F352645
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 240 | 142 | 240 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100131564|Ga0070706_1001315641 |
| Length | 193 |
| Sequence | VSSAQGQSAHRPLEGQKVAVRALPAPPSRGSEVVGEIARYLGAVSILSVGAVHAQQYYGAYFSVVPTIGTLFLLSFIGSGVVGTVLLAPVRRLRRNVADLILVLAALGAIAIXXXXLASLLVSEYTPLFGFMESGYRLAIVLALVFDALTTVFLGLFVLMVLRQRRHQEANGAFSGTAIDLKARQTITTERNP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 29 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 30 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 31 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 32 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 33 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 34 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 35 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 43 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 70 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 71 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 72 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 73 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 74 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 75 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 76 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 77 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 78 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 79 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 80 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 81 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 82 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 83 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 117 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 118 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 119 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 120 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 121 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 122 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 123 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 124 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 127 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 128 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 129 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 130 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 131 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 132 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.83 |
| Rhizosphere | 89.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070680_100017385 | 3300005336 | Bacteria | 5671 |
| 2 | Ga0070660_100000345 | 3300005339 | Bacteria | 30972 |
| 3 | Ga0070659_100005460 | 3300005366 | Bacteria | 9134 |
| 4 | Ga0070709_10004260 | 3300005434 | Bacteria | 7717 |
| 5 | Ga0070709_10035200 | 3300005434 | Unclassified | 3042 |
| 6 | Ga0070709_10729752 | 3300005434 | Unclassified | 773 |
| 7 | Ga0070714_100069295 | 3300005435 | Bacteria | 3045 |
| 8 | Ga0070714_100362219 | 3300005435 | Bacteria | 1363 |
| 9 | Ga0070714_101164918 | 3300005435 | Unclassified | 752 |
| 10 | Ga0070714_101456593 | 3300005435 | Unclassified | 669 |
| 11 | Ga0070713_100154748 | 3300005436 | Unclassified | 2042 |
| 12 | Ga0070710_10199428 | 3300005437 | Bacteria | 1263 |
| 13 | Ga0070711_100009378 | 3300005439 | Bacteria | 6028 |
| 14 | Ga0070705_100193613 | 3300005440 | Bacteria | 1388 |
| 15 | Ga0070694_100927115 | 3300005444 | Unclassified | 720 |
| 16 | Ga0070708_100047125 | 3300005445 | Bacteria | 3806 |
| 17 | Ga0070708_100092411 | 3300005445 | Bacteria | 2757 |
| 18 | Ga0070708_100107599 | 3300005445 | Bacteria | 2560 |
| 19 | Ga0070708_100444594 | 3300005445 | Bacteria | 1223 |
| 20 | Ga0070678_100671491 | 3300005456 | Unclassified | 931 |
| 21 | Ga0070681_10034162 | 3300005458 | Bacteria | 5107 |
| 22 | Ga0070706_100131564 | 3300005467 | Unclassified | 2335 |
| 23 | Ga0070706_100241274 | 3300005467 | Bacteria | 1687 |
| 24 | Ga0070706_100318021 | 3300005467 | Unclassified | 1452 |
| 25 | Ga0070707_100000511 | 3300005468 | Bacteria | 38643 |
| 26 | Ga0070707_100024054 | 3300005468 | Bacteria | 5766 |
| 27 | Ga0070707_100254265 | 3300005468 | Unclassified | 1710 |
| 28 | Ga0070707_100311185 | 3300005468 | Unclassified | 1531 |
| 29 | Ga0070707_100948075 | 3300005468 | Bacteria | 825 |
| 30 | Ga0070698_100011375 | 3300005471 | Bacteria | 9446 |
| 31 | Ga0070698_100031511 | 3300005471 | Bacteria | 5497 |
| 32 | Ga0070698_100066808 | 3300005471 | Bacteria | 3617 |
