F354980

General Info

Members Datasets Scaffolds Average Seq Length
242 152 484 260

Family's Representative Sequence

Representative Sequence 3300046531|Ga0495665_0058006|Ga0495665_0058006_429_1346
Length 305
Sequence MRPRDLAVAPFFSGGGLSFSMSAVYSTSSTGTVFVHSSLEKEGVMKRIVLALIVLFTQGAWAQDWARTQLEKSPRHREWVTIKHDGRSVETFVVYPESKDKRPVVVLIHEIFGMSDWVQDLADQVAAAGYIAVAPDLLSGMGPNGGRTSAIAQDKVTEAVSHLDPDQVTADLNSVADYAKKIPASDGKVFVAGFCWGGGQSFRFATNRADLSGAFVFYGGPPDKETMARIKAPVYGFYAGNDARIDATLPDTTAQMKAAGKTFEPVVYADAGHGFMRAGEAPDASDANKKARQDAWARWKDLLGK

Samples

Sample ID Description Type Environment
1 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
117 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.44
Rhizosphere 86.78
Stem 0
Stem Tuber 0
Unclassified 20.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495665_0058006 3300046531 Bacteria 2044
2 Ga0070683_100017766 3300005329 Bacteria 6285
3 Ga0068869_100135019 3300005334 Bacteria 1900
4 Ga0070680_100279820 3300005336 Unclassified 1413
5 Ga0068868_100014483 3300005338 Bacteria 5813
6 Ga0068868_100064902 3300005338 Bacteria 2899
7 Ga0070660_100032893 3300005339 Bacteria 3906
8 Ga0070660_100331034 3300005339 Unclassified 1252
9 Ga0070673_100217478 3300005364 Bacteria 1652
10 Ga0070659_100058936 3300005366 Bacteria 3031
11 Ga0070703_10010376 3300005406 Bacteria 2626
12 Ga0070714_100020188 3300005435 Bacteria 5438
13 Ga0070710_10094516 3300005437 Unclassified 1769
14 Ga0070711_100226835 3300005439 Bacteria 1455
15 Ga0070700_100332370 3300005441 Unclassified 1120
16 Ga0070694_100001910 3300005444 Bacteria 12333
17 Ga0070708_100187199 3300005445 Bacteria 1936
18 Ga0070678_100102230 3300005456 Bacteria 2224
19 Ga0070681_10000091 3300005458 Bacteria 67429
20 Ga0070681_10029149 3300005458 Bacteria 5541
21 Ga0068867_100137254 3300005459 Bacteria 1908
22 Ga0070706_100001399 3300005467 Bacteria 25498
23 Ga0070698_100209534 3300005471 Bacteria 1884
24 Ga0070699_100075864 3300005518 Bacteria 2926
25 Ga0070679_100003555 3300005530 Bacteria 14279
26 Ga0070679_100037395 3300005530 Unclassified 4821
27 Ga0070684_100143923 3300005535 Bacteria 2157
28 Ga0070697_100000698 3300005536 Bacteria 25151
29 Ga0068853_100009247 3300005539 Bacteria 7942
30 Ga0068853_100106032 3300005539 Bacteria 2490
31 Ga0068853_100435045 3300005539 Unclassified 1232
32 Ga0070672_100229781 3300005543 Bacteria 1558
33 Ga0070695_100000156 3300005545 Bacteria 32250
34 Ga0070695_100360322 3300005545 Bacteria 1092
35 Ga0070696_100000936 3300005546 Bacteria 18905
36 Ga0070696_100031394 3300005546 Unclassified 3640
37 Ga0070696_100128358 3300005546 Bacteria 1842
38 Ga0070693_100000426 3300005547 Bacteria 19036
39 Ga0070693_100101862 3300005547 Bacteria 1751
40 Ga0070665_100507591 3300005548 Bacteria 1217
41 Ga0070704_100205250 3300005549 Bacteria 1593
42 Ga0068855_100001406 3300005563 Bacteria 29877
43 Ga0068855_100051939 3300005563 Bacteria 4828
44 Ga0068855_100103360 3300005563 Bacteria 3278
45 Ga0070664_100012506 3300005564 Bacteria 6903
46 Ga0068857_100008911 3300005577 Bacteria 8691
47 Ga0068856_100001014 3300005614 Bacteria 29891
48 Ga0068856_100013599 3300005614 Bacteria 7876
49 Ga0068856_100257776 3300005614 Bacteria 1759
50 Ga0068866_10040398 3300005718 Bacteria 2309
51 Ga0068858_100003636 3300005842 Bacteria 15256
52 Ga0068858_100003940 3300005842 Bacteria 14656
53 Ga0068860_100008371 3300005843 Bacteria 10299
54 Ga0068860_100830546 3300005843 Unclassified 938
55 Ga0081455_10160107 3300005937 Archaea 1726
56 Ga0070715_10248544 3300006163 Unclassified 928
57 Ga0070716_100255926 3300006173 Unclassified 1195
58 Ga0070712_100005778 3300006175 Bacteria 7646
