F352988
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 240 | 141 | 480 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300031344|Ga0265316_10031176|Ga0265316_100311762 |
| Length | 151 |
| Sequence | VARRQERRPPARVKIYLYYIGKPKDPHANAMAADFVGRAARYSACEMREIRPDRTDLWDKHPSARKIFLDPAGKAMDSAAFARLIARSEMEGRDLVFLIGGHDGLPPGWAARADQLVSLSAMTFPHELARAMLAEQIYRGFATLRGHPYPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 30 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 31 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 56 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 57 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 81 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 82 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 83 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 84 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 85 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 86 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 87 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 89 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 90 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 91 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 92 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 93 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 94 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 95 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 96 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 97 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 98 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 99 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 100 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 101 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 102 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 134 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 135 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 136 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 137 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 138 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.08 |
| Rhizosphere | 93.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 35.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265316_10031176 | 3300031344 | Bacteria | 4362 |
| 2 | Ga0070658_10215427 | 3300005327 | Bacteria | 1623 |
| 3 | Ga0070683_100610215 | 3300005329 | Unclassified | 1044 |
| 4 | Ga0070670_100365490 | 3300005331 | Unclassified | 1269 |
| 5 | Ga0070670_101218452 | 3300005331 | Unclassified | 688 |
| 6 | Ga0070677_10674024 | 3300005333 | Unclassified | 580 |
| 7 | Ga0068869_101894554 | 3300005334 | Unclassified | 534 |
| 8 | Ga0070682_100788905 | 3300005337 | Unclassified | 771 |
| 9 | Ga0070660_101328295 | 3300005339 | Bacteria | 610 |
| 10 | Ga0070675_100303151 | 3300005354 | Bacteria | 1408 |
| 11 | Ga0070671_100267239 | 3300005355 | Unclassified | 1454 |
| 12 | Ga0070674_100432625 | 3300005356 | Unclassified | 1082 |
| 13 | Ga0070674_101409285 | 3300005356 | Unclassified | 624 |
| 14 | Ga0070673_100424922 | 3300005364 | Unclassified | 1192 |
| 15 | Ga0070709_11430038 | 3300005434 | Unclassified | 560 |
| 16 | Ga0070714_100682606 | 3300005435 | Bacteria | 990 |
| 17 | Ga0070713_100065185 | 3300005436 | Bacteria | 3059 |
