F352491

General Info

Members Datasets Scaffolds Average Seq Length
240 143 480 233

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10091579|Ga0065714_100915793
Length 239
Sequence VSAGRILVVDDDPQIRRVMRVTLTAQGYEVDDARSGDEALEKLRERRSDLVLLDMNMPGLSGIEACRLIRADSEVGIIMLTVRDSEADKVEALDAGADDYVTKPFRTPELLARIRAALRRSPSARAAEIRHLALGPIEVDFEARRVQAGDRRVRLTPKELDVLRYLALHAGKVVPHRELLQAVWGPDYGDEVDYLRVIVNQLRKKIEADPSHPVYLLTEPWVGYRLQLSAPVSSRLSSS

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
94 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
95 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
96 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
141 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.25
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 3.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10091579 3300005288 Bacteria 1906
2 Ga0065712_10068409 3300005290 Bacteria 10860
3 Ga0065712_10155314 3300005290 Bacteria 1339
4 Ga0070683_100000007 3300005329 Bacteria 342155
5 Ga0070683_100520478 3300005329 Bacteria 1137
6 Ga0070690_100110977 3300005330 Bacteria 1830
7 Ga0070670_100047666 3300005331 Bacteria 3687
8 Ga0070670_100273716 3300005331 Bacteria 1474
9 Ga0070666_10259908 3300005335 Bacteria 1231
10 Ga0070687_100102654 3300005343 Bacteria 1604
11 Ga0070669_100070611 3300005353 Bacteria 2582
12 Ga0070675_100003846 3300005354 Bacteria 11393
13 Ga0070675_100045431 3300005354 Bacteria 3594
14 Ga0070671_100007537 3300005355 Bacteria 8703
15 Ga0070671_100325845 3300005355 Bacteria 1309
16 Ga0070673_100047857 3300005364 Bacteria 3330
17 Ga0070673_100215459 3300005364 Bacteria 1660
18 Ga0070673_100630375 3300005364 Bacteria 980
19 Ga0070688_100014798 3300005365 Bacteria 4426
20 Ga0070688_100050845 3300005365 Bacteria 2583
21 Ga0070688_100170137 3300005365 Bacteria 1503
22 Ga0070667_100015513 3300005367 Bacteria 6299
23 Ga0070667_100057570 3300005367 Bacteria 3286
24 Ga0070705_100217888 3300005440 Bacteria 1320
25 Ga0070678_100484361 3300005456 Unclassified 1089
26 Ga0070681_10082357 3300005458 Bacteria 3173
27 Ga0070685_10019282 3300005466 Bacteria 3678
28 Ga0070698_100341754 3300005471 Bacteria 1428
29 Ga0070698_100474812 3300005471 Bacteria 1187
30 Ga0070699_100002384 3300005518 Bacteria 16852
31 Ga0070679_100126671 3300005530 Bacteria 2536
32 Ga0070684_100000021 3300005535 Bacteria 132928
33 Ga0068853_100054970 3300005539 Bacteria 3431
34 Ga0070672_100010147 3300005543 Bacteria 6520
35 Ga0070696_100004590 3300005546 Bacteria 9224
36 Ga0070665_100280462 3300005548 Bacteria 1668
37 Ga0068855_100047593 3300005563 Bacteria 5066
38 Ga0068855_100083586 3300005563 Bacteria 3698
39 Ga0070664_100015490 3300005564 Bacteria 6237
40 Ga0068859_100016887 3300005617 Bacteria 7326
41 Ga0068859_100932347 3300005617 Bacteria 952
42 Ga0068864_100643918 3300005618 Bacteria 1031
43 Ga0068863_100004379 3300005841 Bacteria 13920
44 Ga0068863_100155157 3300005841 Bacteria 2192
45 Ga0068863_100174579 3300005841 Unclassified 2062
46 Ga0068863_100483814 3300005841 Bacteria 1218
47 Ga0068858_100036706 3300005842 Bacteria 4544
48 Ga0068858_100066719 3300005842 Bacteria 3332
49 Ga0068858_100239584 3300005842 Bacteria 1721
50 Ga0068860_100013622 3300005843 Bacteria 7970