| 33 | Ga0070698_100171007 | 3300005471 | Bacteria | 2114 |
| 34 | Ga0070698_100198064 | 3300005471 | Bacteria | 1945 |
| 35 | Ga0070699_100194918 | 3300005518 | Unclassified | 1800 |
| 36 | Ga0070699_100240845 | 3300005518 | Bacteria | 1615 |
| 37 | Ga0070699_100352529 | 3300005518 | Bacteria | 1326 |
| 38 | Ga0070679_100042975 | 3300005530 | Bacteria | 4501 |
| 39 | Ga0070697_100195262 | 3300005536 | Unclassified | 1719 |
| 40 | Ga0070697_100237577 | 3300005536 | Unclassified | 1555 |
| 41 | Ga0070697_100811896 | 3300005536 | Bacteria | 828 |
| 42 | Ga0070695_100400180 | 3300005545 | Unclassified | 1041 |
| 43 | Ga0070696_100323070 | 3300005546 | Bacteria | 1188 |
| 44 | Ga0070704_100198541 | 3300005549 | Unclassified | 1618 |
| 45 | Ga0068855_100024342 | 3300005563 | Bacteria | 7245 |
| 46 | Ga0070717_10044649 | 3300006028 | Bacteria | 3620 |
| 47 | Ga0070717_10322464 | 3300006028 | Bacteria | 1376 |
| 48 | Ga0070715_10003275 | 3300006163 | Bacteria | 5115 |
| 49 | Ga0070716_100000925 | 3300006173 | Bacteria | 12711 |
| 50 | Ga0070716_100095380 | 3300006173 | Unclassified | 1811 |
| 51 | Ga0070716_100230156 | 3300006173 | Bacteria | 1251 |
| 52 | Ga0070716_101088350 | 3300006173 | Bacteria | 637 |
| 53 | Ga0070712_100175344 | 3300006175 | Bacteria | 1667 |
| 54 | Ga0070712_100732597 | 3300006175 | Unclassified | 845 |
| 55 | Ga0070712_101272138 | 3300006175 | Bacteria | 641 |
| 56 | Ga0068871_100631566 | 3300006358 | Bacteria | 976 |
| 57 | Ga0075431_100004462 | 3300006847 | Bacteria | 13731 |
| 58 | Ga0075433_10013703 | 3300006852 | Bacteria | 6602 |
| 59 | Ga0075433_10026816 | 3300006852 | Bacteria | 4882 |
| 60 | Ga0075433_10263715 | 3300006852 | Bacteria | 1527 |
| 61 | Ga0075433_10605568 | 3300006852 | Unclassified | 962 |
| 62 | Ga0075434_100046419 | 3300006871 | Bacteria | 4311 |
| 63 | Ga0075434_100123796 | 3300006871 | Bacteria | 2602 |
| 64 | Ga0075434_100339585 | 3300006871 | Unclassified | 1523 |
| 65 | Ga0075434_100774704 | 3300006871 | Bacteria | 976 |
| 66 | Ga0068865_100314662 | 3300006881 | Unclassified | 1257 |
| 67 | Ga0075436_100019080 | 3300006914 | Bacteria | 4698 |
| 68 | Ga0075436_100019618 | 3300006914 | Bacteria | 4634 |
| 69 | Ga0075436_100434103 | 3300006914 | Unclassified | 955 |
| 70 | Ga0075435_100001128 | 3300007076 | Bacteria | 17036 |
| 71 | Ga0075435_100087665 | 3300007076 | Bacteria | 2565 |
| 72 | Ga0075435_100111648 | 3300007076 | Bacteria | 2274 |
| 73 | Ga0075435_100271179 | 3300007076 | Bacteria | 1447 |
| 74 | Ga0075435_100805921 | 3300007076 | Unclassified | 818 |
| 75 | Ga0105245_10248812 | 3300009098 | Unclassified | 1726 |
| 76 | Ga0105245_11162537 | 3300009098 | Bacteria | 819 |
| 77 | Ga0114129_10016812 | 3300009147 | Bacteria | 10413 |
| 78 | Ga0114129_10020943 | 3300009147 | Bacteria | 9288 |
| 79 | Ga0114129_10511006 | 3300009147 | Unclassified | 1568 |
| 80 | Ga0114129_10611544 | 3300009147 | Bacteria | 1411 |
| 81 | Ga0105241_11152052 | 3300009174 | Unclassified | 732 |
| 82 | Ga0105242_10125857 | 3300009176 | Unclassified | 2205 |
| 83 | Ga0105238_10379491 | 3300009551 | Bacteria | 1405 |
| 84 | Ga0157369_10712111 | 3300013105 | Bacteria | 1033 |
| 85 | Ga0157378_11512225 | 3300013297 | Unclassified | 716 |
| 86 | Ga0182008_10427735 | 3300014497 | Bacteria | 716 |
| 87 | Ga0157377_10450157 | 3300014745 | Bacteria | 889 |
| 88 | Ga0207692_10005914 | 3300025898 | Bacteria | 4935 |
| 89 | Ga0207692_10424809 | 3300025898 | Unclassified | 833 |
| 90 | Ga0207685_10046915 | 3300025905 | Unclassified | 1647 |
| 91 | Ga0207699_10672395 | 3300025906 | Unclassified | 757 |
| 92 | Ga0207684_10032465 | 3300025910 | Unclassified | 4439 |
| 93 | Ga0207684_10138390 | 3300025910 | Unclassified | 2092 |
| 94 | Ga0207684_10425525 | 3300025910 | Bacteria | 1141 |
| 95 | Ga0207684_10448342 | 3300025910 | Bacteria | 1108 |
| 96 | Ga0207654_10913041 | 3300025911 | Unclassified | 637 |
| 97 | Ga0207707_10087182 | 3300025912 | Unclassified | 2727 |
| 98 | Ga0207693_10001096 | 3300025915 | Bacteria | 24353 |
| 99 | Ga0207693_10157487 | 3300025915 | Bacteria | 1786 |
| 100 | Ga0207693_10621173 | 3300025915 | Unclassified | 840 |
| 101 | Ga0207663_10002135 | 3300025916 | Bacteria | 9434 |
| 102 | Ga0207663_10165680 | 3300025916 | Bacteria | 1565 |
| 103 | Ga0207660_10360572 | 3300025917 | Bacteria | 1166 |
| 104 | Ga0207657_10000874 | 3300025919 | Bacteria | 31807 |
| 105 | Ga0207652_10019256 | 3300025921 | Bacteria | 5611 |
| 106 | Ga0207646_10005572 | 3300025922 | Bacteria | 13220 |
| 107 | Ga0207646_10005691 | 3300025922 | Bacteria | 13071 |