| 18 | Ga0070681_10001801 | 3300005458 | Bacteria | 19265 |
| 19 | Ga0070684_100330073 | 3300005535 | Unclassified | 1402 |
| 20 | Ga0070684_100483850 | 3300005535 | Unclassified | 1146 |
| 21 | Ga0070684_101129804 | 3300005535 | Bacteria | 736 |
| 22 | Ga0068853_101780670 | 3300005539 | Unclassified | 597 |
| 23 | Ga0070665_101548036 | 3300005548 | Bacteria | 671 |
| 24 | Ga0070664_100541263 | 3300005564 | Unclassified | 1076 |
| 25 | Ga0068857_100821440 | 3300005577 | Bacteria | 888 |
| 26 | Ga0068856_100141225 | 3300005614 | Unclassified | 2415 |
| 27 | Ga0068859_100341312 | 3300005617 | Bacteria | 1592 |
| 28 | Ga0068859_101223751 | 3300005617 | Unclassified | 827 |
| 29 | Ga0068864_100182457 | 3300005618 | Bacteria | 1919 |
| 30 | Ga0068863_100142954 | 3300005841 | Bacteria | 2287 |
| 31 | Ga0068863_100743032 | 3300005841 | Unclassified | 977 |
| 32 | Ga0068858_100848368 | 3300005842 | Unclassified | 892 |
| 33 | Ga0070717_10531673 | 3300006028 | Bacteria | 1064 |
| 34 | Ga0097621_100124297 | 3300006237 | Bacteria | 2191 |
| 35 | Ga0097621_101331230 | 3300006237 | Unclassified | 679 |
| 36 | Ga0097621_101885894 | 3300006237 | Unclassified | 570 |
| 37 | Ga0068871_100068015 | 3300006358 | Bacteria | 2924 |
| 38 | Ga0068871_100480834 | 3300006358 | Bacteria | 1117 |
| 39 | Ga0068865_100210087 | 3300006881 | Bacteria | 1516 |
| 40 | Ga0068865_101667991 | 3300006881 | Bacteria | 574 |
| 41 | Ga0097620_100341300 | 3300006931 | Bacteria | 1592 |
| 42 | Ga0097620_101223491 | 3300006931 | Unclassified | 827 |
| 43 | Ga0075435_101800650 | 3300007076 | Unclassified | 537 |
| 44 | Ga0105240_10008850 | 3300009093 | Bacteria | 14336 |
| 45 | Ga0105240_10089983 | 3300009093 | Unclassified | 3753 |
| 46 | Ga0111539_11075383 | 3300009094 | Bacteria | 935 |
| 47 | Ga0105245_10447669 | 3300009098 | Bacteria | 1299 |
| 48 | Ga0114129_10913192 | 3300009147 | Bacteria | 1112 |
| 49 | Ga0114129_11255548 | 3300009147 | Unclassified | 920 |
| 50 | Ga0105242_10276590 | 3300009176 | Unclassified | 1523 |
| 51 | Ga0105242_10691727 | 3300009176 | Unclassified | 997 |
| 52 | Ga0105248_10160539 | 3300009177 | Bacteria | 2536 |
| 53 | Ga0105248_11103795 | 3300009177 | Bacteria | 897 |
| 54 | Ga0105237_10066967 | 3300009545 | Unclassified | 3585 |
| 55 | Ga0105237_10450254 | 3300009545 | Bacteria | 1293 |
| 56 | Ga0105238_10120034 | 3300009551 | Bacteria | 2609 |
| 57 | Ga0105239_11764225 | 3300010375 | Unclassified | 717 |
| 58 | Ga0105239_11800458 | 3300010375 | Bacteria | 709 |
| 59 | Ga0105246_11157021 | 3300011119 | Unclassified | 710 |
| 60 | Ga0157370_10878884 | 3300013104 | Bacteria | 814 |
| 61 | Ga0157370_12005236 | 3300013104 | Bacteria | 519 |
| 62 | Ga0157369_10226657 | 3300013105 | Bacteria | 1955 |
| 63 | Ga0157369_10764690 | 3300013105 | Bacteria | 993 |
| 64 | Ga0157374_10458278 | 3300013296 | Viruses | 1277 |
| 65 | Ga0157374_11145486 | 3300013296 | Bacteria | 799 |
| 66 | Ga0157378_11320067 | 3300013297 | Bacteria | 763 |
| 67 | Ga0163162_10783502 | 3300013306 | Unclassified | 1072 |
| 68 | Ga0163162_11015336 | 3300013306 | Unclassified | 938 |
| 69 | Ga0163162_11314588 | 3300013306 | Bacteria | 822 |
| 70 | Ga0163162_11915671 | 3300013306 | Unclassified | 679 |
| 71 | Ga0157372_10503537 | 3300013307 | Bacteria | 1412 |
| 72 | Ga0157375_10115163 | 3300013308 | Unclassified | 2791 |
