ga0495668_0023323 3300046616 Bacteria 3531
117 Ga0495634_0002406 3300046642 Bacteria 15591
118 Ga0495634_0076590 3300046642 Bacteria 2195
119 Ga0495625_0002211 3300046660 Bacteria 21506
120 Ga0495625_0022355 3300046660 Bacteria 4850
121 Ga0495625_0059191 3300046660 Bacteria 2719
122 Ga0495635_0004858 3300046663 Bacteria 9354
123 Ga0495635_0034329 3300046663 Bacteria 3518
124 Ga0495661_0020227 3300046665 Bacteria 4350
125 Ga0495588_0032471 3300046674 Bacteria 2631
126 Ga0495588_0110552 3300046674 Bacteria 1447
127 Ga0495657_0007908 3300046675 Bacteria 8158
128 Ga0495657_0009276 3300046675 Bacteria 7468
129 Ga0495657_0017775 3300046675 Bacteria 5159
130 Ga0495646_0031719 3300046680 Bacteria 3291
131 Ga0495658_0094984 3300046683 Bacteria 1771
132 Ga0495613_0001293 3300046689 Bacteria 19115
133 Ga0495613_0010634 3300046689 Bacteria 6825
134 Ga0495613_0020693 3300046689 Bacteria 4905
135 Ga0495613_0043278 3300046689 Bacteria 3331
136 Ga0495613_0090938 3300046689 Bacteria 2210
137 Ga0495613_0272286 3300046689 Bacteria 1177
138 Ga0495624_0017546 3300046690 Bacteria 4804
139 Ga0495624_0027857 3300046690 Bacteria 3695
140 Ga0495670_0051933 3300046691 Bacteria 2052
141 Ga0495649_0018309 3300046694 Bacteria 3942
142 Ga0495649_0021065 3300046694 Bacteria 3655
143 Ga0495589_0007465 3300046794 Bacteria 5730
144 Ga0495589_0008993 3300046794 Bacteria 5196
145 Ga0495589_0010233 3300046794 Bacteria 4874
146 Ga0495600_0085299 3300046809 Bacteria 2061
147 Ga0495600_0094751 3300046809 Bacteria 1946
148 Ga0495581_0008616 3300047315 Bacteria 5909
149 Ga0495581_0255638 3300047315 Bacteria 1024
150 Ga0495604_0007291 3300047317 Bacteria 8755
151 Ga0495604_0032604 3300047317 Bacteria 4128
152 Ga0495604_0089029 3300047317 Bacteria 2295
153 Ga0495636_0000562 3300047318 Bacteria 13627
154 Ga0495636_0005154 3300047318 Bacteria 5126
155 Ga0495636_0015601 3300047318 Bacteria 3028
156 Ga0495636_0018284 3300047318 Bacteria 2811
157 Ga0495636_0045477 3300047318 Bacteria 1830
158 Ga0495674_0173647 3300047319 Bacteria 1797
159 Ga0495676_0002098 3300047321 Bacteria 17582
160 Ga0495676_0011686 3300047321 Bacteria 7916
161 Ga0495676_0013786 3300047321 Bacteria 7247
162 Ga0495676_0015935 3300047321 Bacteria 6680
163 Ga0495676_0021817 3300047321 Bacteria 5584
164 Ga0495680_0025272 3300047322 Bacteria 4918
165 Ga0495687_000668 3300047443 Bacteria 39207
166 Ga0495687_004096 3300047443 Bacteria 10087
167 Ga0495687_017972 3300047443 Bacteria 3509
168 Ga0495687_063755 3300047443 Bacteria 1507
169 Ga0495675_0011373 3300047444 Bacteria 5586
170 Ga0495685_001044 3300047447 Bacteria 8447
171 Ga0495685_004062 3300047447 Bacteria 4706
172 Ga0495685_010001 3300047447 Bacteria 3176
173 Ga0495685_023248 3300047447 Bacteria 2133
174 Ga0495681_0002694 3300047470 Bacteria 12584
175 Ga0495681_0043477 3300047470 Bacteria 2166
176 Ga0495686_0062793 3300047472 Bacteria 2303
177 Ga0495593_0009826 3300047673 Bacteria 5552
178 Ga0495593_0017282 3300047673 Bacteria 4059
179 Ga0495593_0060471 3300047673 Bacteria 1984
180 Ga0495602_0139568 3300048088 Bacteria 1920