59 Ga0097621_100000127 3300006237 Bacteria 44332
60 Ga0068871_100000279 3300006358 Bacteria 35392
61 Ga0068871_100006136 3300006358 Bacteria 8469
62 Ga0068871_100106206 3300006358 Bacteria 2357
63 Ga0075428_100032329 3300006844 Bacteria 5778
64 Ga0075431_100027334 3300006847 Bacteria 5852
65 Ga0068865_100698820 3300006881 Bacteria 866
66 Ga0099794_10019640 3300007265 Bacteria 3049
67 Ga0099794_10019911 3300007265 Bacteria 3031
68 Ga0099794_10061299 3300007265 Bacteria 1827
69 Ga0099794_10071551 3300007265 Bacteria 1699
70 Ga0105240_10001253 3300009093 Bacteria 44068
71 Ga0105240_10001350 3300009093 Bacteria 42116
72 Ga0105240_10061268 3300009093 Bacteria 4689
73 Ga0111539_10004216 3300009094 Bacteria 18855
74 Ga0105245_10001916 3300009098 Bacteria 18896
75 Ga0105245_10173606 3300009098 Bacteria 2054
76 Ga0105245_10321626 3300009098 Unclassified 1524
77 Ga0114129_10956630 3300009147 Bacteria 1081
78 Ga0105241_10005966 3300009174 Bacteria 8984
79 Ga0105248_10219798 3300009177 Bacteria 2139
80 Ga0105237_10253755 3300009545 Unclassified 1761
81 Ga0105238_10000143 3300009551 Bacteria 78219
82 Ga0105238_10018925 3300009551 Bacteria 7012
83 Ga0099796_10055909 3300010159 Bacteria 1383
84 Ga0105239_10048683 3300010375 Bacteria 4648
85 Ga0105239_10051105 3300010375 Bacteria 4532
86 Ga0105239_10058551 3300010375 Bacteria 4228
87 Ga0105239_10083725 3300010375 Bacteria 3513
88 Ga0157373_10056577 3300013100 Unclassified 2784
89 Ga0157373_10155906 3300013100 Bacteria 1606
90 Ga0157371_10026747 3300013102 Bacteria 4190
91 Ga0157369_10000102 3300013105 Bacteria 118470
92 Ga0157369_10019937 3300013105 Bacteria 7499
93 Ga0157369_10038087 3300013105 Bacteria 5260
94 Ga0157374_10000097 3300013296 Bacteria 81947
95 Ga0157374_10010769 3300013296 Bacteria 7883
96 Ga0157374_10027651 3300013296 Bacteria 5120
97 Ga0157378_10000097 3300013297 Bacteria 82132
98 Ga0157378_10000441 3300013297 Bacteria 40161
99 Ga0157378_10001294 3300013297 Bacteria 22533
100 Ga0157378_10083596 3300013297 Bacteria 2889
101 Ga0157378_10775913 3300013297 Unclassified 983
102 Ga0163162_10008931 3300013306 Bacteria 9745
103 Ga0163162_10078941 3300013306 Bacteria 3357
104 Ga0163162_10102903 3300013306 Unclassified 2950
105 Ga0157372_10000340 3300013307 Bacteria 51471
106 Ga0157372_10045591 3300013307 Bacteria 4865
107 Ga0157372_10051365 3300013307 Unclassified 4588
108 Ga0157372_10164142 3300013307 Bacteria 2568
109 Ga0157375_10011482 3300013308 Bacteria 7825
110 Ga0157375_10084669 3300013308 Bacteria 3220
111 Ga0157380_10682913 3300014326 Bacteria 1029
112 Ga0157379_10047357 3300014968 Bacteria 3836
113 Ga0157376_10157150 3300014969 Bacteria 2057
114 Ga0157376_10564943 3300014969 Bacteria 1128
115 Ga0206351_10849730 3300020077 Unclassified 1385
116 Ga0213874_10026368 3300021377 Bacteria 1646
117 Ga0213876_10026665 3300021384 Bacteria 3048
118 Ga0213875_10039898 3300021388 Unclassified 2211
119 Ga0224712_10029010 3300022467 Unclassified 1983
120 Ga0207653_10000850 3300025885 Bacteria 10187
121 Ga0207692_10181777 3300025898 Unclassified 1226
122 Ga0207647_10008837 3300025904 Bacteria 7189
123 Ga0207699_10071411 3300025906 Bacteria 2123
124 Ga0207654_10011669 3300025911 Bacteria 4484
125 Ga0207654_10124429 3300025911 Bacteria 1624
126 Ga0207707_10000127 3300025912 Bacteria 78669
127 Ga0207707_10040736 3300025912 Unclassified 4056
128 Ga0207707_10307270 3300025912 Bacteria 1371
129 Ga0207707_10505361 3300025912 Unclassified 1030
130 Ga0207695_10009738 3300025913 Bacteria 11828
131 Ga0207695_10307297 3300025913 Unclassified 1476
132 Ga0207671_10045440 3300025914 Bacteria 3248
133 Ga0207671_10091636 3300025914 Bacteria 2290
134 Ga0207693_10010151 3300025915 Bacteria 7649