| 108 | Ga0207646_10148432 | 3300025922 | Unclassified | 2114 |
| 109 | Ga0207646_10289278 | 3300025922 | Unclassified | 1481 |
| 110 | Ga0207646_10409565 | 3300025922 | Bacteria | 1224 |
| 111 | Ga0207694_10513771 | 3300025924 | Bacteria | 1004 |
| 112 | Ga0207687_10020351 | 3300025927 | Bacteria | 4401 |
| 113 | Ga0207687_10701912 | 3300025927 | Unclassified | 859 |
| 114 | Ga0207700_10219889 | 3300025928 | Bacteria | 1610 |
| 115 | Ga0207700_10820153 | 3300025928 | Unclassified | 832 |
| 116 | Ga0207664_10041071 | 3300025929 | Bacteria | 3602 |
| 117 | Ga0207664_10300219 | 3300025929 | Bacteria | 1413 |
| 118 | Ga0207664_10448610 | 3300025929 | Bacteria | 1151 |
| 119 | Ga0207664_10629976 | 3300025929 | Bacteria | 963 |
| 120 | Ga0207644_10039667 | 3300025931 | Bacteria | 3325 |
| 121 | Ga0207690_10023161 | 3300025932 | Bacteria | 3873 |
| 122 | Ga0207686_10068954 | 3300025934 | Bacteria | 2267 |
| 123 | Ga0207686_10825454 | 3300025934 | Bacteria | 744 |
| 124 | Ga0207704_10166131 | 3300025938 | Unclassified | 1577 |
| 125 | Ga0207665_10000856 | 3300025939 | Bacteria | 20555 |
| 126 | Ga0207665_10009578 | 3300025939 | Bacteria | 6361 |
| 127 | Ga0207665_10303264 | 3300025939 | Unclassified | 1194 |
| 128 | Ga0207665_10331828 | 3300025939 | Bacteria | 1144 |
| 129 | Ga0207665_10351156 | 3300025939 | Bacteria | 1113 |
| 130 | Ga0207711_10482906 | 3300025941 | Bacteria | 1154 |
| 131 | Ga0207667_10047093 | 3300025949 | Bacteria | 4565 |
| 132 | Ga0207702_10171524 | 3300026078 | Bacteria | 1990 |
| 133 | Ga0207683_10059765 | 3300026121 | Unclassified | 3349 |
| 134 | Ga0207428_10382107 | 3300027907 | Bacteria | 1033 |
| 135 | Ga0373944_0014687 | 3300035089 | Bacteria | 2189 |
| 136 | Ga0373945_0033135 | 3300035116 | Bacteria | 1834 |
| 137 | Ga0373943_0051847 | 3300035170 | Bacteria | 2021 |
| 138 | Ga0373946_0012302 | 3300035171 | Bacteria | 3201 |
| 139 | Ga0373931_0491109 | 3300035691 | Bacteria | 790 |
| 140 | Ga0373935_0038731 | 3300035692 | Bacteria | 2986 |
| 141 | Ga0373927_0204953 | 3300035695 | Bacteria | 1295 |
| 142 | Ga0373933_0472277 | 3300035724 | Bacteria | 821 |
| 143 | Ga0373947_0004052 | 3300035725 | Bacteria | 8620 |
| 144 | Ga0373937_0147714 | 3300036401 | Bacteria | 2201 |
| 145 | Ga0373937_0283552 | 3300036401 | Bacteria | 1564 |
| 146 | Ga0373937_1306927 | 3300036401 | Bacteria | 673 |
| 147 | Ga0373925_0011456 | 3300037068 | Bacteria | 6419 |
| 148 | Ga0395900_0275651 | 3300037418 | Bacteria | 1676 |
| 149 | Ga0466967_0000076 | 3300045976 | Bacteria | 36156 |
| 150 | Ga0495592_0179357 | 3300046454 | Unclassified | 1444 |
| 151 | Ga0495592_0208258 | 3300046454 | Bacteria | 1315 |
| 152 | Ga0495629_0000079 | 3300046459 | Bacteria | 85673 |
| 153 | Ga0495641_0080479 | 3300046461 | Bacteria | 1459 |
| 154 | Ga0495653_0031993 | 3300046463 | Unclassified | 4180 |
| 155 | Ga0495653_0179623 | 3300046463 | Bacteria | 1454 |
| 156 | Ga0495653_0878678 | 3300046463 | Bacteria | 535 |
| 157 | Ga0495582_0009345 | 3300046473 | Bacteria | 5402 |
| 158 | Ga0495582_0058930 | 3300046473 | Bacteria | 2118 |
| 159 | Ga0495662_0000357 | 3300046476 | Bacteria | 20066 |
| 160 | Ga0495584_0028831 | 3300046491 | Unclassified | 2814 |
| 161 | Ga0495594_0433204 | 3300046499 | Unclassified | 748 |
| 162 | Ga0495608_0026133 | 3300046511 | Bacteria | 3983 |
| 163 | Ga0495608_0459022 | 3300046511 | Bacteria | 774 |
| 164 | Ga0495628_0215464 | 3300046516 | Bacteria | 1443 |
| 165 | Ga0495630_0219167 | 3300046517 | Bacteria | 1452 |
| 166 | Ga0495666_0029812 | 3300046526 | Bacteria | 2683 |
| 167 | Ga0495652_0042596 | 3300046529 | Bacteria | 3914 |
| 168 | Ga0495665_0089558 | 3300046531 | Bacteria | 1617 |
| 169 | Ga0495640_0011298 | 3300046533 | Bacteria | 6874 |
| 170 | Ga0495587_0319668 | 3300046536 | Bacteria | 867 |
| 171 | Ga0495667_0007074 | 3300046559 | Bacteria | 7614 |
| 172 | Ga0495668_0297899 | 3300046616 | Unclassified | 884 |
| 173 | Ga0495634_0082943 | 3300046642 | Bacteria | 2093 |
| 174 | Ga0495635_0019979 | 3300046663 | Bacteria | 4668 |
| 175 | Ga0495599_0154729 | 3300046678 | Bacteria | 1419 |
| 176 | Ga0495599_0403531 | 3300046678 | Unclassified | 814 |
| 177 | Ga0495647_0044412 | 3300046681 | Bacteria | 1704 |
| 178 | Ga0495658_0002080 | 3300046683 | Bacteria | 10148 |
| 179 | Ga0495658_0125510 | 3300046683 | Bacteria | 1557 |
| 180 | Ga0495613_0005986 | 3300046689 | Bacteria | 9102 |
| 181 | Ga0495624_0008116 | 3300046690 | Bacteria | 7349 |
| 182 | Ga0495600_0097848 | 3300046809 | Bacteria | 1913 |
| 183 | Ga0495581_0004661 | 3300047315 | Bacteria | 7919 |