181 Ga0495614_0001317 3300048089 Bacteria 10704
182 Ga0495614_0010004 3300048089 Bacteria 4186
183 Ga0495614_0011665 3300048089 Bacteria 3865
184 Ga0495614_0022007 3300048089 Bacteria 2752
185 Ga0495614_0174936 3300048089 Bacteria 964
186 Ga0495626_0007305 3300048091 Bacteria 6162
187 Ga0496109_0170517 3300048912 Bacteria 2041
188 Ga0496114_0325895 3300048917 Bacteria 1358
189 Ga0496121_0129762 3300048924 Bacteria 1889
190 Ga0495678_006518 3300049459 Bacteria 6199
191 Ga0495682_0024814 3300049460 Bacteria 2234
192 Ga0501033_0010302 3300049570 Bacteria 7174
193 Ga0501035_0037655 3300049822 Bacteria 4379
194 nmdc:mga07m45_70204_c1 3300050496 Bacteria 1992
195 Ga0500640_001480 3300053095 Bacteria 7168
196 Ga0500560_001520 3300053107 Bacteria 4068
197 Ga0500600_0093370 3300053149 Bacteria 1602
198 2585297760 2582581312 Bacteria 7308206
199 2585309720 2582581313 Bacteria 10042643
200 2586065621 2585427649 Bacteria 9053857
201 2616692986 2616644814 Bacteria 11555299
202 2616905870 2616644941 Bacteria 8510691
203 2643905122 2643221578 Bacteria 9213798
204 2644019713 2643221601 Bacteria 7493239
205 2644180398 2643221631 Bacteria 8168043
206 2644264247 2643221647 Bacteria 10741251
207 2644403180 2643221673 Bacteria 9196637
208 2784586518 2784132148 Bacteria 8627943
209 2786667959 2786546132 Bacteria 10419719
210 2809230030 2808606448 Bacteria 8656184
211 2809594035 2808606522 Bacteria 9488490
212 2812360543 2811994879 Bacteria 9313447
213 2819699337 2818991463 Bacteria 7948711
214 2862296555 2862290372 Bacteria 7471434
215 2862580224 2862574272 Bacteria 10567477
216 2867435982 2867428634 Bacteria 9590268
217 2873158178 2873151551 Bacteria 8625867
218 2877683619 2877676314 Bacteria 9512378
219 2915772097 2915768154 Bacteria 8424322
220 2919475605 2919468124 Bacteria 9133025
221 2946052246 2946045630 Bacteria 8527308
222 2946065343 2946064051 Bacteria 8957905
223 2946080289 2946072368 Bacteria 8999607
224 2947232102 2947224130 Bacteria 9938529
225 2954008866 2954002825 Bacteria 9173742
226 2954388879 2954380949 Bacteria 10050426
227 2954674245 2954673503 Bacteria 9685905
228 2954689887 2954682443 Bacteria 9862841
229 2954699668 2954691527 Bacteria 10720516
230 2954702550 2954701450 Bacteria 10834262
231 2954718609 2954711539 Bacteria 10867210
232 2954728580 2954721474 Bacteria 10456478
233 2954733232 2954731030 Bacteria 10243860
234 2954747476 2954740390 Bacteria 10229294
235 2954752113 2954749733 Bacteria 10366972
236 2954766592 2954759201 Bacteria 9358192
237 2966604628 2966598605 Bacteria 7676064
238 2990063602 2990059506 Bacteria 9321252
239 2997607170 2997600082 Bacteria 9896405
240 3006394097 3006393351 Bacteria 6615579
241 3006486821 3006486233 Bacteria 8157040
242 3006497151 3006493962 Bacteria 8825450
243 8003314843 8003314358 Bacteria 10575343
244 Ga0451853_0077431
245 Ga0006562J51391_1047095
246 Ga0070668_100003435
247 Ga0070667_100698874
248 Ga0070714_100210432
249 Ga0070663_100001205
250 Ga0081538_10000388
251 Ga0075370_10052113
252 Ga0105251_10048168
253 Ga0183367_1003
254 Ga0213873_10000108