135 Ga0207663_10209416 3300025916 Bacteria 1412
136 Ga0207660_10083932 3300025917 Bacteria 2347
137 Ga0207657_10039873 3300025919 Bacteria 4168
138 Ga0207652_10016158 3300025921 Bacteria 6089
139 Ga0207652_10046724 3300025921 Bacteria 3695
140 Ga0207652_10065957 3300025921 Bacteria 3136
141 Ga0207652_10272174 3300025921 Bacteria 1528
142 Ga0207694_10001202 3300025924 Bacteria 22454
143 Ga0207694_10016571 3300025924 Bacteria 5565
144 Ga0207687_10127589 3300025927 Bacteria 1912
145 Ga0207664_10006389 3300025929 Bacteria 8105
146 Ga0207664_10074845 3300025929 Unclassified 2737
147 Ga0207690_10025432 3300025932 Bacteria 3717
148 Ga0207686_10031513 3300025934 Bacteria 3149
149 Ga0207704_10013734 3300025938 Bacteria 4066
150 Ga0207665_10538383 3300025939 Unclassified 906
151 Ga0207711_10197998 3300025941 Unclassified 1833
152 Ga0207711_10255540 3300025941 Unclassified 1610
153 Ga0207689_10002747 3300025942 Bacteria 16270
154 Ga0207661_10008374 3300025944 Bacteria 7387
155 Ga0207661_10195512 3300025944 Unclassified 1776
156 Ga0207679_10034235 3300025945 Bacteria 3582
157 Ga0207667_10000606 3300025949 Bacteria 46386
158 Ga0207667_10022030 3300025949 Bacteria 7050
159 Ga0207651_10100999 3300025960 Bacteria 2140
160 Ga0207677_10022620 3300026023 Bacteria 3867
161 Ga0207703_10022739 3300026035 Bacteria 4925
162 Ga0207639_10000029 3300026041 Bacteria 195764
163 Ga0207639_10029038 3300026041 Bacteria 4045
164 Ga0207702_10000427 3300026078 Bacteria 48314
165 Ga0207702_10126005 3300026078 Bacteria 2299
166 Ga0207702_10177339 3300026078 Bacteria 1959
167 Ga0207641_10024188 3300026088 Bacteria 5007
168 Ga0207648_10333466 3300026089 Unclassified 1365
169 Ga0207674_10009451 3300026116 Bacteria 11140
170 Ga0207698_10195059 3300026142 Bacteria 1808
171 Ga0209588_1003223 3300027671 Bacteria 4508
172 Ga0209588_1050171 3300027671 Bacteria 1350
173 Ga0209588_1051521 3300027671 Unclassified 1331
174 Ga0209588_1056549 3300027671 Bacteria 1268
175 Ga0209588_1086161 3300027671 Unclassified 1014
176 Ga0207428_10124579 3300027907 Unclassified 1974
177 Ga0268266_10188538 3300028379 Bacteria 1882
178 Ga0268264_10010001 3300028381 Bacteria 7853
179 Ga0268264_10727953 3300028381 Unclassified 987
180 Ga0265338_10028322 3300028800 Bacteria 5590
181 Ga0265325_10052634 3300031241 Bacteria 2089
182 Ga0265325_10115747 3300031241 Bacteria 1298
183 Ga0265325_10194087 3300031241 Unclassified 940
184 Ga0373934_0082467 3300035086 Unclassified 1292
185 Ga0373951_0024323 3300035091 Bacteria 1402
186 Ga0373932_0066071 3300035112 Bacteria 1111
187 Ga0373936_0179452 3300035113 Unclassified 928
188 Ga0373946_0028383 3300035171 Bacteria 2219
189 Ga0373924_0017504 3300035410 Bacteria 2751
190 Ga0373935_0139153 3300035692 Bacteria 1638
191 Ga0373927_0002128 3300035695 Bacteria 14581
192 Ga0373927_0021485 3300035695 Bacteria 4231
193 Ga0373933_0000412 3300035724 Bacteria 26899
194 Ga0373937_0000076 3300036401 Bacteria 89708
195 Ga0373925_0001199 3300037068 Bacteria 22828
196 Ga0373925_0011124 3300037068 Bacteria 6527
197 Ga0436364_0028560 3300037853 Bacteria 14750
198 Ga0436364_0159220 3300037853 Unclassified 1087
199 Ga0436364_0461879 3300037853 Bacteria 3055
200 Ga0436364_0566493 3300037853 Bacteria 3252
201 Ga0436364_0753292 3300037853 Bacteria 13640
202 Ga0436364_0769585 3300037853 Bacteria 10018
203 Ga0436365_0254866 3300039437 Unclassified 4028
204 Ga0436365_1249734 3300039437 Bacteria 3359
205 Ga0436365_1438112 3300039437 Bacteria 6762
206 Ga0436363_0478493 3300039450 Unclassified 1133
207 Ga0436363_0601611 3300039450 Unclassified 4186
208 Ga0466963_0184586 3300044694 Bacteria 1457
