F352645

General Info

Members Datasets Scaffolds Average Seq Length
240 142 240 170

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100131564|Ga0070706_1001315641
Length 193
Sequence VSSAQGQSAHRPLEGQKVAVRALPAPPSRGSEVVGEIARYLGAVSILSVGAVHAQQYYGAYFSVVPTIGTLFLLSFIGSGVVGTVLLAPVRRLRRNVADLILVLAALGAIAIXXXXLASLLVSEYTPLFGFMESGYRLAIVLALVFDALTTVFLGLFVLMVLRQRRHQEANGAFSGTAIDLKARQTITTERNP

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
71 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
97 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
140 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
141 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.83
Rhizosphere 89.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100017385 3300005336 Bacteria 5671
2 Ga0070660_100000345 3300005339 Bacteria 30972
3 Ga0070659_100005460 3300005366 Bacteria 9134
4 Ga0070709_10004260 3300005434 Bacteria 7717
5 Ga0070709_10035200 3300005434 Unclassified 3042
6 Ga0070709_10729752 3300005434 Unclassified 773
7 Ga0070714_100069295 3300005435 Bacteria 3045
8 Ga0070714_100362219 3300005435 Bacteria 1363
9 Ga0070714_101164918 3300005435 Unclassified 752
10 Ga0070714_101456593 3300005435 Unclassified 669
11 Ga0070713_100154748 3300005436 Unclassified 2042
12 Ga0070710_10199428 3300005437 Bacteria 1263
13 Ga0070711_100009378 3300005439 Bacteria 6028
14 Ga0070705_100193613 3300005440 Bacteria 1388
15 Ga0070694_100927115 3300005444 Unclassified 720
16 Ga0070708_100047125 3300005445 Bacteria 3806
17 Ga0070708_100092411 3300005445 Bacteria 2757
18 Ga0070708_100107599 3300005445 Bacteria 2560
19 Ga0070708_100444594 3300005445 Bacteria 1223
20 Ga0070678_100671491 3300005456 Unclassified 931
21 Ga0070681_10034162 3300005458 Bacteria 5107
22 Ga0070706_100131564 3300005467 Unclassified 2335
23 Ga0070706_100241274 3300005467 Bacteria 1687
24 Ga0070706_100318021 3300005467 Unclassified 1452
25 Ga0070707_100000511 3300005468 Bacteria 38643
26 Ga0070707_100024054 3300005468 Bacteria 5766
27 Ga0070707_100254265 3300005468 Unclassified 1710
28 Ga0070707_100311185 3300005468 Unclassified 1531
29 Ga0070707_100948075 3300005468 Bacteria 825
30 Ga0070698_100011375 3300005471 Bacteria 9446
31 Ga0070698_100031511 3300005471 Bacteria 5497
32 Ga0070698_100066808 3300005471 Bacteria 3617
33 Ga0070698_100171007 3300005471 Bacteria 2114
34 Ga0070698_100198064 3300005471 Bacteria 1945
35 Ga0070699_100194918 3300005518 Unclassified 1800
36 Ga0070699_100240845 3300005518 Bacteria 1615
37 Ga0070699_100352529 3300005518 Bacteria 1326
38 Ga0070679_100042975 3300005530 Bacteria 4501
39 Ga0070697_100195262 3300005536 Unclassified 1719
40 Ga0070697_100237577 3300005536 Unclassified 1555
41 Ga0070697_100811896 3300005536 Bacteria 828
42 Ga0070695_100400180 3300005545 Unclassified 1041
43 Ga0070696_100323070 3300005546 Bacteria 1188
44 Ga0070704_100198541 3300005549 Unclassified 1618
45 Ga0068855_100024342 3300005563 Bacteria 7245
46 Ga0070717_10044649 3300006028 Bacteria 3620
47 Ga0070717_10322464 3300006028 Bacteria 1376
48 Ga0070715_10003275 3300006163 Bacteria 5115
49 Ga0070716_100000925 3300006173 Bacteria 12711
50 Ga0070716_100095380 3300006173 Unclassified 1811
51 Ga0070716_100230156 3300006173 Bacteria 1251
52 Ga0070716_101088350 3300006173 Bacteria 637
53 Ga0070712_100175344 3300006175 Bacteria 1667
54 Ga0070712_100732597 3300006175 Unclassified 845
55 Ga0070712_101272138 3300006175 Bacteria 641
56 Ga0068871_100631566 3300006358 Bacteria 976
57 Ga0075431_100004462 3300006847 Bacteria 13731
58 Ga0075433_10013703 3300006852 Bacteria 6602
