F352988

General Info

Members Datasets Scaffolds Average Seq Length
240 141 480 139

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10031176|Ga0265316_100311762
Length 151
Sequence VARRQERRPPARVKIYLYYIGKPKDPHANAMAADFVGRAARYSACEMREIRPDRTDLWDKHPSARKIFLDPAGKAMDSAAFARLIARSEMEGRDLVFLIGGHDGLPPGWAARADQLVSLSAMTFPHELARAMLAEQIYRGFATLRGHPYPR

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.08
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 35.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10031176 3300031344 Bacteria 4362
2 Ga0070658_10215427 3300005327 Bacteria 1623
3 Ga0070683_100610215 3300005329 Unclassified 1044
4 Ga0070670_100365490 3300005331 Unclassified 1269
5 Ga0070670_101218452 3300005331 Unclassified 688
6 Ga0070677_10674024 3300005333 Unclassified 580
7 Ga0068869_101894554 3300005334 Unclassified 534
8 Ga0070682_100788905 3300005337 Unclassified 771
9 Ga0070660_101328295 3300005339 Bacteria 610
10 Ga0070675_100303151 3300005354 Bacteria 1408
11 Ga0070671_100267239 3300005355 Unclassified 1454
12 Ga0070674_100432625 3300005356 Unclassified 1082
13 Ga0070674_101409285 3300005356 Unclassified 624
14 Ga0070673_100424922 3300005364 Unclassified 1192
15 Ga0070709_11430038 3300005434 Unclassified 560
16 Ga0070714_100682606 3300005435 Bacteria 990
17 Ga0070713_100065185 3300005436 Bacteria 3059
18 Ga0070681_10001801 3300005458 Bacteria 19265
19 Ga0070684_100330073 3300005535 Unclassified 1402
20 Ga0070684_100483850 3300005535 Unclassified 1146
21 Ga0070684_101129804 3300005535 Bacteria 736
22 Ga0068853_101780670 3300005539 Unclassified 597
23 Ga0070665_101548036 3300005548 Bacteria 671
24 Ga0070664_100541263 3300005564 Unclassified 1076
25 Ga0068857_100821440 3300005577 Bacteria 888
26 Ga0068856_100141225 3300005614 Unclassified 2415
27 Ga0068859_100341312 3300005617 Bacteria 1592
28 Ga0068859_101223751 3300005617 Unclassified 827
29 Ga0068864_100182457 3300005618 Bacteria 1919
30 Ga0068863_100142954 3300005841 Bacteria 2287
31 Ga0068863_100743032 3300005841 Unclassified 977
32 Ga0068858_100848368 3300005842 Unclassified 892
33 Ga0070717_10531673 3300006028 Bacteria 1064
34 Ga0097621_100124297 3300006237 Bacteria 2191
35 Ga0097621_101331230 3300006237 Unclassified 679
36 Ga0097621_101885894 3300006237 Unclassified 570
37 Ga0068871_100068015 3300006358 Bacteria 2924
38 Ga0068871_100480834 3300006358 Bacteria 1117
39 Ga0068865_100210087 3300006881 Bacteria 1516
40 Ga0068865_101667991 3300006881 Bacteria 574
41 Ga0097620_100341300 3300006931 Bacteria 1592
42 Ga0097620_101223491 3300006931 Unclassified 827
43 Ga0075435_101800650 3300007076 Unclassified 537
44 Ga0105240_10008850 3300009093 Bacteria 14336
45 Ga0105240_10089983 3300009093 Unclassified 3753
46 Ga0111539_11075383 3300009094 Bacteria 935
47 Ga0105245_10447669 3300009098 Bacteria 1299
48 Ga0114129_10913192 3300009147 Bacteria 1112
49 Ga0114129_11255548 3300009147 Unclassified 920
50 Ga0105242_10276590 3300009176 Unclassified 1523
51 Ga0105242_10691727 3300009176 Unclassified 997
52 Ga0105248_10160539 3300009177 Bacteria 2536
53 Ga0105248_11103795 3300009177 Bacteria 897
54 Ga0105237_10066967 3300009545 Unclassified 3585
55 Ga0105237_10450254 3300009545 Bacteria 1293
56 Ga0105238_10120034 3300009551 Bacteria 2609
57 Ga0105239_11764225 3300010375 Unclassified 717
58 Ga0105239_11800458 3300010375 Bacteria 709
59 Ga0105246_11157021 3300011119 Unclassified 710
60 Ga0157370_10878884 3300013104 Bacteria 814
61 Ga0157370_12005236 3300013104 Bacteria 519
62 Ga0157369_10226657 3300013105 Bacteria 1955