209 Ga0495651_0095289 3300046462 Bacteria 2226
210 Ga0495580_0000306 3300046472 Bacteria 39953
211 Ga0495630_0016700 3300046517 Bacteria 5368
212 Ga0495630_0249276 3300046517 Bacteria 1357
213 Ga0495652_0222538 3300046529 Unclassified 1417
214 Ga0495587_0029896 3300046536 Unclassified 3306
215 Ga0495587_0032142 3300046536 Bacteria 3174
216 Ga0495667_0136194 3300046559 Bacteria 1583
217 Ga0495675_0011604 3300047444 Bacteria 5532
218 Ga0495684_0277308 3300047471 Unclassified 1211
219 Ga0495602_0019401 3300048088 Bacteria 6751
220 Ga0496100_0202788 3300048903 Unclassified 1446
221 Ga0496101_0007464 3300048904 Bacteria 7088
222 Ga0496102_0000946 3300048905 Bacteria 27368
223 Ga0496102_0064688 3300048905 Bacteria 3350
224 Ga0496102_0562119 3300048905 Unclassified 1063
225 Ga0496104_0009277 3300048907 Bacteria 8751
226 Ga0496104_0415143 3300048907 Bacteria 1258
227 Ga0496105_0176602 3300048908 Bacteria 1749
228 Ga0496106_0188528 3300048909 Unclassified 1639
229 Ga0496107_0031922 3300048910 Unclassified 3761
230 Ga0496107_0109833 3300048910 Bacteria 2026
231 Ga0496107_0328354 3300048910 Bacteria 1138
232 Ga0496112_0001191 3300048915 Bacteria 19489
233 Ga0496112_0010823 3300048915 Bacteria 8300
234 Ga0496115_0011921 3300048918 Bacteria 6527
235 Ga0496115_0073564 3300048918 Bacteria 2774
236 Ga0496115_0079780 3300048918 Bacteria 2664
237 Ga0496115_0334186 3300048918 Unclassified 1237
238 Ga0501076_0319262 3300049592 Bacteria 1274
239 nmdc:mga06r32_34368_c1 3300050510 Unclassified 4780
240 nmdc:mga08y16_28201_c1 3300050511 Bacteria 5918
241 nmdc:mga08x19_1779_c1 3300050514 Bacteria 13274
242 Ga0495619_0007300 3300053085 Bacteria 6999
243 Ga0495665_0058006
244 Ga0070683_100017766
245 Ga0068869_100135019
246 Ga0070680_100279820
247 Ga0068868_100014483
248 Ga0068868_100064902
249 Ga0070660_100032893
250 Ga0070660_100331034
251 Ga0070673_100217478
252 Ga0070659_100058936
253 Ga0070703_10010376
254 Ga0070714_100020188
255 Ga0070710_10094516
256 Ga0070711_100226835
257 Ga0070700_100332370
258 Ga0070694_100001910
259 Ga0070708_100187199
260 Ga0070678_100102230
261 Ga0070681_10000091
262 Ga0070681_10029149
263 Ga0068867_100137254
264 Ga0070706_100001399
265 Ga0070698_100209534
266 Ga0070699_100075864
267 Ga0070679_100003555
268 Ga0070679_100037395
269 Ga0070684_100143923
270 Ga0070697_100000698
271 Ga0068853_100009247
272 Ga0068853_100106032
273 Ga0068853_100435045
274 Ga0070672_100229781
275 Ga0070695_100000156
276 Ga0070695_100360322
277 Ga0070696_100000936
278 Ga0070696_100031394
279 Ga0070696_100128358
280 Ga0070693_100000426
281 Ga0070693_100101862
282 Ga0070665_100507591
283 Ga0070704_100205250
284 Ga0068855_100001406
285 Ga0068855_100051939
286 Ga0068855_100103360
287 Ga0070664_100012506
288 Ga0068857_100008911
289 Ga0068856_100001014
290 Ga0068856_100013599
291 Ga0068856_100257776
292 Ga0068866_10040398
293 Ga0068858_100003636
294 Ga0068858_100003940
295 Ga0068860_100008371
296 Ga0068860_100830546
297 Ga0081455_10160107
298 Ga0070715_10248544
299 Ga0070716_100255926
300 Ga0070712_100005778
301 Ga0097621_100000127
302 Ga0068871_100000279
303 Ga0068871_100006136
304 Ga0068871_100106206
305 Ga0075428_100032329
306 Ga0075431_100027334
307 Ga0068865_100698820
308 Ga0099794_10019640
309 Ga0099794_10019911
310 Ga0099794_10061299
311 Ga0099794_10071551
312 Ga0105240_10001253
313 Ga0105240_10001350
314 Ga0105240_10061268
315 Ga0111539_10004216
316 Ga0105245_10001916
317 Ga0105245_10173606
318 Ga0105245_10321626
319 Ga0114129_10956630
320 Ga0105241_10005966
321 Ga0105248_10219798
322 Ga0105237_10253755
323 Ga0105238_10000143
324 Ga0105238_10018925
325 Ga0099796_10055909
326 Ga0105239_10048683