| 73 | Ga0157375_10305310 | 3300013308 | Bacteria | 1755 |
| 74 | Ga0157375_10643637 | 3300013308 | Bacteria | 1217 |
| 75 | Ga0157375_11778891 | 3300013308 | Bacteria | 730 |
| 76 | Ga0163163_10315457 | 3300014325 | Bacteria | 1617 |
| 77 | Ga0157380_10479637 | 3300014326 | Unclassified | 1202 |
| 78 | Ga0157379_10653391 | 3300014968 | Bacteria | 985 |
| 79 | Ga0157376_10079010 | 3300014969 | Unclassified | 2819 |
| 80 | Ga0157376_10465158 | 3300014969 | Unclassified | 1236 |
| 81 | Ga0163161_11195843 | 3300017792 | Unclassified | 657 |
| 82 | Ga0213876_10139606 | 3300021384 | Unclassified | 1289 |
| 83 | Ga0213875_10019335 | 3300021388 | Bacteria | 3276 |
| 84 | Ga0213875_10076588 | 3300021388 | Bacteria | 1561 |
| 85 | Ga0207682_10087582 | 3300025893 | Bacteria | 1345 |
| 86 | Ga0207692_10376539 | 3300025898 | Bacteria | 880 |
| 87 | Ga0207680_11070965 | 3300025903 | Bacteria | 577 |
| 88 | Ga0207707_10001905 | 3300025912 | Bacteria | 18983 |
| 89 | Ga0207707_10770373 | 3300025912 | Unclassified | 803 |
| 90 | Ga0207695_10002623 | 3300025913 | Bacteria | 26311 |
| 91 | Ga0207695_10005563 | 3300025913 | Bacteria | 16641 |
| 92 | Ga0207660_10231964 | 3300025917 | Bacteria | 1451 |
| 93 | Ga0207660_10323007 | 3300025917 | Unclassified | 1233 |
| 94 | Ga0207662_10405523 | 3300025918 | Bacteria | 925 |
| 95 | Ga0207694_10172071 | 3300025924 | Bacteria | 1754 |
| 96 | Ga0207650_10454218 | 3300025925 | Unclassified | 1067 |
| 97 | Ga0207650_11002317 | 3300025925 | Unclassified | 710 |
| 98 | Ga0207664_10075861 | 3300025929 | Bacteria | 2719 |
| 99 | Ga0207664_10420767 | 3300025929 | Bacteria | 1190 |
| 100 | Ga0207644_10558993 | 3300025931 | Bacteria | 948 |
| 101 | Ga0207686_10330644 | 3300025934 | Unclassified | 1142 |
| 102 | Ga0207670_10232982 | 3300025936 | Bacteria | 1415 |
| 103 | Ga0207670_10254694 | 3300025936 | Unclassified | 1358 |
| 104 | Ga0207691_10517744 | 3300025940 | Bacteria | 1012 |
| 105 | Ga0207711_10110694 | 3300025941 | Bacteria | 2442 |
| 106 | Ga0207711_10544372 | 3300025941 | Unclassified | 1083 |
| 107 | Ga0207711_10830471 | 3300025941 | Bacteria | 860 |
| 108 | Ga0207711_11018284 | 3300025941 | Bacteria | 768 |
| 109 | Ga0207661_10073921 | 3300025944 | Bacteria | 2793 |
| 110 | Ga0207661_10234946 | 3300025944 | Bacteria | 1625 |
| 111 | Ga0207661_10507336 | 3300025944 | Unclassified | 1102 |
| 112 | Ga0207651_10511045 | 3300025960 | Unclassified | 1040 |
| 113 | Ga0207677_10208174 | 3300026023 | Bacteria | 1560 |
| 114 | Ga0207639_12012248 | 3300026041 | Unclassified | 539 |
| 115 | Ga0207702_10071617 | 3300026078 | Unclassified | 2985 |
| 116 | Ga0207641_10696960 | 3300026088 | Unclassified | 1000 |
| 117 | Ga0207641_12021123 | 3300026088 | Bacteria | 577 |
| 118 | Ga0207676_10230814 | 3300026095 | Bacteria | 1654 |
| 119 | Ga0207674_10804482 | 3300026116 | Bacteria | 907 |
| 120 | Ga0265330_10123378 | 3300031235 | Unclassified | 1103 |
| 121 | Ga0265330_10162929 | 3300031235 | Bacteria | 947 |
| 122 | Ga0265332_10259352 | 3300031238 | Bacteria | 719 |
| 123 | Ga0265325_10240723 | 3300031241 | Unclassified | 822 |
| 124 | Ga0265329_10208897 | 3300031242 | Unclassified | 644 |
| 125 | Ga0265340_10272703 | 3300031247 | Bacteria | 752 |
| 126 | Ga0265339_10252592 | 3300031249 | Bacteria | 853 |