59 Ga0075433_10026816 3300006852 Bacteria 4882
60 Ga0075433_10263715 3300006852 Bacteria 1527
61 Ga0075433_10605568 3300006852 Unclassified 962
62 Ga0075434_100046419 3300006871 Bacteria 4311
63 Ga0075434_100123796 3300006871 Bacteria 2602
64 Ga0075434_100339585 3300006871 Unclassified 1523
65 Ga0075434_100774704 3300006871 Bacteria 976
66 Ga0068865_100314662 3300006881 Unclassified 1257
67 Ga0075436_100019080 3300006914 Bacteria 4698
68 Ga0075436_100019618 3300006914 Bacteria 4634
69 Ga0075436_100434103 3300006914 Unclassified 955
70 Ga0075435_100001128 3300007076 Bacteria 17036
71 Ga0075435_100087665 3300007076 Bacteria 2565
72 Ga0075435_100111648 3300007076 Bacteria 2274
73 Ga0075435_100271179 3300007076 Bacteria 1447
74 Ga0075435_100805921 3300007076 Unclassified 818
75 Ga0105245_10248812 3300009098 Unclassified 1726
76 Ga0105245_11162537 3300009098 Bacteria 819
77 Ga0114129_10016812 3300009147 Bacteria 10413
78 Ga0114129_10020943 3300009147 Bacteria 9288
79 Ga0114129_10511006 3300009147 Unclassified 1568
80 Ga0114129_10611544 3300009147 Bacteria 1411
81 Ga0105241_11152052 3300009174 Unclassified 732
82 Ga0105242_10125857 3300009176 Unclassified 2205
83 Ga0105238_10379491 3300009551 Bacteria 1405
84 Ga0157369_10712111 3300013105 Bacteria 1033
85 Ga0157378_11512225 3300013297 Unclassified 716
86 Ga0182008_10427735 3300014497 Bacteria 716
87 Ga0157377_10450157 3300014745 Bacteria 889
88 Ga0207692_10005914 3300025898 Bacteria 4935
89 Ga0207692_10424809 3300025898 Unclassified 833
90 Ga0207685_10046915 3300025905 Unclassified 1647
91 Ga0207699_10672395 3300025906 Unclassified 757
92 Ga0207684_10032465 3300025910 Unclassified 4439
93 Ga0207684_10138390 3300025910 Unclassified 2092
94 Ga0207684_10425525 3300025910 Bacteria 1141
95 Ga0207684_10448342 3300025910 Bacteria 1108
96 Ga0207654_10913041 3300025911 Unclassified 637
97 Ga0207707_10087182 3300025912 Unclassified 2727
98 Ga0207693_10001096 3300025915 Bacteria 24353
99 Ga0207693_10157487 3300025915 Bacteria 1786
100 Ga0207693_10621173 3300025915 Unclassified 840
101 Ga0207663_10002135 3300025916 Bacteria 9434
102 Ga0207663_10165680 3300025916 Bacteria 1565
103 Ga0207660_10360572 3300025917 Bacteria 1166
104 Ga0207657_10000874 3300025919 Bacteria 31807
105 Ga0207652_10019256 3300025921 Bacteria 5611
106 Ga0207646_10005572 3300025922 Bacteria 13220
107 Ga0207646_10005691 3300025922 Bacteria 13071
108 Ga0207646_10148432 3300025922 Unclassified 2114
109 Ga0207646_10289278 3300025922 Unclassified 1481
110 Ga0207646_10409565 3300025922 Bacteria 1224
111 Ga0207694_10513771 3300025924 Bacteria 1004
112 Ga0207687_10020351 3300025927 Bacteria 4401
113 Ga0207687_10701912 3300025927 Unclassified 859
114 Ga0207700_10219889 3300025928 Bacteria 1610
115 Ga0207700_10820153 3300025928 Unclassified 832
116 Ga0207664_10041071 3300025929 Bacteria 3602
117 Ga0207664_10300219 3300025929 Bacteria 1413
118 Ga0207664_10448610 3300025929 Bacteria 1151
119 Ga0207664_10629976 3300025929 Bacteria 963
120 Ga0207644_10039667 3300025931 Bacteria 3325
121 Ga0207690_10023161 3300025932 Bacteria 3873
122 Ga0207686_10068954 3300025934 Bacteria 2267
123 Ga0207686_10825454 3300025934 Bacteria 744
124 Ga0207704_10166131 3300025938 Unclassified 1577
125 Ga0207665_10000856 3300025939 Bacteria 20555
126 Ga0207665_10009578 3300025939 Bacteria 6361
127 Ga0207665_10303264 3300025939 Unclassified 1194
128 Ga0207665_10331828 3300025939 Bacteria 1144
129 Ga0207665_10351156 3300025939 Bacteria 1113
130 Ga0207711_10482906 3300025941 Bacteria 1154
131 Ga0207667_10047093 3300025949 Bacteria 4565
132 Ga0207702_10171524 3300026078 Bacteria 1990