51 Ga0081539_10008141 3300005985 Bacteria 9253
52 Ga0070717_10077956 3300006028 Bacteria 2776
53 Ga0097621_100079946 3300006237 Bacteria 2718
54 Ga0097621_100097711 3300006237 Bacteria 2466
55 Ga0068871_100005059 3300006358 Bacteria 9208
56 Ga0075428_100132019 3300006844 Bacteria 2716
57 Ga0075430_100058077 3300006846 Bacteria 3253
58 Ga0075430_100237321 3300006846 Bacteria 1511
59 Ga0075431_100004860 3300006847 Bacteria 13232
60 Ga0075431_100119125 3300006847 Bacteria 2724
61 Ga0075431_100718486 3300006847 Bacteria 976
62 Ga0075433_10075307 3300006852 Bacteria 2970
63 Ga0075433_10113786 3300006852 Bacteria 2401
64 Ga0075433_10116265 3300006852 Bacteria 2373
65 Ga0075434_100027328 3300006871 Bacteria 5602
66 Ga0075434_100160454 3300006871 Bacteria 2268
67 Ga0075434_100199166 3300006871 Bacteria 2022
68 Ga0075434_100722669 3300006871 Bacteria 1013
69 Ga0075434_101024243 3300006871 Bacteria 839
70 Ga0068865_100206746 3300006881 Bacteria 1527
71 Ga0068865_100240574 3300006881 Bacteria 1424
72 Ga0075436_100050115 3300006914 Bacteria 2881
73 Ga0097620_100016889 3300006931 Bacteria 7326
74 Ga0097620_100932501 3300006931 Bacteria 952
75 Ga0075435_100019804 3300007076 Bacteria 5147
76 Ga0075435_100079878 3300007076 Bacteria 2685
77 Ga0105240_10257462 3300009093 Bacteria 2015
78 Ga0114129_10000799 3300009147 Bacteria 40350
79 Ga0114129_10002966 3300009147 Bacteria 23747
80 Ga0114129_10248339 3300009147 Bacteria 2389
81 Ga0114129_10519758 3300009147 Bacteria 1552
82 Ga0105243_10179497 3300009148 Bacteria 1840
83 Ga0105241_10032814 3300009174 Bacteria 3896
84 Ga0105242_10074484 3300009176 Bacteria 2825
85 Ga0105248_10055425 3300009177 Bacteria 4446
86 Ga0105248_10190841 3300009177 Bacteria 2309
87 Ga0105248_10194261 3300009177 Bacteria 2287
88 Ga0105248_10239249 3300009177 Bacteria 2044
89 Ga0105248_11070299 3300009177 Bacteria 911
90 Ga0105237_10013357 3300009545 Bacteria 8614
91 Ga0105239_10052294 3300010375 Bacteria 4479
92 Ga0105239_10250999 3300010375 Bacteria 1987
93 Ga0157369_10042747 3300013105 Bacteria 4943
94 Ga0157374_10015787 3300013296 Bacteria 6633
95 Ga0157374_10137983 3300013296 Bacteria 2365
96 Ga0157374_10224983 3300013296 Bacteria 1842
97 Ga0157378_10041570 3300013297 Bacteria 4078
98 Ga0157378_10368110 3300013297 Bacteria 1408
99 Ga0157378_10617663 3300013297 Bacteria 1097
100 Ga0157378_11153370 3300013297 Bacteria 813
101 Ga0163162_10021203 3300013306 Bacteria 6394
102 Ga0163162_10031986 3300013306 Bacteria 5222
103 Ga0163162_10036843 3300013306 Bacteria 4878
104 Ga0163162_10149881 3300013306 Unclassified 2449
105 Ga0157375_10004342 3300013308 Bacteria 12308
106 Ga0157375_10074329 3300013308 Bacteria 3420
107 Ga0157375_10255764 3300013308 Bacteria 1913
108 Ga0157375_10390386 3300013308 Bacteria 1559
109 Ga0157375_10966558 3300013308 Bacteria 993
110 Ga0163163_10113168 3300014325 Bacteria 2744
111 Ga0163163_11087096 3300014325 Bacteria 863
112 Ga0157377_10086765 3300014745 Bacteria 1840
113 Ga0157379_10505224 3300014968 Bacteria 1121
114 Ga0157376_10010243 3300014969 Bacteria 6848
115 Ga0157376_10596933 3300014969 Bacteria 1098
116 Ga0163161_10005262 3300017792 Bacteria 9007
117 Ga0213876_10120573 3300021384 Bacteria 1392
118 Ga0207697_10038427 3300025315 Bacteria 1962