| 184 | Ga0495581_0140084 | 3300047315 | Bacteria | 1411 |
| 185 | Ga0495604_0060790 | 3300047317 | Bacteria | 2892 |
| 186 | Ga0495676_0016386 | 3300047321 | Bacteria | 6582 |
| 187 | Ga0495676_0433032 | 3300047321 | Unclassified | 869 |
| 188 | Ga0495680_0011414 | 3300047322 | Bacteria | 7865 |
| 189 | Ga0495680_0030932 | 3300047322 | Bacteria | 4362 |
| 190 | Ga0495684_0017532 | 3300047471 | Bacteria | 5513 |
| 191 | Ga0495684_0103065 | 3300047471 | Unclassified | 2157 |
| 192 | Ga0495684_0318209 | 3300047471 | Bacteria | 1113 |
| 193 | Ga0495593_0009147 | 3300047673 | Bacteria | 5747 |
| 194 | Ga0495602_0246640 | 3300048088 | Bacteria | 1333 |
| 195 | Ga0496100_0000411 | 3300048903 | Bacteria | 20683 |
| 196 | Ga0496101_0000767 | 3300048904 | Bacteria | 19022 |
| 197 | Ga0496101_0122058 | 3300048904 | Bacteria | 1970 |
| 198 | Ga0496102_0159540 | 3300048905 | Bacteria | 2121 |
| 199 | Ga0496102_0294147 | 3300048905 | Bacteria | 1530 |
| 200 | Ga0496103_0103787 | 3300048906 | Unclassified | 1801 |
| 201 | Ga0496103_0152711 | 3300048906 | Bacteria | 1479 |
| 202 | Ga0496104_0001579 | 3300048907 | Bacteria | 19611 |
| 203 | Ga0496104_0518645 | 3300048907 | Bacteria | 1103 |
| 204 | Ga0496105_0002338 | 3300048908 | Bacteria | 13742 |
| 205 | Ga0496106_0002962 | 3300048909 | Bacteria | 12632 |
| 206 | Ga0496107_0004456 | 3300048910 | Bacteria | 9495 |
| 207 | Ga0496107_0084347 | 3300048910 | Bacteria | 2318 |
| 208 | Ga0496108_0058746 | 3300048911 | Bacteria | 3233 |
| 209 | Ga0496109_0000791 | 3300048912 | Bacteria | 26324 |
| 210 | Ga0496110_0027920 | 3300048913 | Bacteria | 4842 |
| 211 | Ga0496110_0043958 | 3300048913 | Bacteria | 3901 |
| 212 | Ga0496111_0297602 | 3300048914 | Bacteria | 1196 |
| 213 | Ga0496111_0501111 | 3300048914 | Bacteria | 894 |
| 214 | Ga0496112_0010714 | 3300048915 | Bacteria | 8334 |
| 215 | Ga0496113_0073378 | 3300048916 | Bacteria | 2607 |
| 216 | Ga0496114_0022178 | 3300048917 | Bacteria | 5172 |
| 217 | Ga0496114_0400388 | 3300048917 | Unclassified | 1215 |
| 218 | Ga0496115_0001152 | 3300048918 | Bacteria | 19108 |
| 219 | Ga0496115_0060625 | 3300048918 | Bacteria | 3049 |
| 220 | Ga0496115_1020253 | 3300048918 | Bacteria | 631 |
| 221 | nmdc:mga05p37_106196_c1 | 3300050507 | Bacteria | 3454 |
| 222 | nmdc:mga05p37_37636_c1 | 3300050507 | Bacteria | 5933 |
| 223 | nmdc:mga05p37_828374_c1 | 3300050507 | Unclassified | 1008 |
| 224 | nmdc:mga06r32_505707_c1 | 3300050510 | Bacteria | 1185 |
| 225 | nmdc:mga0n895_1148989_c1 | 3300050512 | Unclassified | 752 |
| 226 | nmdc:mga0n895_29343_c1 | 3300050512 | Bacteria | 5245 |
| 227 | nmdc:mga0n895_379946_c1 | 3300050512 | Bacteria | 1430 |
| 228 | nmdc:mga0rr50_91001_c1 | 3300050513 | Bacteria | 2375 |
| 229 | nmdc:mga08x19_1045769_c1 | 3300050514 | Bacteria | 580 |
| 230 | nmdc:mga0a205_190125_c1 | 3300050515 | Bacteria | 1945 |
| 231 | nmdc:mga0a205_19491_c1 | 3300050515 | Bacteria | 6396 |
| 232 | nmdc:mga0a205_87687_c1 | 3300050515 | Bacteria | 3006 |
| 233 | Ga0495601_0007902 | 3300053077 | Bacteria | 6264 |
| 234 | Ga0495612_0228575 | 3300053078 | Bacteria | 825 |
| 235 | Ga0495655_0138678 | 3300053083 | Unclassified | 755 |
| 236 | Ga0495595_0012041 | 3300053084 | Unclassified | 3627 |
| 237 | Ga0495595_0123321 | 3300053084 | Bacteria | 1263 |
| 238 | Ga0495619_0006173 | 3300053085 | Bacteria | 7592 |
| 239 | Ga0495619_0078179 | 3300053085 | Bacteria | 2224 |
| 240 | Ga0495619_0244528 | 3300053085 | Bacteria | 1243 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046463 | Ga0495653_0878678 | Ga0495653_0878678_22_474 | 123 |
| 2 | 3300009147 | Ga0114129_10020943 | Ga0114129_100209434 | 137 |
| 3 | 3300005435 | Ga0070714_101456593 | Ga0070714_1014565931 | 147 |
| 4 | 3300005445 | Ga0070708_100107599 | Ga0070708_1001075994 | 147 |
| 5 | 3300005471 | Ga0070698_100031511 | Ga0070698_1000315114 | 147 |
| 6 | 3300005518 | Ga0070699_100194918 | Ga0070699_1001949182 | 147 |
| 7 | 3300006173 | Ga0070716_101088350 | Ga0070716_1010883501 | 147 |
| 8 | 3300006871 | Ga0075434_100339585 | Ga0075434_1003395852 | 147 |
| 9 | 3300025910 | Ga0207684_10425525 | Ga0207684_104255252 | 147 |
| 10 | 3300035695 | Ga0373927_0204953 | Ga0373927_0204953_500_1027 | 147 |
| 11 | 3300048907 | Ga0496104_0518645 | Ga0496104_0518645_489_1013 | 147 |
| 12 | 3300048918 | Ga0496115_0060625 | Ga0496115_0060625_45_593 | 147 |
| 13 | 3300006173 | Ga0070716_100095380 | Ga0070716_1000953803 | 148 |
| 14 | 3300025939 | Ga0207665_10009578 | Ga0207665_100095786 | 148 |
| 15 | 3300045976 | Ga0466967_0000076 | Ga0466967_0000076_21076_21558 | 148 |