133 Ga0207683_10059765 3300026121 Unclassified 3349
134 Ga0207428_10382107 3300027907 Bacteria 1033
135 Ga0373944_0014687 3300035089 Bacteria 2189
136 Ga0373945_0033135 3300035116 Bacteria 1834
137 Ga0373943_0051847 3300035170 Bacteria 2021
138 Ga0373946_0012302 3300035171 Bacteria 3201
139 Ga0373931_0491109 3300035691 Bacteria 790
140 Ga0373935_0038731 3300035692 Bacteria 2986
141 Ga0373927_0204953 3300035695 Bacteria 1295
142 Ga0373933_0472277 3300035724 Bacteria 821
143 Ga0373947_0004052 3300035725 Bacteria 8620
144 Ga0373937_0147714 3300036401 Bacteria 2201
145 Ga0373937_0283552 3300036401 Bacteria 1564
146 Ga0373937_1306927 3300036401 Bacteria 673
147 Ga0373925_0011456 3300037068 Bacteria 6419
148 Ga0395900_0275651 3300037418 Bacteria 1676
149 Ga0466967_0000076 3300045976 Bacteria 36156
150 Ga0495592_0179357 3300046454 Unclassified 1444
151 Ga0495592_0208258 3300046454 Bacteria 1315
152 Ga0495629_0000079 3300046459 Bacteria 85673
153 Ga0495641_0080479 3300046461 Bacteria 1459
154 Ga0495653_0031993 3300046463 Unclassified 4180
155 Ga0495653_0179623 3300046463 Bacteria 1454
156 Ga0495653_0878678 3300046463 Bacteria 535
157 Ga0495582_0009345 3300046473 Bacteria 5402
158 Ga0495582_0058930 3300046473 Bacteria 2118
159 Ga0495662_0000357 3300046476 Bacteria 20066
160 Ga0495584_0028831 3300046491 Unclassified 2814
161 Ga0495594_0433204 3300046499 Unclassified 748
162 Ga0495608_0026133 3300046511 Bacteria 3983
163 Ga0495608_0459022 3300046511 Bacteria 774
164 Ga0495628_0215464 3300046516 Bacteria 1443
165 Ga0495630_0219167 3300046517 Bacteria 1452
166 Ga0495666_0029812 3300046526 Bacteria 2683
167 Ga0495652_0042596 3300046529 Bacteria 3914
168 Ga0495665_0089558 3300046531 Bacteria 1617
169 Ga0495640_0011298 3300046533 Bacteria 6874
170 Ga0495587_0319668 3300046536 Bacteria 867
171 Ga0495667_0007074 3300046559 Bacteria 7614
172 Ga0495668_0297899 3300046616 Unclassified 884
173 Ga0495634_0082943 3300046642 Bacteria 2093
174 Ga0495635_0019979 3300046663 Bacteria 4668
175 Ga0495599_0154729 3300046678 Bacteria 1419
176 Ga0495599_0403531 3300046678 Unclassified 814
177 Ga0495647_0044412 3300046681 Bacteria 1704
178 Ga0495658_0002080 3300046683 Bacteria 10148
179 Ga0495658_0125510 3300046683 Bacteria 1557
180 Ga0495613_0005986 3300046689 Bacteria 9102
181 Ga0495624_0008116 3300046690 Bacteria 7349
182 Ga0495600_0097848 3300046809 Bacteria 1913
183 Ga0495581_0004661 3300047315 Bacteria 7919
184 Ga0495581_0140084 3300047315 Bacteria 1411
185 Ga0495604_0060790 3300047317 Bacteria 2892
186 Ga0495676_0016386 3300047321 Bacteria 6582
187 Ga0495676_0433032 3300047321 Unclassified 869
188 Ga0495680_0011414 3300047322 Bacteria 7865
189 Ga0495680_0030932 3300047322 Bacteria 4362
190 Ga0495684_0017532 3300047471 Bacteria 5513
191 Ga0495684_0103065 3300047471 Unclassified 2157
192 Ga0495684_0318209 3300047471 Bacteria 1113
193 Ga0495593_0009147 3300047673 Bacteria 5747
194 Ga0495602_0246640 3300048088 Bacteria 1333
195 Ga0496100_0000411 3300048903 Bacteria 20683
196 Ga0496101_0000767 3300048904 Bacteria 19022
197 Ga0496101_0122058 3300048904 Bacteria 1970
198 Ga0496102_0159540 3300048905 Bacteria 2121
199 Ga0496102_0294147 3300048905 Bacteria 1530
200 Ga0496103_0103787 3300048906 Unclassified 1801
201 Ga0496103_0152711 3300048906 Bacteria 1479
202 Ga0496104_0001579 3300048907 Bacteria 19611
203 Ga0496104_0518645 3300048907 Bacteria 1103
204 Ga0496105_0002338 3300048908 Bacteria 13742
205 Ga0496106_0002962 3300048909 Bacteria 12632
206 Ga0496107_0004456 3300048910 Bacteria 9495
207 Ga0496107_0084347 3300048910 Bacteria 2318