255 Ga0213875_10003699
256 Ga0207426_1021817
257 Ga0207664_10333930
258 Ga0207658_10214333
259 Ga0207678_10000045
260 Ga0307517_10016151
261 Ga0307515_10006537
262 Ga0307515_10022762
263 Ga0307511_10000093
264 Ga0307511_10082558
265 Ga0307512_10071704
266 Ga0307509_10001655
267 Ga0307509_10021961
268 Ga0307509_10233008
269 Ga0307508_10012797
270 Ga0307508_10030089
271 Ga0307508_10214506
272 Ga0307514_10000838
273 Ga0307514_10228320
274 Ga0307516_10007169
275 Ga0307516_10082235
276 Ga0307518_10000658
277 Ga0307507_10013288
278 Ga0307507_10017761
279 Ga0307510_10052137
280 Ga0307510_10304631
281 Ga0395900_0606263
282 Ga0436364_0367657
283 Ga0436362_0388883
284 Ga0451797_0550485
285 Ga0451837_0647781
286 Ga0451853_0301526
287 Ga0451853_2387336
288 Ga0439449_0010497
289 Ga0450903_000071
290 Ga0439458_0000246
291 Ga0466969_0048559
292 Ga0466972_0010312
293 Ga0466972_0028446
294 Ga0466972_0146392
295 Ga0466966_0221319
296 Ga0466961_0118868
297 Ga0466971_0027839
298 Ga0466970_0018634
299 Ga0466957_0027486
300 Ga0466957_0309522
301 Ga0466958_0074304
302 Ga0495617_026048
303 Ga0495592_0027911
304 Ga0495592_0028287
305 Ga0495603_0001004
306 Ga0495603_0006047
307 Ga0495603_0014229
308 Ga0495603_0016208
309 Ga0495603_0080050
310 Ga0495590_0041451
311 Ga0495629_0003811
312 Ga0495629_0004889
313 Ga0495629_0014517
314 Ga0495629_0031425
315 Ga0495629_0035181
316 Ga0495638_0015684
317 Ga0495638_0092950
318 Ga0495651_0002110
319 Ga0495651_0036444
320 Ga0495582_0198588
321 Ga0495605_0003408
322 Ga0495605_0010702
323 Ga0495639_0097417
324 Ga0495662_0001847
325 Ga0495662_0018957
326 Ga0495662_0024738
327 Ga0495662_0233344
328 Ga0495664_0011086
329 Ga0495664_0069306
330 Ga0495585_0062747
331 Ga0495594_0001800
332 Ga0495594_0012764
333 Ga0495594_0016901
334 Ga0495594_0019010
335 Ga0495594_0035086
336 Ga0495596_0014501
337 Ga0495583_0011849
338 Ga0495606_0002917
339 Ga0495606_0093832
340 Ga0495616_0087749
341 Ga0495618_0017803
342 Ga0495620_0018089
343 Ga0495630_0052431
344 Ga0495631_0002488
345 Ga0495632_0066718
346 Ga0495637_0138884
347 Ga0495643_0058751
348 Ga0495666_0070755
349 Ga0495654_0093777
350 Ga0495640_0028782
351 Ga0495587_0020220
352 Ga0495609_0020026
353 Ga0495597_0010182
354 Ga0495645_0052895
355 Ga0495622_0003389
356 Ga0495633_0062345
357 Ga0495633_0129054
358 Ga0495668_0005469
359 Ga0495668_0023323
360 Ga0495634_0002406
361 Ga0495634_0076590
362 Ga0495625_0002211
363 Ga0495625_0022355
364 Ga0495625_0059191
365 Ga0495635_0004858
366 Ga0495635_0034329
367 Ga0495661_0020227
368 Ga0495588_0032471
369 Ga0495588_0110552
370 Ga0495657_0007908
371 Ga0495657_0009276
372 Ga0495657_0017775
373 Ga0495646_0031719
374 Ga0495658_0094984
375 Ga0495613_0001293
376 Ga0495613_0010634
377 Ga0495613_0020693
378 Ga0495613_0043278
379 Ga0495613_0090938
380 Ga0495613_0272286
381 Ga0495624_0017546
382 Ga0495624_0027857
383 Ga0495670_0051933
384 Ga0495649_0018309
385 Ga0495649_0021065
386 Ga0495589_0007465
387 Ga0495589_0008993
388 Ga0495589_0010233
389 Ga0495600_0085299
390 Ga0495600_0094751
391 Ga0495581_0008616
392 Ga0495581_0255638