| 16 | 3300005434 | Ga0070709_10729752 | Ga0070709_107297522 | 149 |
| 17 | 3300005518 | Ga0070699_100352529 | Ga0070699_1003525292 | 150 |
| 18 | 3300009098 | Ga0105245_10248812 | Ga0105245_102488123 | 150 |
| 19 | 3300009147 | Ga0114129_10511006 | Ga0114129_105110063 | 150 |
| 20 | 3300009147 | Ga0114129_10611544 | Ga0114129_106115441 | 150 |
| 21 | 3300009176 | Ga0105242_10125857 | Ga0105242_101258573 | 150 |
| 22 | 3300014745 | Ga0157377_10450157 | Ga0157377_104501572 | 150 |
| 23 | 3300036401 | Ga0373937_0147714 | Ga0373937_0147714_1092_1565 | 150 |
| 24 | 3300036401 | Ga0373937_0283552 | Ga0373937_0283552_840_1313 | 150 |
| 25 | 3300036401 | Ga0373937_1306927 | Ga0373937_1306927_20_493 | 150 |
| 26 | 3300046454 | Ga0495592_0179357 | Ga0495592_0179357_322_795 | 150 |
| 27 | 3300046491 | Ga0495584_0028831 | Ga0495584_0028831_1826_2299 | 150 |
| 28 | 3300046499 | Ga0495594_0433204 | Ga0495594_0433204_110_583 | 150 |
| 29 | 3300046511 | Ga0495608_0026133 | Ga0495608_0026133_385_858 | 150 |
| 30 | 3300046516 | Ga0495628_0215464 | Ga0495628_0215464_363_836 | 150 |
| 31 | 3300046536 | Ga0495587_0319668 | Ga0495587_0319668_236_709 | 150 |
| 32 | 3300046616 | Ga0495668_0297899 | Ga0495668_0297899_400_873 | 150 |
| 33 | 3300046678 | Ga0495599_0154729 | Ga0495599_0154729_855_1328 | 150 |
| 34 | 3300046809 | Ga0495600_0097848 | Ga0495600_0097848_240_713 | 150 |
| 35 | 3300047317 | Ga0495604_0060790 | Ga0495604_0060790_1779_2252 | 150 |
| 36 | 3300047322 | Ga0495680_0030932 | Ga0495680_0030932_3475_3948 | 150 |
| 37 | 3300047471 | Ga0495684_0318209 | Ga0495684_0318209_231_704 | 150 |
| 38 | 3300048088 | Ga0495602_0246640 | Ga0495602_0246640_713_1186 | 150 |
| 39 | 3300048904 | Ga0496101_0122058 | Ga0496101_0122058_525_998 | 150 |
| 40 | 3300048905 | Ga0496102_0159540 | Ga0496102_0159540_47_520 | 150 |
| 41 | 3300048906 | Ga0496103_0103787 | Ga0496103_0103787_1213_1686 | 150 |
| 42 | 3300048910 | Ga0496107_0084347 | Ga0496107_0084347_968_1441 | 150 |
| 43 | 3300048917 | Ga0496114_0400388 | Ga0496114_0400388_50_523 | 150 |
| 44 | 3300048918 | Ga0496115_1020253 | Ga0496115_1020253_104_577 | 150 |
| 45 | 3300050507 | nmdc:mga05p37_37636_c1 | nmdc:mga05p37_37636_c1_4881_5354 | 150 |
| 46 | 3300050507 | nmdc:mga05p37_828374_c1 | nmdc:mga05p37_828374_c1_216_689 | 150 |
| 47 | 3300050510 | nmdc:mga06r32_505707_c1 | nmdc:mga06r32_505707_c1_26_499 | 150 |
| 48 | 3300050512 | nmdc:mga0n895_379946_c1 | nmdc:mga0n895_379946_c1_363_836 | 150 |
| 49 | 3300050515 | nmdc:mga0a205_190125_c1 | nmdc:mga0a205_190125_c1_1038_1511 | 150 |
| 50 | 3300053083 | Ga0495655_0138678 | Ga0495655_0138678_25_498 | 150 |
| 51 | 3300053084 | Ga0495595_0123321 | Ga0495595_0123321_729_1202 | 150 |
| 52 | 3300053085 | Ga0495619_0078179 | Ga0495619_0078179_854_1327 | 150 |
| 53 | 3300009147 | Ga0114129_10016812 | Ga0114129_100168129 | 151 |
| 54 | 3300050507 | nmdc:mga05p37_106196_c1 | nmdc:mga05p37_106196_c1_2328_2813 | 151 |
| 55 | 3300014497 | Ga0182008_10427735 | Ga0182008_104277352 | 154 |
| 56 | 3300048915 | Ga0496112_0010714 | Ga0496112_0010714_2003_2485 | 154 |
| 57 | 3300037418 | Ga0395900_0275651 | Ga0395900_0275651_1032_1508 | 156 |
| 58 | 3300050514 | nmdc:mga08x19_1045769_c1 | nmdc:mga08x19_1045769_c1_21_506 | 156 |
| 59 | 3300050515 | nmdc:mga0a205_87687_c1 | nmdc:mga0a205_87687_c1_2007_2492 | 156 |
| 60 | 3300005434 | Ga0070709_10004260 | Ga0070709_100042603 | 157 |
| 61 | 3300005436 | Ga0070713_100154748 | Ga0070713_1001547482 | 157 |
| 62 | 3300005439 | Ga0070711_100009378 | Ga0070711_1000093783 | 157 |
| 63 | 3300005456 | Ga0070678_100671491 | Ga0070678_1006714911 | 157 |
| 64 | 3300005468 | Ga0070707_100254265 | Ga0070707_1002542653 | 157 |
| 65 | 3300005549 | Ga0070704_100198541 | Ga0070704_1001985412 | 157 |
| 66 | 3300006028 | Ga0070717_10044649 | Ga0070717_100446493 | 157 |
| 67 | 3300006163 | Ga0070715_10003275 | Ga0070715_100032757 | 157 |
| 68 | 3300006173 | Ga0070716_100000925 | Ga0070716_1000009259 | 157 |
| 69 | 3300009098 | Ga0105245_11162537 | Ga0105245_111625372 | 157 |
| 70 | 3300009174 | Ga0105241_11152052 | Ga0105241_111520522 | 157 |
| 71 | 3300013297 | Ga0157378_11512225 | Ga0157378_115122251 | 157 |
| 72 | 3300025898 | Ga0207692_10005914 | Ga0207692_100059145 | 157 |
| 73 | 3300025905 | Ga0207685_10046915 | Ga0207685_100469152 | 157 |
| 74 | 3300025915 | Ga0207693_10001096 | Ga0207693_100010966 | 157 |
| 75 | 3300025916 | Ga0207663_10002135 | Ga0207663_100021355 | 157 |
| 76 | 3300025928 | Ga0207700_10820153 | Ga0207700_108201531 | 157 |