327 Ga0105239_10051105
328 Ga0105239_10058551
329 Ga0105239_10083725
330 Ga0157373_10056577
331 Ga0157373_10155906
332 Ga0157371_10026747
333 Ga0157369_10000102
334 Ga0157369_10019937
335 Ga0157369_10038087
336 Ga0157374_10000097
337 Ga0157374_10010769
338 Ga0157374_10027651
339 Ga0157378_10000097
340 Ga0157378_10000441
341 Ga0157378_10001294
342 Ga0157378_10083596
343 Ga0157378_10775913
344 Ga0163162_10008931
345 Ga0163162_10078941
346 Ga0163162_10102903
347 Ga0157372_10000340
348 Ga0157372_10045591
349 Ga0157372_10051365
350 Ga0157372_10164142
351 Ga0157375_10011482
352 Ga0157375_10084669
353 Ga0157380_10682913
354 Ga0157379_10047357
355 Ga0157376_10157150
356 Ga0157376_10564943
357 Ga0206351_10849730
358 Ga0213874_10026368
359 Ga0213876_10026665
360 Ga0213875_10039898
361 Ga0224712_10029010
362 Ga0207653_10000850
363 Ga0207692_10181777
364 Ga0207647_10008837
365 Ga0207699_10071411
366 Ga0207654_10011669
367 Ga0207654_10124429
368 Ga0207707_10000127
369 Ga0207707_10040736
370 Ga0207707_10307270
371 Ga0207707_10505361
372 Ga0207695_10009738
373 Ga0207695_10307297
374 Ga0207671_10045440
375 Ga0207671_10091636
376 Ga0207693_10010151
377 Ga0207663_10209416
378 Ga0207660_10083932
379 Ga0207657_10039873
380 Ga0207652_10016158
381 Ga0207652_10046724
382 Ga0207652_10065957
383 Ga0207652_10272174
384 Ga0207694_10001202
385 Ga0207694_10016571
386 Ga0207687_10127589
387 Ga0207664_10006389
388 Ga0207664_10074845
389 Ga0207690_10025432
390 Ga0207686_10031513
391 Ga0207704_10013734
392 Ga0207665_10538383
393 Ga0207711_10197998
394 Ga0207711_10255540
395 Ga0207689_10002747
396 Ga0207661_10008374
397 Ga0207661_10195512
398 Ga0207679_10034235
399 Ga0207667_10000606
400 Ga0207667_10022030
401 Ga0207651_10100999
402 Ga0207677_10022620
403 Ga0207703_10022739
404 Ga0207639_10000029
405 Ga0207639_10029038
406 Ga0207702_10000427
407 Ga0207702_10126005
408 Ga0207702_10177339
409 Ga0207641_10024188
410 Ga0207648_10333466
411 Ga0207674_10009451
412 Ga0207698_10195059
413 Ga0209588_1003223
414 Ga0209588_1050171
415 Ga0209588_1051521
416 Ga0209588_1056549
417 Ga0209588_1086161
418 Ga0207428_10124579
419 Ga0268266_10188538
420 Ga0268264_10010001
421 Ga0268264_10727953
422 Ga0265338_10028322
423 Ga0265325_10052634
424 Ga0265325_10115747
425 Ga0265325_10194087
426 Ga0373934_0082467
427 Ga0373951_0024323
428 Ga0373932_0066071
429 Ga0373936_0179452
430 Ga0373946_0028383
431 Ga0373924_0017504
432 Ga0373935_0139153
433 Ga0373927_0002128
434 Ga0373927_0021485
435 Ga0373933_0000412
436 Ga0373937_0000076
437 Ga0373925_0001199
438 Ga0373925_0011124
439 Ga0436364_0028560
440 Ga0436364_0159220
441 Ga0436364_0461879
442 Ga0436364_0566493
443 Ga0436364_0753292
444 Ga0436364_0769585
445 Ga0436365_0254866
446 Ga0436365_1249734
447 Ga0436365_1438112
448 Ga0436363_0478493
449 Ga0436363_0601611
450 Ga0466963_0184586
451 Ga0495651_0095289
452 Ga0495580_0000306
453 Ga0495630_0016700
454 Ga0495630_0249276
455 Ga0495652_0222538
456 Ga0495587_0029896
457 Ga0495587_0032142
458 Ga0495667_0136194
459 Ga0495675_0011604
460 Ga0495684_0277308
461 Ga0495602_0019401
462 Ga0496100_0202788
463 Ga0496101_0007464
464 Ga0496102_0000946
465 Ga0496102_0064688
466 Ga0496102_0562119
467 Ga0496104_0009277
468 Ga0496104_0415143
469 Ga0496105_0176602
470 Ga0496106_0188528
471 Ga0496107_0031922
472 Ga0496107_0109833
473 Ga0496107_0328354
474 Ga0496112_0001191
475 Ga0496112_0010823
476 Ga0496115_0011921
477 Ga0496115_0073564
478 Ga0496115_0079780
479 Ga0496115_0334186
480 Ga0501076_0319262
481 nmdc:mga06r32_34368_c1
482 nmdc:mga08y16_28201_c1
483 nmdc:mga08x19_1779_c1
484 Ga0495619_0007300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