208 Ga0496108_0058746 3300048911 Bacteria 3233
209 Ga0496109_0000791 3300048912 Bacteria 26324
210 Ga0496110_0027920 3300048913 Bacteria 4842
211 Ga0496110_0043958 3300048913 Bacteria 3901
212 Ga0496111_0297602 3300048914 Bacteria 1196
213 Ga0496111_0501111 3300048914 Bacteria 894
214 Ga0496112_0010714 3300048915 Bacteria 8334
215 Ga0496113_0073378 3300048916 Bacteria 2607
216 Ga0496114_0022178 3300048917 Bacteria 5172
217 Ga0496114_0400388 3300048917 Unclassified 1215
218 Ga0496115_0001152 3300048918 Bacteria 19108
219 Ga0496115_0060625 3300048918 Bacteria 3049
220 Ga0496115_1020253 3300048918 Bacteria 631
221 nmdc:mga05p37_106196_c1 3300050507 Bacteria 3454
222 nmdc:mga05p37_37636_c1 3300050507 Bacteria 5933
223 nmdc:mga05p37_828374_c1 3300050507 Unclassified 1008
224 nmdc:mga06r32_505707_c1 3300050510 Bacteria 1185
225 nmdc:mga0n895_1148989_c1 3300050512 Unclassified 752
226 nmdc:mga0n895_29343_c1 3300050512 Bacteria 5245
227 nmdc:mga0n895_379946_c1 3300050512 Bacteria 1430
228 nmdc:mga0rr50_91001_c1 3300050513 Bacteria 2375
229 nmdc:mga08x19_1045769_c1 3300050514 Bacteria 580
230 nmdc:mga0a205_190125_c1 3300050515 Bacteria 1945
231 nmdc:mga0a205_19491_c1 3300050515 Bacteria 6396
232 nmdc:mga0a205_87687_c1 3300050515 Bacteria 3006
233 Ga0495601_0007902 3300053077 Bacteria 6264
234 Ga0495612_0228575 3300053078 Bacteria 825
235 Ga0495655_0138678 3300053083 Unclassified 755
236 Ga0495595_0012041 3300053084 Unclassified 3627
237 Ga0495595_0123321 3300053084 Bacteria 1263
238 Ga0495619_0006173 3300053085 Bacteria 7592
239 Ga0495619_0078179 3300053085 Bacteria 2224
240 Ga0495619_0244528 3300053085 Bacteria 1243

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0878678 Ga0495653_0878678_22_474 123
2 3300009147 Ga0114129_10020943 Ga0114129_100209434 137
3 3300005435 Ga0070714_101456593 Ga0070714_1014565931 147
4 3300005445 Ga0070708_100107599 Ga0070708_1001075994 147
5 3300005471 Ga0070698_100031511 Ga0070698_1000315114 147
6 3300005518 Ga0070699_100194918 Ga0070699_1001949182 147
7 3300006173 Ga0070716_101088350 Ga0070716_1010883501 147
8 3300006871 Ga0075434_100339585 Ga0075434_1003395852 147
9 3300025910 Ga0207684_10425525 Ga0207684_104255252 147
10 3300035695 Ga0373927_0204953 Ga0373927_0204953_500_1027 147
11 3300048907 Ga0496104_0518645 Ga0496104_0518645_489_1013 147
12 3300048918 Ga0496115_0060625 Ga0496115_0060625_45_593 147
13 3300006173 Ga0070716_100095380 Ga0070716_1000953803 148
14 3300025939 Ga0207665_10009578 Ga0207665_100095786 148
15 3300045976 Ga0466967_0000076 Ga0466967_0000076_21076_21558 148
16 3300005434 Ga0070709_10729752 Ga0070709_107297522 149
17 3300005518 Ga0070699_100352529 Ga0070699_1003525292 150
18 3300009098 Ga0105245_10248812 Ga0105245_102488123 150
19 3300009147 Ga0114129_10511006 Ga0114129_105110063 150
20 3300009147 Ga0114129_10611544 Ga0114129_106115441 150
21 3300009176 Ga0105242_10125857 Ga0105242_101258573 150
22 3300014745 Ga0157377_10450157 Ga0157377_104501572 150
23 3300036401 Ga0373937_0147714 Ga0373937_0147714_1092_1565 150
24 3300036401 Ga0373937_0283552 Ga0373937_0283552_840_1313 150
25 3300036401 Ga0373937_1306927 Ga0373937_1306927_20_493 150
26 3300046454 Ga0495592_0179357 Ga0495592_0179357_322_795 150
27 3300046491 Ga0495584_0028831 Ga0495584_0028831_1826_2299 150
28 3300046499 Ga0495594_0433204 Ga0495594_0433204_110_583 150
29 3300046511 Ga0495608_0026133 Ga0495608_0026133_385_858 150
30 3300046516 Ga0495628_0215464 Ga0495628_0215464_363_836 150
31 3300046536 Ga0495587_0319668 Ga0495587_0319668_236_709 150
32 3300046616 Ga0495668_0297899 Ga0495668_0297899_400_873 150