| 127 | Ga0265331_10154215 | 3300031250 | Unclassified | 1042 |
| 128 | Ga0265316_10002594 | 3300031344 | Bacteria | 18653 |
| 129 | Ga0265316_10032883 | 3300031344 | Bacteria | 4230 |
| 130 | Ga0265316_10105474 | 3300031344 | Bacteria | 2138 |
| 131 | Ga0265316_10124550 | 3300031344 | Bacteria | 1944 |
| 132 | Ga0265316_10160010 | 3300031344 | Bacteria | 1684 |
| 133 | Ga0265316_10200971 | 3300031344 | Bacteria | 1477 |
| 134 | Ga0265316_10785082 | 3300031344 | Unclassified | 668 |
| 135 | Ga0265316_10885761 | 3300031344 | Bacteria | 624 |
| 136 | Ga0265314_10011604 | 3300031711 | Bacteria | 7254 |
| 137 | Ga0265342_10009167 | 3300031712 | Bacteria | 7007 |
| 138 | Ga0265342_10411355 | 3300031712 | Unclassified | 698 |
| 139 | Ga0373953_0194245 | 3300035117 | Bacteria | 877 |
| 140 | Ga0373943_0273293 | 3300035170 | Unclassified | 954 |
| 141 | Ga0373943_0362521 | 3300035170 | Bacteria | 832 |
| 142 | Ga0373927_0238949 | 3300035695 | Bacteria | 1194 |
| 143 | Ga0373933_0167158 | 3300035724 | Bacteria | 1399 |
| 144 | Ga0373947_0024259 | 3300035725 | Bacteria | 3534 |
| 145 | Ga0373947_0183862 | 3300035725 | Bacteria | 1362 |
| 146 | Ga0373947_0681996 | 3300035725 | Unclassified | 701 |
| 147 | Ga0373937_0709620 | 3300036401 | Bacteria | 953 |
| 148 | Ga0373937_1634309 | 3300036401 | Unclassified | 591 |
| 149 | Ga0373925_0082770 | 3300037068 | Bacteria | 2443 |
| 150 | Ga0373925_0357284 | 3300037068 | Bacteria | 1187 |
| 151 | Ga0436364_0292238 | 3300037853 | Bacteria | 830 |
| 152 | Ga0436364_0418026 | 3300037853 | Bacteria | 4516 |
| 153 | Ga0436364_1069468 | 3300037853 | Unclassified | 792 |
| 154 | Ga0436364_1397517 | 3300037853 | Bacteria | 14314 |
| 155 | Ga0436365_0605223 | 3300039437 | Bacteria | 1588 |
| 156 | Ga0436365_1524030 | 3300039437 | Bacteria | 3927 |
| 157 | Ga0436363_0718663 | 3300039450 | Unclassified | 1030 |
| 158 | Ga0466963_0683978 | 3300044694 | Unclassified | 724 |
| 159 | Ga0466959_0324468 | 3300045049 | Bacteria | 1052 |
| 160 | Ga0451576_0038722 | 3300045051 | Bacteria | 5046 |
| 161 | Ga0451576_0699520 | 3300045051 | Bacteria | 1065 |
| 162 | Ga0495592_0294980 | 3300046454 | Bacteria | 1056 |
| 163 | Ga0495592_0410153 | 3300046454 | Bacteria | 856 |
| 164 | Ga0495629_0188344 | 3300046459 | Unclassified | 1429 |
| 165 | Ga0495651_0012745 | 3300046462 | Bacteria | 6490 |
| 166 | Ga0495651_0149049 | 3300046462 | Bacteria | 1689 |
| 167 | Ga0495651_0247350 | 3300046462 | Bacteria | 1220 |
| 168 | Ga0495580_0001461 | 3300046472 | Bacteria | 20727 |
| 169 | Ga0495580_0078908 | 3300046472 | Bacteria | 2296 |
| 170 | Ga0495580_0120070 | 3300046472 | Bacteria | 1825 |
| 171 | Ga0495580_0389258 | 3300046472 | Bacteria | 941 |
| 172 | Ga0495580_0446545 | 3300046472 | Bacteria | 868 |
| 173 | Ga0495582_0431748 | 3300046473 | Unclassified | 760 |
| 174 | Ga0495582_0537540 | 3300046473 | Bacteria | 676 |
| 175 | Ga0495639_0412374 | 3300046475 | Unclassified | 683 |
| 176 | Ga0495664_0386806 | 3300046477 | Unclassified | 841 |
| 177 | Ga0495664_0502912 | 3300046477 | Bacteria | 724 |
| 178 | Ga0495664_0599312 | 3300046477 | Bacteria | 655 |
| 179 | Ga0495594_0034786 | 3300046499 | Bacteria | 2742 |
| 180 | Ga0495594_0104206 | 3300046499 | Bacteria | 1597 |
| 181 | Ga0495594_0799394 | 3300046499 | Unclassified | 532 |