89

305

0.92

PF12740

Chlorophyllase2

Cutinase

87

220

0.73

PF07224

Chlorophyllase

Chlorophyllase

54

212

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.8813 26 260
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8622 31 261
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.8608 30 260
1ggv-assembly1.cif.gz_A crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) 0.8539 36 260
4u2c-assembly1.cif.gz_A crystal structure of dienelactone hydrolase a-6 variant (s7t, a24v, q35h, f38l, q110l, c123s, y145c, e199g and s208g) at 1.95 a resolution 0.8525 36 260
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8949 27 260 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8557 27 260 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8462 31 255 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8319 34 257 3.40.50.1820
af_Q2FY80_39_164_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8311 28 50 3.30.450.20
ID Description Score Start End GO Terms
AF-A0A2V9AX37-F1-model_v4 Carboxymethylenebutenolidase 0.9809 27 261 GO:0016787
AF-A0A2V9RE90-F1-model_v4 Carboxymethylenebutenolidase 0.9795 56 261 GO:0016787
AF-A0A7Z9QZG5-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9773 22 172 GO:0016787
AF-A0A2N9M1F9-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9768 18 109 GO:0016787
AF-A0A2V9G165-F1-model_v4 Carboxymethylenebutenolidase 0.9764 13 167 GO:0016787

Map