63 Ga0157369_10764690 3300013105 Bacteria 993
64 Ga0157374_10458278 3300013296 Viruses 1277
65 Ga0157374_11145486 3300013296 Bacteria 799
66 Ga0157378_11320067 3300013297 Bacteria 763
67 Ga0163162_10783502 3300013306 Unclassified 1072
68 Ga0163162_11015336 3300013306 Unclassified 938
69 Ga0163162_11314588 3300013306 Bacteria 822
70 Ga0163162_11915671 3300013306 Unclassified 679
71 Ga0157372_10503537 3300013307 Bacteria 1412
72 Ga0157375_10115163 3300013308 Unclassified 2791
73 Ga0157375_10305310 3300013308 Bacteria 1755
74 Ga0157375_10643637 3300013308 Bacteria 1217
75 Ga0157375_11778891 3300013308 Bacteria 730
76 Ga0163163_10315457 3300014325 Bacteria 1617
77 Ga0157380_10479637 3300014326 Unclassified 1202
78 Ga0157379_10653391 3300014968 Bacteria 985
79 Ga0157376_10079010 3300014969 Unclassified 2819
80 Ga0157376_10465158 3300014969 Unclassified 1236
81 Ga0163161_11195843 3300017792 Unclassified 657
82 Ga0213876_10139606 3300021384 Unclassified 1289
83 Ga0213875_10019335 3300021388 Bacteria 3276
84 Ga0213875_10076588 3300021388 Bacteria 1561
85 Ga0207682_10087582 3300025893 Bacteria 1345
86 Ga0207692_10376539 3300025898 Bacteria 880
87 Ga0207680_11070965 3300025903 Bacteria 577
88 Ga0207707_10001905 3300025912 Bacteria 18983
89 Ga0207707_10770373 3300025912 Unclassified 803
90 Ga0207695_10002623 3300025913 Bacteria 26311
91 Ga0207695_10005563 3300025913 Bacteria 16641
92 Ga0207660_10231964 3300025917 Bacteria 1451
93 Ga0207660_10323007 3300025917 Unclassified 1233
94 Ga0207662_10405523 3300025918 Bacteria 925
95 Ga0207694_10172071 3300025924 Bacteria 1754
96 Ga0207650_10454218 3300025925 Unclassified 1067
97 Ga0207650_11002317 3300025925 Unclassified 710
98 Ga0207664_10075861 3300025929 Bacteria 2719
99 Ga0207664_10420767 3300025929 Bacteria 1190
100 Ga0207644_10558993 3300025931 Bacteria 948
101 Ga0207686_10330644 3300025934 Unclassified 1142
102 Ga0207670_10232982 3300025936 Bacteria 1415
103 Ga0207670_10254694 3300025936 Unclassified 1358
104 Ga0207691_10517744 3300025940 Bacteria 1012
105 Ga0207711_10110694 3300025941 Bacteria 2442
106 Ga0207711_10544372 3300025941 Unclassified 1083
107 Ga0207711_10830471 3300025941 Bacteria 860
108 Ga0207711_11018284 3300025941 Bacteria 768
109 Ga0207661_10073921 3300025944 Bacteria 2793
110 Ga0207661_10234946 3300025944 Bacteria 1625
111 Ga0207661_10507336 3300025944 Unclassified 1102
112 Ga0207651_10511045 3300025960 Unclassified 1040
113 Ga0207677_10208174 3300026023 Bacteria 1560
114 Ga0207639_12012248 3300026041 Unclassified 539
115 Ga0207702_10071617 3300026078 Unclassified 2985
116 Ga0207641_10696960 3300026088 Unclassified 1000
117 Ga0207641_12021123 3300026088 Bacteria 577
118 Ga0207676_10230814 3300026095 Bacteria 1654
119 Ga0207674_10804482 3300026116 Bacteria 907
120 Ga0265330_10123378 3300031235 Unclassified 1103
121 Ga0265330_10162929 3300031235 Bacteria 947
122 Ga0265332_10259352 3300031238 Bacteria 719
123 Ga0265325_10240723 3300031241 Unclassified 822
124 Ga0265329_10208897 3300031242 Unclassified 644
125 Ga0265340_10272703 3300031247 Bacteria 752
126 Ga0265339_10252592 3300031249 Bacteria 853
127 Ga0265331_10154215 3300031250 Unclassified 1042
128 Ga0265316_10002594 3300031344 Bacteria 18653
129 Ga0265316_10032883 3300031344 Bacteria 4230
130 Ga0265316_10105474 3300031344 Bacteria 2138
131 Ga0265316_10124550 3300031344 Bacteria 1944
132 Ga0265316_10160010 3300031344 Bacteria 1684
133 Ga0265316_10200971 3300031344 Bacteria 1477
134 Ga0265316_10785082 3300031344 Unclassified 668