| 182 | Ga0495608_0311538 | 3300046511 | Unclassified | 973 |
| 183 | Ga0495628_0038302 | 3300046516 | Bacteria | 3838 |
| 184 | Ga0495628_0157398 | 3300046516 | Bacteria | 1728 |
| 185 | Ga0495628_0216399 | 3300046516 | Bacteria | 1440 |
| 186 | Ga0495628_0260037 | 3300046516 | Bacteria | 1294 |
| 187 | Ga0495666_0034215 | 3300046526 | Bacteria | 2480 |
| 188 | Ga0495652_0384697 | 3300046529 | Bacteria | 997 |
| 189 | Ga0495665_0057353 | 3300046531 | Unclassified | 2056 |
| 190 | Ga0495665_0405366 | 3300046531 | Bacteria | 691 |
| 191 | Ga0495665_0596048 | 3300046531 | Unclassified | 552 |
| 192 | Ga0495587_0312111 | 3300046536 | Bacteria | 878 |
| 193 | Ga0495645_0003783 | 3300046543 | Bacteria | 10287 |
| 194 | Ga0495645_0247263 | 3300046543 | Unclassified | 1187 |
| 195 | Ga0495645_0444002 | 3300046543 | Unclassified | 819 |
| 196 | Ga0495667_0011804 | 3300046559 | Bacteria | 5917 |
| 197 | Ga0495667_0075702 | 3300046559 | Bacteria | 2190 |
| 198 | Ga0495667_0115231 | 3300046559 | Bacteria | 1736 |
| 199 | Ga0495667_0123834 | 3300046559 | Bacteria | 1669 |
| 200 | Ga0495635_0064466 | 3300046663 | Bacteria | 2515 |
| 201 | Ga0495599_0115270 | 3300046678 | Bacteria | 1672 |
| 202 | Ga0495599_0373688 | 3300046678 | Unclassified | 852 |
| 203 | Ga0495623_0058423 | 3300046679 | Unclassified | 2425 |
| 204 | Ga0495623_0221495 | 3300046679 | Bacteria | 1078 |
| 205 | Ga0495623_0255383 | 3300046679 | Bacteria | 984 |
| 206 | Ga0495646_0414515 | 3300046680 | Unclassified | 699 |
| 207 | Ga0495613_0120877 | 3300046689 | Bacteria | 1881 |
| 208 | Ga0495600_0263996 | 3300046809 | Unclassified | 1093 |
| 209 | Ga0495604_0157164 | 3300047317 | Unclassified | 1609 |
| 210 | Ga0495604_0656779 | 3300047317 | Bacteria | 668 |
| 211 | Ga0495636_0639503 | 3300047318 | Unclassified | 522 |
| 212 | Ga0495674_0052674 | 3300047319 | Bacteria | 3580 |
| 213 | Ga0495674_0053184 | 3300047319 | Bacteria | 3561 |
| 214 | Ga0495674_0096781 | 3300047319 | Bacteria | 2515 |
| 215 | Ga0495674_0169959 | 3300047319 | Bacteria | 1820 |
| 216 | Ga0495674_0371218 | 3300047319 | Bacteria | 1159 |
| 217 | Ga0495674_0960650 | 3300047319 | Bacteria | 657 |
| 218 | Ga0495680_0138189 | 3300047322 | Unclassified | 1785 |
| 219 | Ga0495680_0522864 | 3300047322 | Bacteria | 803 |
| 220 | Ga0495675_0054879 | 3300047444 | Unclassified | 2528 |
| 221 | Ga0495675_0072911 | 3300047444 | Bacteria | 2166 |
| 222 | Ga0495675_0083746 | 3300047444 | Unclassified | 2007 |
| 223 | Ga0495684_0001380 | 3300047471 | Bacteria | 19489 |
| 224 | Ga0495684_0135251 | 3300047471 | Bacteria | 1850 |
| 225 | Ga0495684_0275110 | 3300047471 | Bacteria | 1217 |
| 226 | Ga0495684_0441054 | 3300047471 | Bacteria | 907 |
| 227 | Ga0495593_0240800 | 3300047673 | Bacteria | 906 |
| 228 | Ga0495602_0013404 | 3300048088 | Bacteria | 8379 |
| 229 | Ga0495602_0162197 | 3300048088 | Bacteria | 1744 |
| 230 | Ga0495614_0420517 | 3300048089 | Unclassified | 630 |
| 231 | Ga0496102_1121392 | 3300048905 | Bacteria | 706 |
| 232 | Ga0496111_1051077 | 3300048914 | Bacteria | 582 |
| 233 | Ga0496114_0773389 | 3300048917 | Unclassified | 838 |
| 234 | Ga0496115_0435139 | 3300048918 | Unclassified | 1061 |
| 235 | Ga0496115_0582796 | 3300048918 | Unclassified | 891 |
| 236 | Ga0496126_0103558 | 3300048929 | Bacteria | 2487 |