119 Ga0207642_10064712 3300025899 Bacteria 1715
120 Ga0207642_10128166 3300025899 Bacteria 1320
121 Ga0207645_10335951 3300025907 Bacteria 1009
122 Ga0207707_10249874 3300025912 Bacteria 1541
123 Ga0207695_10184236 3300025913 Bacteria 2008
124 Ga0207671_10493830 3300025914 Bacteria 976
125 Ga0207671_10596643 3300025914 Bacteria 880
126 Ga0207662_10061347 3300025918 Bacteria 2257
127 Ga0207652_10100545 3300025921 Bacteria 2553
128 Ga0207681_10124572 3300025923 Bacteria 1895
129 Ga0207650_10025198 3300025925 Bacteria 4236
130 Ga0207650_10097582 3300025925 Bacteria 2256
131 Ga0207659_10003469 3300025926 Bacteria 9455
132 Ga0207659_10005768 3300025926 Bacteria 7545
133 Ga0207659_10118183 3300025926 Bacteria 2027
134 Ga0207644_10028686 3300025931 Bacteria 3856
135 Ga0207670_10328657 3300025936 Bacteria 1205
136 Ga0207704_10032766 3300025938 Bacteria 2946
137 Ga0207691_10060571 3300025940 Bacteria 3439
138 Ga0207711_10062027 3300025941 Bacteria 3224
139 Ga0207711_10085316 3300025941 Bacteria 2767
140 Ga0207711_10639068 3300025941 Bacteria 993
141 Ga0207661_10000010 3300025944 Bacteria 375338
142 Ga0207661_10414383 3300025944 Bacteria 1223
143 Ga0207667_10218369 3300025949 Bacteria 1953
144 Ga0207668_10016648 3300025972 Bacteria 4593
145 Ga0207658_10315156 3300025986 Bacteria 1352
146 Ga0207703_10043303 3300026035 Bacteria 3613
147 Ga0207703_10071478 3300026035 Bacteria 2866
148 Ga0207703_10509990 3300026035 Bacteria 1130
149 Ga0207703_10598509 3300026035 Bacteria 1043
150 Ga0207641_10015759 3300026088 Bacteria 6192
151 Ga0207641_10516579 3300026088 Bacteria 1161
152 Ga0207648_10104214 3300026089 Bacteria 2487
153 Ga0207676_10721406 3300026095 Bacteria 967
154 Ga0207698_10110948 3300026142 Bacteria 2298
155 Ga0268266_10120107 3300028379 Bacteria 2338
156 Ga0268264_10055159 3300028381 Bacteria 3320
157 Ga0265325_10000825 3300031241 Bacteria 22507
158 Ga0316579_10032460 3300031691 Unclassified 2395
159 Ga0316577_10011819 3300031733 Unclassified 4739
160 Ga0373934_0054310 3300035086 Bacteria 1591
161 Ga0373945_0039250 3300035116 Bacteria 1706
162 Ga0373931_0298463 3300035691 Bacteria 994
163 Ga0373937_0230584 3300036401 Bacteria 1744
164 Ga0373937_0329348 3300036401 Bacteria 1445
165 Ga0373937_0412984 3300036401 Bacteria 1281
166 Ga0316582_0118519 3300036647 Unclassified 1769
167 Ga0316584_0185486 3300036712 Bacteria 1539
168 Ga0373925_0809438 3300037068 Bacteria 772
169 Ga0316581_0013675 3300037588 Unclassified 2305
170 Ga0436364_0202263 3300037853 Bacteria 63132
171 Ga0436364_1518717 3300037853 Bacteria 12270
172 Ga0451577_0190984 3300042876 Bacteria 1847
173 Ga0466959_0312232 3300045049 Bacteria 1076
174 Ga0495629_0116954 3300046459 Bacteria 1858
175 Ga0495580_0231181 3300046472 Bacteria 1269
176 Ga0495580_0346632 3300046472 Bacteria 1007
177 Ga0495608_0033176 3300046511 Bacteria 3492
178 Ga0495618_0306551 3300046514 Bacteria 986
179 Ga0495628_0029623 3300046516 Bacteria 4436
180 Ga0495628_0036014 3300046516 Bacteria 3975
181 Ga0495630_0001368 3300046517 Bacteria 16781
182 Ga0495665_0085560 3300046531 Bacteria 1657
183 Ga0495645_0121185 3300046543 Bacteria 1841
184 Ga0495658_0055766 3300046683 Bacteria 2252
185 Ga0495613_0000992 3300046689 Bacteria 21575