135 Ga0265316_10885761 3300031344 Bacteria 624
136 Ga0265314_10011604 3300031711 Bacteria 7254
137 Ga0265342_10009167 3300031712 Bacteria 7007
138 Ga0265342_10411355 3300031712 Unclassified 698
139 Ga0373953_0194245 3300035117 Bacteria 877
140 Ga0373943_0273293 3300035170 Unclassified 954
141 Ga0373943_0362521 3300035170 Bacteria 832
142 Ga0373927_0238949 3300035695 Bacteria 1194
143 Ga0373933_0167158 3300035724 Bacteria 1399
144 Ga0373947_0024259 3300035725 Bacteria 3534
145 Ga0373947_0183862 3300035725 Bacteria 1362
146 Ga0373947_0681996 3300035725 Unclassified 701
147 Ga0373937_0709620 3300036401 Bacteria 953
148 Ga0373937_1634309 3300036401 Unclassified 591
149 Ga0373925_0082770 3300037068 Bacteria 2443
150 Ga0373925_0357284 3300037068 Bacteria 1187
151 Ga0436364_0292238 3300037853 Bacteria 830
152 Ga0436364_0418026 3300037853 Bacteria 4516
153 Ga0436364_1069468 3300037853 Unclassified 792
154 Ga0436364_1397517 3300037853 Bacteria 14314
155 Ga0436365_0605223 3300039437 Bacteria 1588
156 Ga0436365_1524030 3300039437 Bacteria 3927
157 Ga0436363_0718663 3300039450 Unclassified 1030
158 Ga0466963_0683978 3300044694 Unclassified 724
159 Ga0466959_0324468 3300045049 Bacteria 1052
160 Ga0451576_0038722 3300045051 Bacteria 5046
161 Ga0451576_0699520 3300045051 Bacteria 1065
162 Ga0495592_0294980 3300046454 Bacteria 1056
163 Ga0495592_0410153 3300046454 Bacteria 856
164 Ga0495629_0188344 3300046459 Unclassified 1429
165 Ga0495651_0012745 3300046462 Bacteria 6490
166 Ga0495651_0149049 3300046462 Bacteria 1689
167 Ga0495651_0247350 3300046462 Bacteria 1220
168 Ga0495580_0001461 3300046472 Bacteria 20727
169 Ga0495580_0078908 3300046472 Bacteria 2296
170 Ga0495580_0120070 3300046472 Bacteria 1825
171 Ga0495580_0389258 3300046472 Bacteria 941
172 Ga0495580_0446545 3300046472 Bacteria 868
173 Ga0495582_0431748 3300046473 Unclassified 760
174 Ga0495582_0537540 3300046473 Bacteria 676
175 Ga0495639_0412374 3300046475 Unclassified 683
176 Ga0495664_0386806 3300046477 Unclassified 841
177 Ga0495664_0502912 3300046477 Bacteria 724
178 Ga0495664_0599312 3300046477 Bacteria 655
179 Ga0495594_0034786 3300046499 Bacteria 2742
180 Ga0495594_0104206 3300046499 Bacteria 1597
181 Ga0495594_0799394 3300046499 Unclassified 532
182 Ga0495608_0311538 3300046511 Unclassified 973
183 Ga0495628_0038302 3300046516 Bacteria 3838
184 Ga0495628_0157398 3300046516 Bacteria 1728
185 Ga0495628_0216399 3300046516 Bacteria 1440
186 Ga0495628_0260037 3300046516 Bacteria 1294
187 Ga0495666_0034215 3300046526 Bacteria 2480
188 Ga0495652_0384697 3300046529 Bacteria 997
189 Ga0495665_0057353 3300046531 Unclassified 2056
190 Ga0495665_0405366 3300046531 Bacteria 691
191 Ga0495665_0596048 3300046531 Unclassified 552
192 Ga0495587_0312111 3300046536 Bacteria 878
193 Ga0495645_0003783 3300046543 Bacteria 10287
194 Ga0495645_0247263 3300046543 Unclassified 1187
195 Ga0495645_0444002 3300046543 Unclassified 819
196 Ga0495667_0011804 3300046559 Bacteria 5917
197 Ga0495667_0075702 3300046559 Bacteria 2190
198 Ga0495667_0115231 3300046559 Bacteria 1736
199 Ga0495667_0123834 3300046559 Bacteria 1669
200 Ga0495635_0064466 3300046663 Bacteria 2515
201 Ga0495599_0115270 3300046678 Bacteria 1672
202 Ga0495599_0373688 3300046678 Unclassified 852
203 Ga0495623_0058423 3300046679 Unclassified 2425
204 Ga0495623_0221495 3300046679 Bacteria 1078
205 Ga0495623_0255383 3300046679 Bacteria 984
206 Ga0495646_0414515 3300046680 Unclassified 699
207 Ga0495613_0120877 3300046689 Bacteria 1881
208 Ga0495600_0263996 3300046809 Unclassified 1093