33 3300046678 Ga0495599_0154729 Ga0495599_0154729_855_1328 150
34 3300046809 Ga0495600_0097848 Ga0495600_0097848_240_713 150
35 3300047317 Ga0495604_0060790 Ga0495604_0060790_1779_2252 150
36 3300047322 Ga0495680_0030932 Ga0495680_0030932_3475_3948 150
37 3300047471 Ga0495684_0318209 Ga0495684_0318209_231_704 150
38 3300048088 Ga0495602_0246640 Ga0495602_0246640_713_1186 150
39 3300048904 Ga0496101_0122058 Ga0496101_0122058_525_998 150
40 3300048905 Ga0496102_0159540 Ga0496102_0159540_47_520 150
41 3300048906 Ga0496103_0103787 Ga0496103_0103787_1213_1686 150
42 3300048910 Ga0496107_0084347 Ga0496107_0084347_968_1441 150
43 3300048917 Ga0496114_0400388 Ga0496114_0400388_50_523 150
44 3300048918 Ga0496115_1020253 Ga0496115_1020253_104_577 150
45 3300050507 nmdc:mga05p37_37636_c1 nmdc:mga05p37_37636_c1_4881_5354 150
46 3300050507 nmdc:mga05p37_828374_c1 nmdc:mga05p37_828374_c1_216_689 150
47 3300050510 nmdc:mga06r32_505707_c1 nmdc:mga06r32_505707_c1_26_499 150
48 3300050512 nmdc:mga0n895_379946_c1 nmdc:mga0n895_379946_c1_363_836 150
49 3300050515 nmdc:mga0a205_190125_c1 nmdc:mga0a205_190125_c1_1038_1511 150
50 3300053083 Ga0495655_0138678 Ga0495655_0138678_25_498 150
51 3300053084 Ga0495595_0123321 Ga0495595_0123321_729_1202 150
52 3300053085 Ga0495619_0078179 Ga0495619_0078179_854_1327 150
53 3300009147 Ga0114129_10016812 Ga0114129_100168129 151
54 3300050507 nmdc:mga05p37_106196_c1 nmdc:mga05p37_106196_c1_2328_2813 151
55 3300014497 Ga0182008_10427735 Ga0182008_104277352 154
56 3300048915 Ga0496112_0010714 Ga0496112_0010714_2003_2485 154
57 3300037418 Ga0395900_0275651 Ga0395900_0275651_1032_1508 156
58 3300050514 nmdc:mga08x19_1045769_c1 nmdc:mga08x19_1045769_c1_21_506 156
59 3300050515 nmdc:mga0a205_87687_c1 nmdc:mga0a205_87687_c1_2007_2492 156
60 3300005434 Ga0070709_10004260 Ga0070709_100042603 157
61 3300005436 Ga0070713_100154748 Ga0070713_1001547482 157
62 3300005439 Ga0070711_100009378 Ga0070711_1000093783 157
63 3300005456 Ga0070678_100671491 Ga0070678_1006714911 157
64 3300005468 Ga0070707_100254265 Ga0070707_1002542653 157
65 3300005549 Ga0070704_100198541 Ga0070704_1001985412 157
66 3300006028 Ga0070717_10044649 Ga0070717_100446493 157
67 3300006163 Ga0070715_10003275 Ga0070715_100032757 157
68 3300006173 Ga0070716_100000925 Ga0070716_1000009259 157
69 3300009098 Ga0105245_11162537 Ga0105245_111625372 157
70 3300009174 Ga0105241_11152052 Ga0105241_111520522 157
71 3300013297 Ga0157378_11512225 Ga0157378_115122251 157
72 3300025898 Ga0207692_10005914 Ga0207692_100059145 157
73 3300025905 Ga0207685_10046915 Ga0207685_100469152 157
74 3300025915 Ga0207693_10001096 Ga0207693_100010966 157
75 3300025916 Ga0207663_10002135 Ga0207663_100021355 157
76 3300025928 Ga0207700_10820153 Ga0207700_108201531 157
77 3300025929 Ga0207664_10041071 Ga0207664_100410714 157
78 3300025931 Ga0207644_10039667 Ga0207644_100396673 157
79 3300025939 Ga0207665_10000856 Ga0207665_1000085617 157
80 3300035691 Ga0373931_0491109 Ga0373931_0491109_108_599 157
81 3300048903 Ga0496100_0000411 Ga0496100_0000411_19486_19977 157
82 3300048904 Ga0496101_0000767 Ga0496101_0000767_17822_18313 157
83 3300048905 Ga0496102_0294147 Ga0496102_0294147_349_840 157
84 3300048906 Ga0496103_0152711 Ga0496103_0152711_587_1078 157
85 3300048907 Ga0496104_0001579 Ga0496104_0001579_7787_8278 157
86 3300048908 Ga0496105_0002338 Ga0496105_0002338_705_1196 157
87 3300048909 Ga0496106_0002962 Ga0496106_0002962_4698_5189 157
88 3300048910 Ga0496107_0004456 Ga0496107_0004456_822_1313 157
89 3300048911 Ga0496108_0058746 Ga0496108_0058746_2081_2572 157