186 Ga0495604_0080544 3300047317 Bacteria 2440
187 Ga0495674_0028311 3300047319 Bacteria 5112
188 Ga0495674_0192528 3300047319 Bacteria 1694
189 Ga0495680_0541746 3300047322 Bacteria 785
190 Ga0495684_0001560 3300047471 Bacteria 18344
191 Ga0495684_0056774 3300047471 Bacteria 2984
192 Ga0495684_0462400 3300047471 Bacteria 879
193 Ga0496104_0011881 3300048907 Bacteria 7815
194 Ga0496104_0071157 3300048907 Bacteria 3307
195 Ga0496104_0120574 3300048907 Bacteria 2518
196 Ga0496106_0046107 3300048909 Bacteria 3276
197 Ga0496107_0032117 3300048910 Bacteria 3751
198 Ga0496108_0078867 3300048911 Bacteria 2788
199 Ga0496108_0136707 3300048911 Bacteria 2109
200 Ga0496110_0030143 3300048913 Bacteria 4675
201 Ga0496112_0039513 3300048915 Bacteria 4612
202 Ga0496112_0093949 3300048915 Bacteria 2969
203 Ga0496112_0151518 3300048915 Bacteria 2286
204 Ga0496113_0161189 3300048916 Bacteria 1773
205 Ga0496114_0003165 3300048917 Bacteria 12619
206 Ga0496114_0020408 3300048917 Bacteria 5378
207 Ga0496115_0346420 3300048918 Bacteria 1212
208 Ga0501047_0799449 3300049581 Bacteria 758
209 Ga0501048_0445838 3300049582 Bacteria 927
210 Ga0501081_0205367 3300049743 Bacteria 1430
211 nmdc:mga05p37_1193_c1 3300050507 Bacteria 30026
212 nmdc:mga05p37_282180_c1 3300050507 Bacteria 1980
213 nmdc:mga05p37_731481_c1 3300050507 Bacteria 1094
214 nmdc:mga05p37_84371_c1 3300050507 Unclassified 3914
215 nmdc:mga06r32_10715_c1 3300050510 Bacteria 8260
216 nmdc:mga06r32_13077_c1 3300050510 Bacteria 7511
217 nmdc:mga08y16_410123_c1 3300050511 Bacteria 1386
218 nmdc:mga0n895_197864_c1 3300050512 Bacteria 2041
219 nmdc:mga0n895_44717_c1 3300050512 Bacteria 4318
220 nmdc:mga0n895_62404_c1 3300050512 Bacteria 3683
221 nmdc:mga0n895_697645_c1 3300050512 Bacteria 1011
222 nmdc:mga0rr50_83967_c1 3300050513 Bacteria 2464
223 nmdc:mga08x19_13180_c1 3300050514 Bacteria 4993
224 nmdc:mga0a205_106580_c1 3300050515 Bacteria 2700
225 nmdc:mga0a205_119866_c1 3300050515 Bacteria 2530
226 nmdc:mga0a205_124430_c2 3300050515 Bacteria 838
227 nmdc:mga0a205_211214_c1 3300050515 Bacteria 1829
228 nmdc:mga0a205_432195_c1 3300050515 Bacteria 1178
229 Ga0495601_0004367 3300053077 Bacteria 8168
230 Ga0495601_0005346 3300053077 Bacteria 7481
231 Ga0495601_0099701 3300053077 Bacteria 1875
232 Ga0495601_0343064 3300053077 Bacteria 972
233 Ga0495601_0471867 3300053077 Bacteria 811
234 Ga0495612_0147896 3300053078 Bacteria 1021
235 Ga0495595_0005594 3300053084 Bacteria 5086
236 Ga0495619_0001007 3300053085 Bacteria 18431
237 Ga0495619_0003650 3300053085 Bacteria 9919
238 Ga0495619_0143038 3300053085 Bacteria 1648
239 Ga0495619_0341268 3300053085 Bacteria 1037
240 Ga0501082_0968481 3300060353 Bacteria 744
241 Ga0065714_10091579
242 Ga0065712_10068409
243 Ga0065712_10155314
244 Ga0070683_100000007
245 Ga0070683_100520478
246 Ga0070690_100110977
247 Ga0070670_100047666
248 Ga0070670_100273716
249 Ga0070666_10259908
250 Ga0070687_100102654
251 Ga0070669_100070611
252 Ga0070675_100003846
253 Ga0070675_100045431
254 Ga0070671_100007537
255 Ga0070671_100325845
256 Ga0070673_100047857
257 Ga0070673_100215459
258 Ga0070673_100630375
259 Ga0070688_100014798
260 Ga0070688_100050845
261 Ga0070688_100170137
262 Ga0070667_100015513
263 Ga0070667_100057570
264 Ga0070705_100217888