209 Ga0495604_0157164 3300047317 Unclassified 1609
210 Ga0495604_0656779 3300047317 Bacteria 668
211 Ga0495636_0639503 3300047318 Unclassified 522
212 Ga0495674_0052674 3300047319 Bacteria 3580
213 Ga0495674_0053184 3300047319 Bacteria 3561
214 Ga0495674_0096781 3300047319 Bacteria 2515
215 Ga0495674_0169959 3300047319 Bacteria 1820
216 Ga0495674_0371218 3300047319 Bacteria 1159
217 Ga0495674_0960650 3300047319 Bacteria 657
218 Ga0495680_0138189 3300047322 Unclassified 1785
219 Ga0495680_0522864 3300047322 Bacteria 803
220 Ga0495675_0054879 3300047444 Unclassified 2528
221 Ga0495675_0072911 3300047444 Bacteria 2166
222 Ga0495675_0083746 3300047444 Unclassified 2007
223 Ga0495684_0001380 3300047471 Bacteria 19489
224 Ga0495684_0135251 3300047471 Bacteria 1850
225 Ga0495684_0275110 3300047471 Bacteria 1217
226 Ga0495684_0441054 3300047471 Bacteria 907
227 Ga0495593_0240800 3300047673 Bacteria 906
228 Ga0495602_0013404 3300048088 Bacteria 8379
229 Ga0495602_0162197 3300048088 Bacteria 1744
230 Ga0495614_0420517 3300048089 Unclassified 630
231 Ga0496102_1121392 3300048905 Bacteria 706
232 Ga0496111_1051077 3300048914 Bacteria 582
233 Ga0496114_0773389 3300048917 Unclassified 838
234 Ga0496115_0435139 3300048918 Unclassified 1061
235 Ga0496115_0582796 3300048918 Unclassified 891
236 Ga0496126_0103558 3300048929 Bacteria 2487
237 nmdc:mga05p37_1630842_c1 3300050507 Bacteria 633
238 nmdc:mga0qj67_1000414_c1 3300050509 Bacteria 656
239 Ga0495601_0241723 3300053077 Bacteria 1179
240 Ga0501082_0000021 3300060353 Bacteria 109085
241 Ga0265316_10031176
242 Ga0070658_10215427
243 Ga0070683_100610215
244 Ga0070670_100365490
245 Ga0070670_101218452
246 Ga0070677_10674024
247 Ga0068869_101894554
248 Ga0070682_100788905
249 Ga0070660_101328295
250 Ga0070675_100303151
251 Ga0070671_100267239
252 Ga0070674_100432625
253 Ga0070674_101409285
254 Ga0070673_100424922
255 Ga0070709_11430038
256 Ga0070714_100682606
257 Ga0070713_100065185
258 Ga0070681_10001801
259 Ga0070684_100330073
260 Ga0070684_100483850
261 Ga0070684_101129804
262 Ga0068853_101780670
263 Ga0070665_101548036
264 Ga0070664_100541263
265 Ga0068857_100821440
266 Ga0068856_100141225
267 Ga0068859_100341312
268 Ga0068859_101223751
269 Ga0068864_100182457
270 Ga0068863_100142954
271 Ga0068863_100743032
272 Ga0068858_100848368
273 Ga0070717_10531673
274 Ga0097621_100124297
275 Ga0097621_101331230
276 Ga0097621_101885894
277 Ga0068871_100068015
278 Ga0068871_100480834
279 Ga0068865_100210087
280 Ga0068865_101667991
281 Ga0097620_100341300
282 Ga0097620_101223491
283 Ga0075435_101800650
284 Ga0105240_10008850
285 Ga0105240_10089983
286 Ga0111539_11075383
287 Ga0105245_10447669
288 Ga0114129_10913192
289 Ga0114129_11255548
290 Ga0105242_10276590
291 Ga0105242_10691727
292 Ga0105248_10160539
293 Ga0105248_11103795
294 Ga0105237_10066967
295 Ga0105237_10450254
296 Ga0105238_10120034
297 Ga0105239_11764225
298 Ga0105239_11800458
299 Ga0105246_11157021
300 Ga0157370_10878884
301 Ga0157370_12005236
302 Ga0157369_10226657
303 Ga0157369_10764690
304 Ga0157374_10458278
305 Ga0157374_11145486
306 Ga0157378_11320067
307 Ga0163162_10783502
308 Ga0163162_11015336
309 Ga0163162_11314588
310 Ga0163162_11915671
311 Ga0157372_10503537
312 Ga0157375_10115163
313 Ga0157375_10305310
314 Ga0157375_10643637
315 Ga0157375_11778891
316 Ga0163163_10315457
317 Ga0157380_10479637
318 Ga0157379_10653391
319 Ga0157376_10079010
320 Ga0157376_10465158
321 Ga0163161_11195843
322 Ga0213876_10139606
323 Ga0213875_10019335