| 237 | nmdc:mga05p37_1630842_c1 | 3300050507 | Bacteria | 633 |
| 238 | nmdc:mga0qj67_1000414_c1 | 3300050509 | Bacteria | 656 |
| 239 | Ga0495601_0241723 | 3300053077 | Bacteria | 1179 |
| 240 | Ga0501082_0000021 | 3300060353 | Bacteria | 109085 |
| 241 | Ga0265316_10031176 | |||
| 242 | Ga0070658_10215427 | |||
| 243 | Ga0070683_100610215 | |||
| 244 | Ga0070670_100365490 | |||
| 245 | Ga0070670_101218452 | |||
| 246 | Ga0070677_10674024 | |||
| 247 | Ga0068869_101894554 | |||
| 248 | Ga0070682_100788905 | |||
| 249 | Ga0070660_101328295 | |||
| 250 | Ga0070675_100303151 | |||
| 251 | Ga0070671_100267239 | |||
| 252 | Ga0070674_100432625 | |||
| 253 | Ga0070674_101409285 | |||
| 254 | Ga0070673_100424922 | |||
| 255 | Ga0070709_11430038 | |||
| 256 | Ga0070714_100682606 | |||
| 257 | Ga0070713_100065185 | |||
| 258 | Ga0070681_10001801 | |||
| 259 | Ga0070684_100330073 | |||
| 260 | Ga0070684_100483850 | |||
| 261 | Ga0070684_101129804 | |||
| 262 | Ga0068853_101780670 | |||
| 263 | Ga0070665_101548036 | |||
| 264 | Ga0070664_100541263 | |||
| 265 | Ga0068857_100821440 | |||
| 266 | Ga0068856_100141225 | |||
| 267 | Ga0068859_100341312 | |||
| 268 | Ga0068859_101223751 | |||
| 269 | Ga0068864_100182457 | |||
| 270 | Ga0068863_100142954 | |||
| 271 | Ga0068863_100743032 | |||
| 272 | Ga0068858_100848368 | |||
| 273 | Ga0070717_10531673 | |||
| 274 | Ga0097621_100124297 | |||
| 275 | Ga0097621_101331230 | |||
| 276 | Ga0097621_101885894 | |||
| 277 | Ga0068871_100068015 | |||
| 278 | Ga0068871_100480834 | |||
| 279 | Ga0068865_100210087 | |||
| 280 | Ga0068865_101667991 | |||
| 281 | Ga0097620_100341300 | |||
| 282 | Ga0097620_101223491 | |||
| 283 | Ga0075435_101800650 | |||
| 284 | Ga0105240_10008850 | |||
| 285 | Ga0105240_10089983 | |||
| 286 | Ga0111539_11075383 | |||
| 287 | Ga0105245_10447669 | |||
| 288 | Ga0114129_10913192 | |||
| 289 | Ga0114129_11255548 | |||
| 290 | Ga0105242_10276590 | |||
| 291 | Ga0105242_10691727 | |||
| 292 | Ga0105248_10160539 | |||
| 293 | Ga0105248_11103795 | |||
| 294 | Ga0105237_10066967 | |||
| 295 | Ga0105237_10450254 | |||
| 296 | Ga0105238_10120034 | |||
| 297 | Ga0105239_11764225 | |||
| 298 | Ga0105239_11800458 | |||
| 299 | Ga0105246_11157021 | |||
| 300 | Ga0157370_10878884 | |||
| 301 | Ga0157370_12005236 | |||
| 302 | Ga0157369_10226657 | |||
| 303 | Ga0157369_10764690 | |||
| 304 | Ga0157374_10458278 | |||
| 305 | Ga0157374_11145486 | |||
| 306 | Ga0157378_11320067 | |||
| 307 | Ga0163162_10783502 | |||
| 308 | Ga0163162_11015336 | |||
| 309 | Ga0163162_11314588 | |||
| 310 | Ga0163162_11915671 | |||
| 311 | Ga0157372_10503537 | |||
| 312 | Ga0157375_10115163 | |||
| 313 | Ga0157375_10305310 | |||
| 314 | Ga0157375_10643637 | |||
| 315 | Ga0157375_11778891 | |||
| 316 | Ga0163163_10315457 | |||
| 317 | Ga0157380_10479637 | |||
| 318 | Ga0157379_10653391 | |||
| 319 | Ga0157376_10079010 | |||
| 320 | Ga0157376_10465158 | |||
| 321 | Ga0163161_11195843 | |||
| 322 | Ga0213876_10139606 | |||
| 323 | Ga0213875_10019335 | |||
| 324 | Ga0213875_10076588 | |||
| 325 | Ga0207682_10087582 | |||
| 326 | Ga0207692_10376539 | |||
| 327 | Ga0207680_11070965 | |||
| 328 | Ga0207707_10001905 | |||
| 329 | Ga0207707_10770373 | |||
| 330 | Ga0207695_10002623 | |||
| 331 | Ga0207695_10005563 | |||
| 332 | Ga0207660_10231964 | |||