265 Ga0070678_100484361
266 Ga0070681_10082357
267 Ga0070685_10019282
268 Ga0070698_100341754
269 Ga0070698_100474812
270 Ga0070699_100002384
271 Ga0070679_100126671
272 Ga0070684_100000021
273 Ga0068853_100054970
274 Ga0070672_100010147
275 Ga0070696_100004590
276 Ga0070665_100280462
277 Ga0068855_100047593
278 Ga0068855_100083586
279 Ga0070664_100015490
280 Ga0068859_100016887
281 Ga0068859_100932347
282 Ga0068864_100643918
283 Ga0068863_100004379
284 Ga0068863_100155157
285 Ga0068863_100174579
286 Ga0068863_100483814
287 Ga0068858_100036706
288 Ga0068858_100066719
289 Ga0068858_100239584
290 Ga0068860_100013622
291 Ga0081539_10008141
292 Ga0070717_10077956
293 Ga0097621_100079946
294 Ga0097621_100097711
295 Ga0068871_100005059
296 Ga0075428_100132019
297 Ga0075430_100058077
298 Ga0075430_100237321
299 Ga0075431_100004860
300 Ga0075431_100119125
301 Ga0075431_100718486
302 Ga0075433_10075307
303 Ga0075433_10113786
304 Ga0075433_10116265
305 Ga0075434_100027328
306 Ga0075434_100160454
307 Ga0075434_100199166
308 Ga0075434_100722669
309 Ga0075434_101024243
310 Ga0068865_100206746
311 Ga0068865_100240574
312 Ga0075436_100050115
313 Ga0097620_100016889
314 Ga0097620_100932501
315 Ga0075435_100019804
316 Ga0075435_100079878
317 Ga0105240_10257462
318 Ga0114129_10000799
319 Ga0114129_10002966
320 Ga0114129_10248339
321 Ga0114129_10519758
322 Ga0105243_10179497
323 Ga0105241_10032814
324 Ga0105242_10074484
325 Ga0105248_10055425
326 Ga0105248_10190841
327 Ga0105248_10194261
328 Ga0105248_10239249
329 Ga0105248_11070299
330 Ga0105237_10013357
331 Ga0105239_10052294
332 Ga0105239_10250999
333 Ga0157369_10042747
334 Ga0157374_10015787
335 Ga0157374_10137983
336 Ga0157374_10224983
337 Ga0157378_10041570
338 Ga0157378_10368110
339 Ga0157378_10617663
340 Ga0157378_11153370
341 Ga0163162_10021203
342 Ga0163162_10031986
343 Ga0163162_10036843
344 Ga0163162_10149881
345 Ga0157375_10004342
346 Ga0157375_10074329
347 Ga0157375_10255764
348 Ga0157375_10390386
349 Ga0157375_10966558
350 Ga0163163_10113168
351 Ga0163163_11087096
352 Ga0157377_10086765
353 Ga0157379_10505224
354 Ga0157376_10010243
355 Ga0157376_10596933
356 Ga0163161_10005262
357 Ga0213876_10120573
358 Ga0207697_10038427
359 Ga0207642_10064712
360 Ga0207642_10128166
361 Ga0207645_10335951
362 Ga0207707_10249874
363 Ga0207695_10184236
364 Ga0207671_10493830
365 Ga0207671_10596643
366 Ga0207662_10061347
367 Ga0207652_10100545
368 Ga0207681_10124572
369 Ga0207650_10025198
370 Ga0207650_10097582
371 Ga0207659_10003469
372 Ga0207659_10005768
373 Ga0207659_10118183
374 Ga0207644_10028686
375 Ga0207670_10328657
376 Ga0207704_10032766
377 Ga0207691_10060571
378 Ga0207711_10062027
379 Ga0207711_10085316
380 Ga0207711_10639068
381 Ga0207661_10000010
382 Ga0207661_10414383
383 Ga0207667_10218369
384 Ga0207668_10016648
385 Ga0207658_10315156
386 Ga0207703_10043303
387 Ga0207703_10071478
388 Ga0207703_10509990
389 Ga0207703_10598509
390 Ga0207641_10015759
391 Ga0207641_10516579
392 Ga0207648_10104214
393 Ga0207676_10721406
394 Ga0207698_10110948
395 Ga0268266_10120107
396 Ga0268264_10055159
397 Ga0265325_10000825
398 Ga0316579_10032460
399 Ga0316577_10011819
400 Ga0373934_0054310
401 Ga0373945_0039250
402 Ga0373931_0298463