90 3300048912 Ga0496109_0000791 Ga0496109_0000791_16007_16498 157
91 3300048913 Ga0496110_0027920 Ga0496110_0027920_3684_4175 157
92 3300048913 Ga0496110_0043958 Ga0496110_0043958_774_1271 157
93 3300048914 Ga0496111_0297602 Ga0496111_0297602_637_1128 157
94 3300048916 Ga0496113_0073378 Ga0496113_0073378_1491_1982 157
95 3300048917 Ga0496114_0022178 Ga0496114_0022178_4005_4496 157
96 3300048918 Ga0496115_0001152 Ga0496115_0001152_11348_11839 157
97 3300005468 Ga0070707_100024054 Ga0070707_1000240545 158
98 3300005471 Ga0070698_100171007 Ga0070698_1001710072 158
99 3300025922 Ga0207646_10289278 Ga0207646_102892782 158
100 3300035724 Ga0373933_0472277 Ga0373933_0472277_211_735 158
101 3300005545 Ga0070695_100400180 Ga0070695_1004001801 159
102 3300046683 Ga0495658_0125510 Ga0495658_0125510_550_1095 160
103 3300005440 Ga0070705_100193613 Ga0070705_1001936133 162
104 3300005536 Ga0070697_100811896 Ga0070697_1008118961 162
105 3300006852 Ga0075433_10263715 Ga0075433_102637152 162
106 3300048914 Ga0496111_0501111 Ga0496111_0501111_181_696 162
107 3300005467 Ga0070706_100241274 Ga0070706_1002412742 163
108 3300006175 Ga0070712_101272138 Ga0070712_1012721382 163
109 3300006852 Ga0075433_10013703 Ga0075433_100137034 163
110 3300006871 Ga0075434_100046419 Ga0075434_1000464196 163
111 3300007076 Ga0075435_100087665 Ga0075435_1000876654 163
112 3300007076 Ga0075435_100805921 Ga0075435_1008059211 163
113 3300027907 Ga0207428_10382107 Ga0207428_103821072 163
114 3300050512 nmdc:mga0n895_1148989_c1 nmdc:mga0n895_1148989_c1_104_631 163
115 3300050512 nmdc:mga0n895_29343_c1 nmdc:mga0n895_29343_c1_2063_2584 163
116 3300050513 nmdc:mga0rr50_91001_c1 nmdc:mga0rr50_91001_c1_595_1116 163
117 3300050515 nmdc:mga0a205_19491_c1 nmdc:mga0a205_19491_c1_4414_4935 163
118 3300005445 Ga0070708_100444594 Ga0070708_1004445942 164
119 3300005546 Ga0070696_100323070 Ga0070696_1003230702 164
120 3300006175 Ga0070712_100175344 Ga0070712_1001753443 164
121 3300025915 Ga0207693_10157487 Ga0207693_101574873 164
122 3300025922 Ga0207646_10409565 Ga0207646_104095652 164
123 3300005468 Ga0070707_100311185 Ga0070707_1003111852 165
124 3300005518 Ga0070699_100240845 Ga0070699_1002408452 165
125 3300007076 Ga0075435_100111648 Ga0075435_1001116484 165
126 3300025910 Ga0207684_10448342 Ga0207684_104483422 165
127 3300005445 Ga0070708_100047125 Ga0070708_1000471253 166
128 3300005468 Ga0070707_100948075 Ga0070707_1009480751 166
129 3300046454 Ga0495592_0208258 Ga0495592_0208258_210_731 166
130 3300046463 Ga0495653_0179623 Ga0495653_0179623_68_589 166
131 3300046473 Ga0495582_0058930 Ga0495582_0058930_347_895 166
132 3300046529 Ga0495652_0042596 Ga0495652_0042596_732_1253 166
133 3300046678 Ga0495599_0403531 Ga0495599_0403531_166_687 166
134 3300047315 Ga0495581_0140084 Ga0495581_0140084_166_714 166
135 3300047321 Ga0495676_0433032 Ga0495676_0433032_124_672 166
136 3300047471 Ga0495684_0103065 Ga0495684_0103065_670_1191 166
137 3300053077 Ga0495601_0007902 Ga0495601_0007902_1212_1733 166
138 3300053085 Ga0495619_0244528 Ga0495619_0244528_175_696 166
139 3300005435 Ga0070714_100362219 Ga0070714_1003622192 167
140 3300006028 Ga0070717_10322464 Ga0070717_103224642 167
141 3300025929 Ga0207664_10300219 Ga0207664_103002192 167
142 3300005434 Ga0070709_10035200 Ga0070709_100352003 168
143 3300005435 Ga0070714_100069295 Ga0070714_1000692953 168
144 3300005435 Ga0070714_101164918 Ga0070714_1011649181 168
145 3300005445 Ga0070708_100092411 Ga0070708_1000924113 168
146 3300005467 Ga0070706_100131564 Ga0070706_1001315641 168
147 3300005467 Ga0070706_100318021 Ga0070706_1003180212 168