393 Ga0495604_0007291
394 Ga0495604_0032604
395 Ga0495604_0089029
396 Ga0495636_0000562
397 Ga0495636_0005154
398 Ga0495636_0015601
399 Ga0495636_0018284
400 Ga0495636_0045477
401 Ga0495674_0173647
402 Ga0495676_0002098
403 Ga0495676_0011686
404 Ga0495676_0013786
405 Ga0495676_0015935
406 Ga0495676_0021817
407 Ga0495680_0025272
408 Ga0495687_000668
409 Ga0495687_004096
410 Ga0495687_017972
411 Ga0495687_063755
412 Ga0495675_0011373
413 Ga0495685_001044
414 Ga0495685_004062
415 Ga0495685_010001
416 Ga0495685_023248
417 Ga0495681_0002694
418 Ga0495681_0043477
419 Ga0495686_0062793
420 Ga0495593_0009826
421 Ga0495593_0017282
422 Ga0495593_0060471
423 Ga0495602_0139568
424 Ga0495614_0001317
425 Ga0495614_0010004
426 Ga0495614_0011665
427 Ga0495614_0022007
428 Ga0495614_0174936
429 Ga0495626_0007305
430 Ga0496109_0170517
431 Ga0496114_0325895
432 Ga0496121_0129762
433 Ga0495678_006518
434 Ga0495682_0024814
435 Ga0501033_0010302
436 Ga0501035_0037655
437 nmdc:mga07m45_70204_c1
438 Ga0500640_001480
439 Ga0500560_001520
440 Ga0500600_0093370
441 2585297760
442 2585309720
443 2586065621
444 2616692986
445 2616905870
446 2643905122
447 2644019713
448 2644180398
449 2644264247
450 2644403180
451 2784586518
452 2786667959
453 2809230030
454 2809594035
455 2812360543
456 2819699337
457 2862296555
458 2862580224
459 2867435982
460 2873158178
461 2877683619
462 2915772097
463 2919475605
464 2946052246
465 2946065343
466 2946080289
467 2947232102
468 2954008866
469 2954388879
470 2954674245
471 2954689887
472 2954699668
473 2954702550
474 2954718609
475 2954728580
476 2954733232
477 2954747476
478 2954752113
479 2954766592
480 2966604628
481 2990063602
482 2997607170
483 3006394097
484 3006486821
485 3006497151
486 8003314843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

19

158

0.95

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

108

192

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9034 4 220
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.8984 4 219
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.8969 3 215
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.8951 4 219
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.8948 4 219
ID Description Score Start End Superfamily
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9454 4 220 3.40.50.300
af_P9WQL7_7_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9279 4 222 3.40.50.300
af_Q2FXB7_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9276 1 212 3.40.50.300
af_A4I2P8_1496_1744_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9182 4 219 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.918 4 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3R9WUE8-F1-model_v4 Cell division protein FtsQ 0.9775 1 218 GO:0005524
GO:0005886
GO:0016887
GO:0032153
GO:0043093
GO:0090529
AF-A0A3E2CUD3-F1-model_v4 deleted 0.9649 4 154
AF-A0A3E2CUD3-F1-model_v4 deleted 0.9526 4 154
AF-A0A7I7SA04-F1-model_v4 deleted 0.9426 9 220
AF-A0A661W7K0-F1-model_v4 ABC transporter ATP-binding protein 0.9374 4 220 GO:0005524
GO:0016887

Map