324 Ga0213875_10076588
325 Ga0207682_10087582
326 Ga0207692_10376539
327 Ga0207680_11070965
328 Ga0207707_10001905
329 Ga0207707_10770373
330 Ga0207695_10002623
331 Ga0207695_10005563
332 Ga0207660_10231964
333 Ga0207660_10323007
334 Ga0207662_10405523
335 Ga0207694_10172071
336 Ga0207650_10454218
337 Ga0207650_11002317
338 Ga0207664_10075861
339 Ga0207664_10420767
340 Ga0207644_10558993
341 Ga0207686_10330644
342 Ga0207670_10232982
343 Ga0207670_10254694
344 Ga0207691_10517744
345 Ga0207711_10110694
346 Ga0207711_10544372
347 Ga0207711_10830471
348 Ga0207711_11018284
349 Ga0207661_10073921
350 Ga0207661_10234946
351 Ga0207661_10507336
352 Ga0207651_10511045
353 Ga0207677_10208174
354 Ga0207639_12012248
355 Ga0207702_10071617
356 Ga0207641_10696960
357 Ga0207641_12021123
358 Ga0207676_10230814
359 Ga0207674_10804482
360 Ga0265330_10123378
361 Ga0265330_10162929
362 Ga0265332_10259352
363 Ga0265325_10240723
364 Ga0265329_10208897
365 Ga0265340_10272703
366 Ga0265339_10252592
367 Ga0265331_10154215
368 Ga0265316_10002594
369 Ga0265316_10032883
370 Ga0265316_10105474
371 Ga0265316_10124550
372 Ga0265316_10160010
373 Ga0265316_10200971
374 Ga0265316_10785082
375 Ga0265316_10885761
376 Ga0265314_10011604
377 Ga0265342_10009167
378 Ga0265342_10411355
379 Ga0373953_0194245
380 Ga0373943_0273293
381 Ga0373943_0362521
382 Ga0373927_0238949
383 Ga0373933_0167158
384 Ga0373947_0024259
385 Ga0373947_0183862
386 Ga0373947_0681996
387 Ga0373937_0709620
388 Ga0373937_1634309
389 Ga0373925_0082770
390 Ga0373925_0357284
391 Ga0436364_0292238
392 Ga0436364_0418026
393 Ga0436364_1069468
394 Ga0436364_1397517
395 Ga0436365_0605223
396 Ga0436365_1524030
397 Ga0436363_0718663
398 Ga0466963_0683978
399 Ga0466959_0324468
400 Ga0451576_0038722
401 Ga0451576_0699520
402 Ga0495592_0294980
403 Ga0495592_0410153
404 Ga0495629_0188344
405 Ga0495651_0012745
406 Ga0495651_0149049
407 Ga0495651_0247350
408 Ga0495580_0001461
409 Ga0495580_0078908
410 Ga0495580_0120070
411 Ga0495580_0389258
412 Ga0495580_0446545
413 Ga0495582_0431748
414 Ga0495582_0537540
415 Ga0495639_0412374
416 Ga0495664_0386806
417 Ga0495664_0502912
418 Ga0495664_0599312
419 Ga0495594_0034786
420 Ga0495594_0104206
421 Ga0495594_0799394
422 Ga0495608_0311538
423 Ga0495628_0038302
424 Ga0495628_0157398
425 Ga0495628_0216399
426 Ga0495628_0260037
427 Ga0495666_0034215
428 Ga0495652_0384697
429 Ga0495665_0057353
430 Ga0495665_0405366
431 Ga0495665_0596048
432 Ga0495587_0312111
433 Ga0495645_0003783
434 Ga0495645_0247263
435 Ga0495645_0444002
436 Ga0495667_0011804
437 Ga0495667_0075702
438 Ga0495667_0115231
439 Ga0495667_0123834
440 Ga0495635_0064466
441 Ga0495599_0115270
442 Ga0495599_0373688
443 Ga0495623_0058423
444 Ga0495623_0221495
445 Ga0495623_0255383
446 Ga0495646_0414515
447 Ga0495613_0120877
448 Ga0495600_0263996
449 Ga0495604_0157164
450 Ga0495604_0656779
451 Ga0495636_0639503
452 Ga0495674_0052674
453 Ga0495674_0053184
454 Ga0495674_0096781
455 Ga0495674_0169959
456 Ga0495674_0371218
457 Ga0495674_0960650
458 Ga0495680_0138189
459 Ga0495680_0522864
460 Ga0495675_0054879
461 Ga0495675_0072911
462 Ga0495675_0083746
463 Ga0495684_0001380
464 Ga0495684_0135251
465 Ga0495684_0275110
466 Ga0495684_0441054
467 Ga0495593_0240800
468 Ga0495602_0013404
469 Ga0495602_0162197
470 Ga0495614_0420517
471 Ga0496102_1121392
472 Ga0496111_1051077
473 Ga0496114_0773389
474 Ga0496115_0435139
475 Ga0496115_0582796
476 Ga0496126_0103558
477 nmdc:mga05p37_1630842_c1
478 nmdc:mga0qj67_1000414_c1
479 Ga0495601_0241723
480 Ga0501082_0000021