| 77 | 3300025929 | Ga0207664_10041071 | Ga0207664_100410714 | 157 |
| 78 | 3300025931 | Ga0207644_10039667 | Ga0207644_100396673 | 157 |
| 79 | 3300025939 | Ga0207665_10000856 | Ga0207665_1000085617 | 157 |
| 80 | 3300035691 | Ga0373931_0491109 | Ga0373931_0491109_108_599 | 157 |
| 81 | 3300048903 | Ga0496100_0000411 | Ga0496100_0000411_19486_19977 | 157 |
| 82 | 3300048904 | Ga0496101_0000767 | Ga0496101_0000767_17822_18313 | 157 |
| 83 | 3300048905 | Ga0496102_0294147 | Ga0496102_0294147_349_840 | 157 |
| 84 | 3300048906 | Ga0496103_0152711 | Ga0496103_0152711_587_1078 | 157 |
| 85 | 3300048907 | Ga0496104_0001579 | Ga0496104_0001579_7787_8278 | 157 |
| 86 | 3300048908 | Ga0496105_0002338 | Ga0496105_0002338_705_1196 | 157 |
| 87 | 3300048909 | Ga0496106_0002962 | Ga0496106_0002962_4698_5189 | 157 |
| 88 | 3300048910 | Ga0496107_0004456 | Ga0496107_0004456_822_1313 | 157 |
| 89 | 3300048911 | Ga0496108_0058746 | Ga0496108_0058746_2081_2572 | 157 |
| 90 | 3300048912 | Ga0496109_0000791 | Ga0496109_0000791_16007_16498 | 157 |
| 91 | 3300048913 | Ga0496110_0027920 | Ga0496110_0027920_3684_4175 | 157 |
| 92 | 3300048913 | Ga0496110_0043958 | Ga0496110_0043958_774_1271 | 157 |
| 93 | 3300048914 | Ga0496111_0297602 | Ga0496111_0297602_637_1128 | 157 |
| 94 | 3300048916 | Ga0496113_0073378 | Ga0496113_0073378_1491_1982 | 157 |
| 95 | 3300048917 | Ga0496114_0022178 | Ga0496114_0022178_4005_4496 | 157 |
| 96 | 3300048918 | Ga0496115_0001152 | Ga0496115_0001152_11348_11839 | 157 |
| 97 | 3300005468 | Ga0070707_100024054 | Ga0070707_1000240545 | 158 |
| 98 | 3300005471 | Ga0070698_100171007 | Ga0070698_1001710072 | 158 |
| 99 | 3300025922 | Ga0207646_10289278 | Ga0207646_102892782 | 158 |
| 100 | 3300035724 | Ga0373933_0472277 | Ga0373933_0472277_211_735 | 158 |
| 101 | 3300005545 | Ga0070695_100400180 | Ga0070695_1004001801 | 159 |
| 102 | 3300046683 | Ga0495658_0125510 | Ga0495658_0125510_550_1095 | 160 |
| 103 | 3300005440 | Ga0070705_100193613 | Ga0070705_1001936133 | 162 |
| 104 | 3300005536 | Ga0070697_100811896 | Ga0070697_1008118961 | 162 |
| 105 | 3300006852 | Ga0075433_10263715 | Ga0075433_102637152 | 162 |
| 106 | 3300048914 | Ga0496111_0501111 | Ga0496111_0501111_181_696 | 162 |
| 107 | 3300005467 | Ga0070706_100241274 | Ga0070706_1002412742 | 163 |
| 108 | 3300006175 | Ga0070712_101272138 | Ga0070712_1012721382 | 163 |
| 109 | 3300006852 | Ga0075433_10013703 | Ga0075433_100137034 | 163 |
| 110 | 3300006871 | Ga0075434_100046419 | Ga0075434_1000464196 | 163 |
| 111 | 3300007076 | Ga0075435_100087665 | Ga0075435_1000876654 | 163 |
| 112 | 3300007076 | Ga0075435_100805921 | Ga0075435_1008059211 | 163 |
| 113 | 3300027907 | Ga0207428_10382107 | Ga0207428_103821072 | 163 |
| 114 | 3300050512 | nmdc:mga0n895_1148989_c1 | nmdc:mga0n895_1148989_c1_104_631 | 163 |
| 115 | 3300050512 | nmdc:mga0n895_29343_c1 | nmdc:mga0n895_29343_c1_2063_2584 | 163 |
| 116 | 3300050513 | nmdc:mga0rr50_91001_c1 | nmdc:mga0rr50_91001_c1_595_1116 | 163 |
| 117 | 3300050515 | nmdc:mga0a205_19491_c1 | nmdc:mga0a205_19491_c1_4414_4935 | 163 |
| 118 | 3300005445 | Ga0070708_100444594 | Ga0070708_1004445942 | 164 |
| 119 | 3300005546 | Ga0070696_100323070 | Ga0070696_1003230702 | 164 |
| 120 | 3300006175 | Ga0070712_100175344 | Ga0070712_1001753443 | 164 |
| 121 | 3300025915 | Ga0207693_10157487 | Ga0207693_101574873 | 164 |
| 122 | 3300025922 | Ga0207646_10409565 | Ga0207646_104095652 | 164 |
| 123 | 3300005468 | Ga0070707_100311185 | Ga0070707_1003111852 | 165 |
| 124 | 3300005518 | Ga0070699_100240845 | Ga0070699_1002408452 | 165 |
| 125 | 3300007076 | Ga0075435_100111648 | Ga0075435_1001116484 | 165 |
| 126 | 3300025910 | Ga0207684_10448342 | Ga0207684_104483422 | 165 |
| 127 | 3300005445 | Ga0070708_100047125 | Ga0070708_1000471253 | 166 |
| 128 | 3300005468 | Ga0070707_100948075 | Ga0070707_1009480751 | 166 |
| 129 | 3300046454 | Ga0495592_0208258 | Ga0495592_0208258_210_731 | 166 |
| 130 | 3300046463 | Ga0495653_0179623 | Ga0495653_0179623_68_589 | 166 |
| 131 | 3300046473 | Ga0495582_0058930 | Ga0495582_0058930_347_895 | 166 |
| 132 | 3300046529 | Ga0495652_0042596 | Ga0495652_0042596_732_1253 | 166 |
| 133 | 3300046678 | Ga0495599_0403531 | Ga0495599_0403531_166_687 | 166 |
| 134 | 3300047315 | Ga0495581_0140084 | Ga0495581_0140084_166_714 | 166 |
| 135 | 3300047321 | Ga0495676_0433032 | Ga0495676_0433032_124_672 | 166 |
| 136 | 3300047471 | Ga0495684_0103065 | Ga0495684_0103065_670_1191 | 166 |
| 137 | 3300053077 | Ga0495601_0007902 | Ga0495601_0007902_1212_1733 | 166 |