148 3300005468 Ga0070707_100000511 Ga0070707_10000051125 168
149 3300005471 Ga0070698_100011375 Ga0070698_1000113755 168
150 3300005471 Ga0070698_100198064 Ga0070698_1001980642 168
151 3300006175 Ga0070712_100732597 Ga0070712_1007325972 168
152 3300006358 Ga0068871_100631566 Ga0068871_1006315661 168
153 3300006847 Ga0075431_100004462 Ga0075431_10000446212 168
154 3300006852 Ga0075433_10026816 Ga0075433_100268164 168
155 3300006852 Ga0075433_10605568 Ga0075433_106055681 168
156 3300006871 Ga0075434_100123796 Ga0075434_1001237963 168
157 3300006914 Ga0075436_100019080 Ga0075436_1000190804 168
158 3300007076 Ga0075435_100271179 Ga0075435_1002711793 168
159 3300025898 Ga0207692_10424809 Ga0207692_104248092 168
160 3300025906 Ga0207699_10672395 Ga0207699_106723952 168
161 3300025910 Ga0207684_10032465 Ga0207684_100324653 168
162 3300025910 Ga0207684_10138390 Ga0207684_101383903 168
163 3300025916 Ga0207663_10165680 Ga0207663_101656803 168
164 3300025922 Ga0207646_10005691 Ga0207646_100056915 168
165 3300025927 Ga0207687_10020351 Ga0207687_100203514 168
166 3300025929 Ga0207664_10448610 Ga0207664_104486102 168
167 3300025929 Ga0207664_10629976 Ga0207664_106299761 168
168 3300025934 Ga0207686_10825454 Ga0207686_108254542 168
169 3300005336 Ga0070680_100017385 Ga0070680_1000173854 169
170 3300005339 Ga0070660_100000345 Ga0070660_10000034516 169
171 3300005366 Ga0070659_100005460 Ga0070659_1000054603 169
172 3300005437 Ga0070710_10199428 Ga0070710_101994281 169
173 3300005444 Ga0070694_100927115 Ga0070694_1009271152 169
174 3300005458 Ga0070681_10034162 Ga0070681_100341622 169
175 3300005471 Ga0070698_100066808 Ga0070698_1000668084 169
176 3300005530 Ga0070679_100042975 Ga0070679_1000429752 169
177 3300005536 Ga0070697_100195262 Ga0070697_1001952622 169
178 3300005536 Ga0070697_100237577 Ga0070697_1002375772 169
179 3300005563 Ga0068855_100024342 Ga0068855_1000243427 169
180 3300006173 Ga0070716_100230156 Ga0070716_1002301562 169
181 3300006871 Ga0075434_100774704 Ga0075434_1007747042 169
182 3300006881 Ga0068865_100314662 Ga0068865_1003146622 169
183 3300006914 Ga0075436_100019618 Ga0075436_1000196183 169
184 3300006914 Ga0075436_100434103 Ga0075436_1004341032 169
185 3300007076 Ga0075435_100001128 Ga0075435_1000011284 169
186 3300009551 Ga0105238_10379491 Ga0105238_103794913 169
187 3300013105 Ga0157369_10712111 Ga0157369_107121112 169
188 3300025911 Ga0207654_10913041 Ga0207654_109130411 169
189 3300025912 Ga0207707_10087182 Ga0207707_100871823 169
190 3300025915 Ga0207693_10621173 Ga0207693_106211732 169
191 3300025917 Ga0207660_10360572 Ga0207660_103605722 169
192 3300025919 Ga0207657_10000874 Ga0207657_1000087416 169
193 3300025921 Ga0207652_10019256 Ga0207652_100192562 169
194 3300025922 Ga0207646_10005572 Ga0207646_1000557216 169
195 3300025922 Ga0207646_10148432 Ga0207646_101484323 169
196 3300025924 Ga0207694_10513771 Ga0207694_105137711 169
197 3300025927 Ga0207687_10701912 Ga0207687_107019121 169
198 3300025928 Ga0207700_10219889 Ga0207700_102198891 169
199 3300025932 Ga0207690_10023161 Ga0207690_100231613 169
200 3300025934 Ga0207686_10068954 Ga0207686_100689543 169
201 3300025938 Ga0207704_10166131 Ga0207704_101661313 169
202 3300025939 Ga0207665_10303264 Ga0207665_103032641 169
203 3300025939 Ga0207665_10331828 Ga0207665_103318282 169
204 3300025939 Ga0207665_10351156 Ga0207665_103511562 169
205 3300025941 Ga0207711_10482906 Ga0207711_104829062 169
206 3300025949 Ga0207667_10047093 Ga0207667_100470935 169
207 3300026078 Ga0207702_10171524 Ga0207702_101715242 169