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02590

SPOUT_MTase

Predicted SPOUT methyltransferase

13

150

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1to0-assembly4.cif.gz_G x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.9151 1 137
1to0-assembly3.cif.gz_F x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.9128 1 134
1to0-assembly2.cif.gz_D x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.9035 1 137
1to0-assembly4.cif.gz_G x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.8964 1 137
1to0-assembly1.cif.gz_A x-ray structure of northeast structural genomics target protein sr145 from bacillus subtilis 0.8956 1 137
ID Description Score Start End Superfamily
1o6dA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8886 1 135 3.40.1280.10
1to0F00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8791 3 134 3.40.1280.10
af_I1M9Q9_28_183_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8657 1 139 3.40.1280.10
af_I1M9Q9_28_183_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8598 1 139 3.40.1280.10
1o6dA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8588 1 135 3.40.1280.10
ID Description Score Start End GO Terms
AF-Q01UR1-F1-model_v4 Ribosomal RNA large subunit methyltransferase H (EC 2.1.1.177) (23S rRNA (pseudouridine1915-N3)-methyltransferase) (23S rRNA m3Psi1915 methyltransferase) (rRNA (pseudouridine-N3-)-methyltransferase RlmH) 0.991 1 139 GO:0005737
GO:0070038
AF-A0A2V7QW46-F1-model_v4 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH 0.9639 52 139 GO:0006364
GO:0008168
GO:0032259
AF-A0A7J4K5E6-F1-model_v4 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH 0.9606 3 139 GO:0006364
GO:0008168
GO:0032259
AF-A0A2V7QW46-F1-model_v4 23S rRNA (Pseudouridine(1915)-N(3))-methyltransferase RlmH 0.9534 52 139 GO:0006364
GO:0008168
GO:0032259
AF-A0A7H4P7X4-F1-model_v4 LSU m3Psi1915 methyltransferase RlmH /ybeA (EC 2.1.1.177) 0.9528 52 134 GO:0006364
GO:0008168
GO:0032259

Map