| 333 | Ga0207660_10323007 | |||
| 334 | Ga0207662_10405523 | |||
| 335 | Ga0207694_10172071 | |||
| 336 | Ga0207650_10454218 | |||
| 337 | Ga0207650_11002317 | |||
| 338 | Ga0207664_10075861 | |||
| 339 | Ga0207664_10420767 | |||
| 340 | Ga0207644_10558993 | |||
| 341 | Ga0207686_10330644 | |||
| 342 | Ga0207670_10232982 | |||
| 343 | Ga0207670_10254694 | |||
| 344 | Ga0207691_10517744 | |||
| 345 | Ga0207711_10110694 | |||
| 346 | Ga0207711_10544372 | |||
| 347 | Ga0207711_10830471 | |||
| 348 | Ga0207711_11018284 | |||
| 349 | Ga0207661_10073921 | |||
| 350 | Ga0207661_10234946 | |||
| 351 | Ga0207661_10507336 | |||
| 352 | Ga0207651_10511045 | |||
| 353 | Ga0207677_10208174 | |||
| 354 | Ga0207639_12012248 | |||
| 355 | Ga0207702_10071617 | |||
| 356 | Ga0207641_10696960 | |||
| 357 | Ga0207641_12021123 | |||
| 358 | Ga0207676_10230814 | |||
| 359 | Ga0207674_10804482 | |||
| 360 | Ga0265330_10123378 | |||
| 361 | Ga0265330_10162929 | |||
| 362 | Ga0265332_10259352 | |||
| 363 | Ga0265325_10240723 | |||
| 364 | Ga0265329_10208897 | |||
| 365 | Ga0265340_10272703 | |||
| 366 | Ga0265339_10252592 | |||
| 367 | Ga0265331_10154215 | |||
| 368 | Ga0265316_10002594 | |||
| 369 | Ga0265316_10032883 | |||
| 370 | Ga0265316_10105474 | |||
| 371 | Ga0265316_10124550 | |||
| 372 | Ga0265316_10160010 | |||
| 373 | Ga0265316_10200971 | |||
| 374 | Ga0265316_10785082 | |||
| 375 | Ga0265316_10885761 | |||
| 376 | Ga0265314_10011604 | |||
| 377 | Ga0265342_10009167 | |||
| 378 | Ga0265342_10411355 | |||
| 379 | Ga0373953_0194245 | |||
| 380 | Ga0373943_0273293 | |||
| 381 | Ga0373943_0362521 | |||
| 382 | Ga0373927_0238949 | |||
| 383 | Ga0373933_0167158 | |||
| 384 | Ga0373947_0024259 | |||
| 385 | Ga0373947_0183862 | |||
| 386 | Ga0373947_0681996 | |||
| 387 | Ga0373937_0709620 | |||
| 388 | Ga0373937_1634309 | |||
| 389 | Ga0373925_0082770 | |||
| 390 | Ga0373925_0357284 | |||
| 391 | Ga0436364_0292238 | |||
| 392 | Ga0436364_0418026 | |||
| 393 | Ga0436364_1069468 | |||
| 394 | Ga0436364_1397517 | |||
| 395 | Ga0436365_0605223 | |||
| 396 | Ga0436365_1524030 | |||
| 397 | Ga0436363_0718663 | |||
| 398 | Ga0466963_0683978 | |||
| 399 | Ga0466959_0324468 | |||
| 400 | Ga0451576_0038722 | |||
| 401 | Ga0451576_0699520 | |||
| 402 | Ga0495592_0294980 | |||
| 403 | Ga0495592_0410153 | |||
| 404 | Ga0495629_0188344 | |||
| 405 | Ga0495651_0012745 | |||
| 406 | Ga0495651_0149049 | |||
| 407 | Ga0495651_0247350 | |||
| 408 | Ga0495580_0001461 | |||
| 409 | Ga0495580_0078908 | |||
| 410 | Ga0495580_0120070 | |||
| 411 | Ga0495580_0389258 | |||
| 412 | Ga0495580_0446545 | |||
| 413 | Ga0495582_0431748 | |||
| 414 | Ga0495582_0537540 | |||
| 415 | Ga0495639_0412374 | |||
| 416 | Ga0495664_0386806 | |||
| 417 | Ga0495664_0502912 | |||
| 418 | Ga0495664_0599312 | |||
| 419 | Ga0495594_0034786 | |||
| 420 | Ga0495594_0104206 | |||
| 421 | Ga0495594_0799394 | |||
| 422 | Ga0495608_0311538 | |||
| 423 | Ga0495628_0038302 | |||
| 424 | Ga0495628_0157398 | |||
| 425 | Ga0495628_0216399 | |||
| 426 | Ga0495628_0260037 | |||
| 427 | Ga0495666_0034215 | |||
| 428 | Ga0495652_0384697 | |||
| 429 | Ga0495665_0057353 | |||
| 430 | Ga0495665_0405366 | |||
| 431 | Ga0495665_0596048 | |||
| 432 | Ga0495587_0312111 | |||
| 433 | Ga0495645_0003783 | |||
| 434 | Ga0495645_0247263 | |||