208 3300026121 Ga0207683_10059765 Ga0207683_100597651 169
209 3300035089 Ga0373944_0014687 Ga0373944_0014687_1502_2035 169
210 3300035116 Ga0373945_0033135 Ga0373945_0033135_198_731 169
211 3300035170 Ga0373943_0051847 Ga0373943_0051847_1326_1859 169
212 3300035171 Ga0373946_0012302 Ga0373946_0012302_37_570 169
213 3300035692 Ga0373935_0038731 Ga0373935_0038731_2266_2799 169
214 3300035725 Ga0373947_0004052 Ga0373947_0004052_8000_8533 169
215 3300037068 Ga0373925_0011456 Ga0373925_0011456_4112_4645 169
216 3300046459 Ga0495629_0000079 Ga0495629_0000079_24445_24978 169
217 3300046461 Ga0495641_0080479 Ga0495641_0080479_741_1274 169
218 3300046463 Ga0495653_0031993 Ga0495653_0031993_181_714 169
219 3300046473 Ga0495582_0009345 Ga0495582_0009345_182_715 169
220 3300046476 Ga0495662_0000357 Ga0495662_0000357_10932_11465 169
221 3300046511 Ga0495608_0459022 Ga0495608_0459022_110_643 169
222 3300046517 Ga0495630_0219167 Ga0495630_0219167_355_888 169
223 3300046526 Ga0495666_0029812 Ga0495666_0029812_2037_2570 169
224 3300046531 Ga0495665_0089558 Ga0495665_0089558_901_1434 169
225 3300046533 Ga0495640_0011298 Ga0495640_0011298_129_662 169
226 3300046559 Ga0495667_0007074 Ga0495667_0007074_6924_7457 169
227 3300046642 Ga0495634_0082943 Ga0495634_0082943_1370_1903 169
228 3300046663 Ga0495635_0019979 Ga0495635_0019979_169_702 169
229 3300046681 Ga0495647_0044412 Ga0495647_0044412_201_734 169
230 3300046683 Ga0495658_0002080 Ga0495658_0002080_96_629 169
231 3300046689 Ga0495613_0005986 Ga0495613_0005986_185_718 169
232 3300046690 Ga0495624_0008116 Ga0495624_0008116_163_696 169
233 3300047315 Ga0495581_0004661 Ga0495581_0004661_163_696 169
234 3300047321 Ga0495676_0016386 Ga0495676_0016386_5866_6399 169
235 3300047322 Ga0495680_0011414 Ga0495680_0011414_7175_7708 169
236 3300047471 Ga0495684_0017532 Ga0495684_0017532_120_653 169
237 3300047673 Ga0495593_0009147 Ga0495593_0009147_190_723 169
238 3300053078 Ga0495612_0228575 Ga0495612_0228575_99_632 169
239 3300053084 Ga0495595_0012041 Ga0495595_0012041_2914_3447 169
240 3300053085 Ga0495619_0006173 Ga0495619_0006173_7000_7533 169

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r01-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h107a/h111a 0.7343 37 155
6qyb-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h111a 0.7073 37 156
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.7049 34 154
6qvh-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h113a 0.7022 37 156
6r01-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h107a/h111a 0.6934 37 155
ID Description Score Start End Superfamily
af_A0A2R8PY22_1_187_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7235 34 163 1.20.140.150
af_Q9D7D7_2_187_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7035 34 163 1.20.140.150
af_Q9LYT5_47_183_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6996 25 157 1.20.140.40
af_Q10482_16_111_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6948 112 169 1.20.1280.290
af_A0A0P0XBL1_35_175_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6833 34 152 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A538KQ31-F1-model_v4 Uncharacterized protein 0.8934 23 167 GO:0016020
AF-A0A538CTZ6-F1-model_v4 Uncharacterized protein 0.8762 33 167 GO:0016020
AF-A0A2P7AD67-F1-model_v4 deleted 0.8587 28 167
AF-A0A2W6EIU0-F1-model_v4 Na+/H+ antiporter MnhB subunit-related protein domain-containing protein 0.8352 33 169 GO:0016020
AF-A0A538CTZ6-F1-model_v4 Uncharacterized protein 0.8345 33 167 GO:0016020

Feature Viewer

pLDDT pTM Quality
68.41 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map