403 Ga0373937_0230584
404 Ga0373937_0329348
405 Ga0373937_0412984
406 Ga0316582_0118519
407 Ga0316584_0185486
408 Ga0373925_0809438
409 Ga0316581_0013675
410 Ga0436364_0202263
411 Ga0436364_1518717
412 Ga0451577_0190984
413 Ga0466959_0312232
414 Ga0495629_0116954
415 Ga0495580_0231181
416 Ga0495580_0346632
417 Ga0495608_0033176
418 Ga0495618_0306551
419 Ga0495628_0029623
420 Ga0495628_0036014
421 Ga0495630_0001368
422 Ga0495665_0085560
423 Ga0495645_0121185
424 Ga0495658_0055766
425 Ga0495613_0000992
426 Ga0495604_0080544
427 Ga0495674_0028311
428 Ga0495674_0192528
429 Ga0495680_0541746
430 Ga0495684_0001560
431 Ga0495684_0056774
432 Ga0495684_0462400
433 Ga0496104_0011881
434 Ga0496104_0071157
435 Ga0496104_0120574
436 Ga0496106_0046107
437 Ga0496107_0032117
438 Ga0496108_0078867
439 Ga0496108_0136707
440 Ga0496110_0030143
441 Ga0496112_0039513
442 Ga0496112_0093949
443 Ga0496112_0151518
444 Ga0496113_0161189
445 Ga0496114_0003165
446 Ga0496114_0020408
447 Ga0496115_0346420
448 Ga0501047_0799449
449 Ga0501048_0445838
450 Ga0501081_0205367
451 nmdc:mga05p37_1193_c1
452 nmdc:mga05p37_282180_c1
453 nmdc:mga05p37_731481_c1
454 nmdc:mga05p37_84371_c1
455 nmdc:mga06r32_10715_c1
456 nmdc:mga06r32_13077_c1
457 nmdc:mga08y16_410123_c1
458 nmdc:mga0n895_197864_c1
459 nmdc:mga0n895_44717_c1
460 nmdc:mga0n895_62404_c1
461 nmdc:mga0n895_697645_c1
462 nmdc:mga0rr50_83967_c1
463 nmdc:mga08x19_13180_c1
464 nmdc:mga0a205_106580_c1
465 nmdc:mga0a205_119866_c1
466 nmdc:mga0a205_124430_c2
467 nmdc:mga0a205_211214_c1
468 nmdc:mga0a205_432195_c1
469 Ga0495601_0004367
470 Ga0495601_0005346
471 Ga0495601_0099701
472 Ga0495601_0343064
473 Ga0495601_0471867
474 Ga0495612_0147896
475 Ga0495595_0005594
476 Ga0495619_0001007
477 Ga0495619_0003650
478 Ga0495619_0143038
479 Ga0495619_0341268
480 Ga0501082_0968481

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

6

115

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

150

226

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9777 5 121
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.976 4 120
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9759 4 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9695 5 121
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9663 4 120
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9787 5 81 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9739 4 79 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9731 1 81 3.40.50.2300
af_Q2FVQ9_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9728 5 81 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9723 4 79 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7X5VMK3-F1-model_v4 Response regulator 0.95 5 227 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3M1MUX9-F1-model_v4 DNA-binding response regulator 0.946 1 230 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-I4EKR3-F1-model_v4 Putative transcriptional regulator ycf27 0.9411 1 232 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1Q7N6Z8-F1-model_v4 DNA-binding response regulator 0.9408 1 194 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2G8DMW7-F1-model_v4 Transcriptional regulator 0.9405 5 231 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map