| 138 | 3300053085 | Ga0495619_0244528 | Ga0495619_0244528_175_696 | 166 |
| 139 | 3300005435 | Ga0070714_100362219 | Ga0070714_1003622192 | 167 |
| 140 | 3300006028 | Ga0070717_10322464 | Ga0070717_103224642 | 167 |
| 141 | 3300025929 | Ga0207664_10300219 | Ga0207664_103002192 | 167 |
| 142 | 3300005434 | Ga0070709_10035200 | Ga0070709_100352003 | 168 |
| 143 | 3300005435 | Ga0070714_100069295 | Ga0070714_1000692953 | 168 |
| 144 | 3300005435 | Ga0070714_101164918 | Ga0070714_1011649181 | 168 |
| 145 | 3300005445 | Ga0070708_100092411 | Ga0070708_1000924113 | 168 |
| 146 | 3300005467 | Ga0070706_100131564 | Ga0070706_1001315641 | 168 |
| 147 | 3300005467 | Ga0070706_100318021 | Ga0070706_1003180212 | 168 |
| 148 | 3300005468 | Ga0070707_100000511 | Ga0070707_10000051125 | 168 |
| 149 | 3300005471 | Ga0070698_100011375 | Ga0070698_1000113755 | 168 |
| 150 | 3300005471 | Ga0070698_100198064 | Ga0070698_1001980642 | 168 |
| 151 | 3300006175 | Ga0070712_100732597 | Ga0070712_1007325972 | 168 |
| 152 | 3300006358 | Ga0068871_100631566 | Ga0068871_1006315661 | 168 |
| 153 | 3300006847 | Ga0075431_100004462 | Ga0075431_10000446212 | 168 |
| 154 | 3300006852 | Ga0075433_10026816 | Ga0075433_100268164 | 168 |
| 155 | 3300006852 | Ga0075433_10605568 | Ga0075433_106055681 | 168 |
| 156 | 3300006871 | Ga0075434_100123796 | Ga0075434_1001237963 | 168 |
| 157 | 3300006914 | Ga0075436_100019080 | Ga0075436_1000190804 | 168 |
| 158 | 3300007076 | Ga0075435_100271179 | Ga0075435_1002711793 | 168 |
| 159 | 3300025898 | Ga0207692_10424809 | Ga0207692_104248092 | 168 |
| 160 | 3300025906 | Ga0207699_10672395 | Ga0207699_106723952 | 168 |
| 161 | 3300025910 | Ga0207684_10032465 | Ga0207684_100324653 | 168 |
| 162 | 3300025910 | Ga0207684_10138390 | Ga0207684_101383903 | 168 |
| 163 | 3300025916 | Ga0207663_10165680 | Ga0207663_101656803 | 168 |
| 164 | 3300025922 | Ga0207646_10005691 | Ga0207646_100056915 | 168 |
| 165 | 3300025927 | Ga0207687_10020351 | Ga0207687_100203514 | 168 |
| 166 | 3300025929 | Ga0207664_10448610 | Ga0207664_104486102 | 168 |
| 167 | 3300025929 | Ga0207664_10629976 | Ga0207664_106299761 | 168 |
| 168 | 3300025934 | Ga0207686_10825454 | Ga0207686_108254542 | 168 |
| 169 | 3300005336 | Ga0070680_100017385 | Ga0070680_1000173854 | 169 |
| 170 | 3300005339 | Ga0070660_100000345 | Ga0070660_10000034516 | 169 |
| 171 | 3300005366 | Ga0070659_100005460 | Ga0070659_1000054603 | 169 |
| 172 | 3300005437 | Ga0070710_10199428 | Ga0070710_101994281 | 169 |
| 173 | 3300005444 | Ga0070694_100927115 | Ga0070694_1009271152 | 169 |
| 174 | 3300005458 | Ga0070681_10034162 | Ga0070681_100341622 | 169 |
| 175 | 3300005471 | Ga0070698_100066808 | Ga0070698_1000668084 | 169 |
| 176 | 3300005530 | Ga0070679_100042975 | Ga0070679_1000429752 | 169 |
| 177 | 3300005536 | Ga0070697_100195262 | Ga0070697_1001952622 | 169 |
| 178 | 3300005536 | Ga0070697_100237577 | Ga0070697_1002375772 | 169 |
| 179 | 3300005563 | Ga0068855_100024342 | Ga0068855_1000243427 | 169 |
| 180 | 3300006173 | Ga0070716_100230156 | Ga0070716_1002301562 | 169 |
| 181 | 3300006871 | Ga0075434_100774704 | Ga0075434_1007747042 | 169 |
| 182 | 3300006881 | Ga0068865_100314662 | Ga0068865_1003146622 | 169 |
| 183 | 3300006914 | Ga0075436_100019618 | Ga0075436_1000196183 | 169 |
| 184 | 3300006914 | Ga0075436_100434103 | Ga0075436_1004341032 | 169 |
| 185 | 3300007076 | Ga0075435_100001128 | Ga0075435_1000011284 | 169 |
| 186 | 3300009551 | Ga0105238_10379491 | Ga0105238_103794913 | 169 |
| 187 | 3300013105 | Ga0157369_10712111 | Ga0157369_107121112 | 169 |
| 188 | 3300025911 | Ga0207654_10913041 | Ga0207654_109130411 | 169 |
| 189 | 3300025912 | Ga0207707_10087182 | Ga0207707_100871823 | 169 |
| 190 | 3300025915 | Ga0207693_10621173 | Ga0207693_106211732 | 169 |
| 191 | 3300025917 | Ga0207660_10360572 | Ga0207660_103605722 | 169 |
| 192 | 3300025919 | Ga0207657_10000874 | Ga0207657_1000087416 | 169 |
| 193 | 3300025921 | Ga0207652_10019256 | Ga0207652_100192562 | 169 |
| 194 | 3300025922 | Ga0207646_10005572 | Ga0207646_1000557216 | 169 |
| 195 | 3300025922 | Ga0207646_10148432 | Ga0207646_101484323 | 169 |
| 196 | 3300025924 | Ga0207694_10513771 | Ga0207694_105137711 | 169 |
| 197 | 3300025927 | Ga0207687_10701912 | Ga0207687_107019121 | 169 |
| 198 | 3300025928 | Ga0207700_10219889 | Ga0207700_102198891 | 169 |
| 199 | 3300025932 | Ga0207690_10023161 | Ga0207690_100231613 | 169 |
| 200 | 3300025934 | Ga0207686_10068954 | Ga0207686_100689543 | 169 |
| 201 | 3300025938 | Ga0207704_10166131 | Ga0207704_101661313 | 169 |