| 435 | Ga0495645_0444002 | |||
| 436 | Ga0495667_0011804 | |||
| 437 | Ga0495667_0075702 | |||
| 438 | Ga0495667_0115231 | |||
| 439 | Ga0495667_0123834 | |||
| 440 | Ga0495635_0064466 | |||
| 441 | Ga0495599_0115270 | |||
| 442 | Ga0495599_0373688 | |||
| 443 | Ga0495623_0058423 | |||
| 444 | Ga0495623_0221495 | |||
| 445 | Ga0495623_0255383 | |||
| 446 | Ga0495646_0414515 | |||
| 447 | Ga0495613_0120877 | |||
| 448 | Ga0495600_0263996 | |||
| 449 | Ga0495604_0157164 | |||
| 450 | Ga0495604_0656779 | |||
| 451 | Ga0495636_0639503 | |||
| 452 | Ga0495674_0052674 | |||
| 453 | Ga0495674_0053184 | |||
| 454 | Ga0495674_0096781 | |||
| 455 | Ga0495674_0169959 | |||
| 456 | Ga0495674_0371218 | |||
| 457 | Ga0495674_0960650 | |||
| 458 | Ga0495680_0138189 | |||
| 459 | Ga0495680_0522864 | |||
| 460 | Ga0495675_0054879 | |||
| 461 | Ga0495675_0072911 | |||
| 462 | Ga0495675_0083746 | |||
| 463 | Ga0495684_0001380 | |||
| 464 | Ga0495684_0135251 | |||
| 465 | Ga0495684_0275110 | |||
| 466 | Ga0495684_0441054 | |||
| 467 | Ga0495593_0240800 | |||
| 468 | Ga0495602_0013404 | |||
| 469 | Ga0495602_0162197 | |||
| 470 | Ga0495614_0420517 | |||
| 471 | Ga0496102_1121392 | |||
| 472 | Ga0496111_1051077 | |||
| 473 | Ga0496114_0773389 | |||
| 474 | Ga0496115_0435139 | |||
| 475 | Ga0496115_0582796 | |||
| 476 | Ga0496126_0103558 | |||
| 477 | nmdc:mga05p37_1630842_c1 | |||
| 478 | nmdc:mga0qj67_1000414_c1 | |||
| 479 | Ga0495601_0241723 | |||
| 480 | Ga0501082_0000021 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1to0-assembly4.cif.gz_G | x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis | 0.9151 | 1 | 137 |
| 1to0-assembly3.cif.gz_F | x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis | 0.9128 | 1 | 134 |
| 1to0-assembly2.cif.gz_D | x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis | 0.9035 | 1 | 137 |
| 1to0-assembly4.cif.gz_G | x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis | 0.8964 | 1 | 137 |
| 1to0-assembly1.cif.gz_A | x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis | 0.8956 | 1 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1o6dA00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8886 | 1 | 135 | 3.40.1280.10 |
| 1to0F00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8791 | 3 | 134 | 3.40.1280.10 |
| af_I1M9Q9_28_183_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8657 | 1 | 139 | 3.40.1280.10 |
| af_I1M9Q9_28_183_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8598 | 1 | 139 | 3.40.1280.10 |
| 1o6dA00 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8588 | 1 | 135 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q01UR1-F1-model_v4 | Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) | 0.991 | 1 | 139 |
GO:0005737
GO:0070038 |
| AF-A0A2V7QW46-F1-model_v4 | 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH | 0.9639 | 52 | 139 |
GO:0006364
GO:0008168 GO:0032259 |
| AF-A0A7J4K5E6-F1-model_v4 | 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH | 0.9606 | 3 | 139 |
GO:0006364
GO:0008168 GO:0032259 |
| AF-A0A2V7QW46-F1-model_v4 | 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH | 0.9534 | 52 | 139 |
GO:0006364
GO:0008168 GO:0032259 |
| AF-A0A7H4P7X4-F1-model_v4 | LSU m3Psi1915 methyltransferase RlmH /ybeA (EC 2.1.1.177) | 0.9528 | 52 | 134 |
GO:0006364
GO:0008168 GO:0032259 |