| 202 | 3300025939 | Ga0207665_10303264 | Ga0207665_103032641 | 169 |
| 203 | 3300025939 | Ga0207665_10331828 | Ga0207665_103318282 | 169 |
| 204 | 3300025939 | Ga0207665_10351156 | Ga0207665_103511562 | 169 |
| 205 | 3300025941 | Ga0207711_10482906 | Ga0207711_104829062 | 169 |
| 206 | 3300025949 | Ga0207667_10047093 | Ga0207667_100470935 | 169 |
| 207 | 3300026078 | Ga0207702_10171524 | Ga0207702_101715242 | 169 |
| 208 | 3300026121 | Ga0207683_10059765 | Ga0207683_100597651 | 169 |
| 209 | 3300035089 | Ga0373944_0014687 | Ga0373944_0014687_1502_2035 | 169 |
| 210 | 3300035116 | Ga0373945_0033135 | Ga0373945_0033135_198_731 | 169 |
| 211 | 3300035170 | Ga0373943_0051847 | Ga0373943_0051847_1326_1859 | 169 |
| 212 | 3300035171 | Ga0373946_0012302 | Ga0373946_0012302_37_570 | 169 |
| 213 | 3300035692 | Ga0373935_0038731 | Ga0373935_0038731_2266_2799 | 169 |
| 214 | 3300035725 | Ga0373947_0004052 | Ga0373947_0004052_8000_8533 | 169 |
| 215 | 3300037068 | Ga0373925_0011456 | Ga0373925_0011456_4112_4645 | 169 |
| 216 | 3300046459 | Ga0495629_0000079 | Ga0495629_0000079_24445_24978 | 169 |
| 217 | 3300046461 | Ga0495641_0080479 | Ga0495641_0080479_741_1274 | 169 |
| 218 | 3300046463 | Ga0495653_0031993 | Ga0495653_0031993_181_714 | 169 |
| 219 | 3300046473 | Ga0495582_0009345 | Ga0495582_0009345_182_715 | 169 |
| 220 | 3300046476 | Ga0495662_0000357 | Ga0495662_0000357_10932_11465 | 169 |
| 221 | 3300046511 | Ga0495608_0459022 | Ga0495608_0459022_110_643 | 169 |
| 222 | 3300046517 | Ga0495630_0219167 | Ga0495630_0219167_355_888 | 169 |
| 223 | 3300046526 | Ga0495666_0029812 | Ga0495666_0029812_2037_2570 | 169 |
| 224 | 3300046531 | Ga0495665_0089558 | Ga0495665_0089558_901_1434 | 169 |
| 225 | 3300046533 | Ga0495640_0011298 | Ga0495640_0011298_129_662 | 169 |
| 226 | 3300046559 | Ga0495667_0007074 | Ga0495667_0007074_6924_7457 | 169 |
| 227 | 3300046642 | Ga0495634_0082943 | Ga0495634_0082943_1370_1903 | 169 |
| 228 | 3300046663 | Ga0495635_0019979 | Ga0495635_0019979_169_702 | 169 |
| 229 | 3300046681 | Ga0495647_0044412 | Ga0495647_0044412_201_734 | 169 |
| 230 | 3300046683 | Ga0495658_0002080 | Ga0495658_0002080_96_629 | 169 |
| 231 | 3300046689 | Ga0495613_0005986 | Ga0495613_0005986_185_718 | 169 |
| 232 | 3300046690 | Ga0495624_0008116 | Ga0495624_0008116_163_696 | 169 |
| 233 | 3300047315 | Ga0495581_0004661 | Ga0495581_0004661_163_696 | 169 |
| 234 | 3300047321 | Ga0495676_0016386 | Ga0495676_0016386_5866_6399 | 169 |
| 235 | 3300047322 | Ga0495680_0011414 | Ga0495680_0011414_7175_7708 | 169 |
| 236 | 3300047471 | Ga0495684_0017532 | Ga0495684_0017532_120_653 | 169 |
| 237 | 3300047673 | Ga0495593_0009147 | Ga0495593_0009147_190_723 | 169 |
| 238 | 3300053078 | Ga0495612_0228575 | Ga0495612_0228575_99_632 | 169 |
| 239 | 3300053084 | Ga0495595_0012041 | Ga0495595_0012041_2914_3447 | 169 |
| 240 | 3300053085 | Ga0495619_0006173 | Ga0495619_0006173_7000_7533 | 169 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6r01-assembly1.cif.gz_A | streptomyces lividans ccsp mutant - h107a/h111a | 0.7343 | 37 | 155 |
| 6qyb-assembly1.cif.gz_A | streptomyces lividans ccsp mutant - h111a | 0.7073 | 37 | 156 |
| 6q58-assembly1.cif.gz_A | copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) | 0.7049 | 34 | 154 |
| 6qvh-assembly1.cif.gz_A | streptomyces lividans ccsp mutant - h113a | 0.7022 | 37 | 156 |
| 6r01-assembly1.cif.gz_A | streptomyces lividans ccsp mutant - h107a/h111a | 0.6934 | 37 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8PY22_1_187_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.7235 | 34 | 163 | 1.20.140.150 |
| af_Q9D7D7_2_187_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.7035 | 34 | 163 | 1.20.140.150 |
| af_Q9LYT5_47_183_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.6996 | 25 | 157 | 1.20.140.40 |
| af_Q10482_16_111_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.6948 | 112 | 169 | 1.20.1280.290 |
| af_A0A0P0XBL1_35_175_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.6833 | 34 | 152 | 1.20.140.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538KQ31-F1-model_v4 | Uncharacterized protein | 0.8934 | 23 | 167 |
GO:0016020
|
| AF-A0A538CTZ6-F1-model_v4 | Uncharacterized protein | 0.8762 | 33 | 167 |
GO:0016020
|
| AF-A0A2P7AD67-F1-model_v4 | deleted | 0.8587 | 28 | 167 |
|
| AF-A0A2W6EIU0-F1-model_v4 | Na+/H+ antiporter MnhB subunit-related protein domain-containing protein | 0.8352 | 33 | 169 |
GO:0016020
|
| AF-A0A538CTZ6-F1-model_v4 | Uncharacterized protein | 0.8345 | 33 | 167 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar