F352244

General Info

Members Datasets Scaffolds Average Seq Length
239 125 478 243

Family's Representative Sequence

Representative Sequence 3300046679|Ga0495623_0193707|Ga0495623_0193707_16_864
Length 282
Sequence VLELDHVERKPQAFPEHKALTIVSFYRHPPPCYSDVRADICDMLEAFSLSDKGCVRANNEDYCFIDAERGLYILADGMGGAKAGERASRIAVETVAETIRSSPLRDSQVLIRAAEEANRRVLEAANNDPSLEGMGTTLVAALELEEELAIASVGDSRAYMLDDRGLHVITDDQTWVNEVGRPLGLDEESLRHHPMRHVLTMAIGASAPLTINHYRVPLAKGNLVLICSDGLHGVLEAPLMEEILNGGRDGVSLEESCRHLIDAAKQAGGPDNVTAVLMRKIG

Samples

Sample ID Description Type Environment
1 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.42
Rhizosphere 84.52
Stem 0
Stem Tuber 0
Unclassified 26.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495623_0193707 3300046679 Unclassified 1173
2 Ga0070683_100000047 3300005329 Bacteria 94142
3 Ga0070683_100021393 3300005329 Bacteria 5774
4 Ga0070683_100242572 3300005329 Unclassified 1714
5 Ga0070689_100206247 3300005340 Bacteria 1607
6 Ga0070673_100443275 3300005364 Unclassified 1167
7 Ga0070667_100531785 3300005367 Bacteria 1079
8 Ga0070667_100783182 3300005367 Unclassified 885
9 Ga0070714_100044047 3300005435 Bacteria 3777
10 Ga0070713_100002584 3300005436 Bacteria 11843
11 Ga0070713_100030286 3300005436 Bacteria 4297
12 Ga0070713_100156640 3300005436 Bacteria 2031
13 Ga0070711_100050364 3300005439 Bacteria 2856
14 Ga0070678_100735658 3300005456 Unclassified 891
15 Ga0070684_100154902 3300005535 Bacteria 2078
16 Ga0070684_100257714 3300005535 Unclassified 1595
17 Ga0070684_100535779 3300005535 Bacteria 1086
18 Ga0070697_100021654 3300005536 Bacteria 5095
19 Ga0068853_100901599 3300005539 Bacteria 849
20 Ga0070665_100009687 3300005548 Bacteria 9735
21 Ga0068855_100084840 3300005563 Bacteria 3666
22 Ga0068855_100174387 3300005563 Bacteria 2434
23 Ga0068856_100010620 3300005614 Bacteria 8948
24 Ga0068852_100204891 3300005616 Bacteria 1868
25 Ga0068859_100245575 3300005617 Bacteria 1880
26 Ga0068859_100254231 3300005617 Bacteria 1847
27 Ga0068864_100145432 3300005618 Bacteria 2143
28 Ga0068863_100066273 3300005841 Bacteria 3416
29 Ga0068863_100651451 3300005841 Unclassified 1045
30 Ga0068858_100003926 3300005842 Bacteria 14684
31 Ga0068860_100063368 3300005843 Bacteria 3512
32 Ga0070717_10030663 3300006028 Bacteria 4320
33 Ga0097621_100443908 3300006237 Bacteria 1168
34 Ga0068871_100098097 3300006358 Bacteria 2451
35 Ga0068871_100137988 3300006358 Unclassified 2072
36 Ga0068871_100175376 3300006358 Bacteria 1840
37 Ga0075434_100713422 3300006871 Unclassified 1020
38 Ga0097620_100245577 3300006931 Bacteria 1880
39 Ga0097620_100254227 3300006931 Bacteria 1847
40 Ga0097620_100716944 3300006931 Bacteria 1090
41 Ga0105240_10009368 3300009093 Bacteria 13878
42 Ga0105240_10125875 3300009093 Bacteria 3079
43 Ga0105240_10462275 3300009093 Bacteria 1418
44 Ga0111539_10592711 3300009094 Unclassified 1291
45 Ga0111539_10777815 3300009094 Unclassified 1114
46 Ga0105245_10128388 3300009098 Bacteria 2375
47 Ga0105245_10285907 3300009098 Unclassified 1614
48 Ga0105245_10322927 3300009098 Bacteria 1521
49 Ga0105245_10524044 3300009098 Unclassified 1204
50 Ga0105243_10018168 3300009148 Bacteria 5323
51 Ga0105243_10303854 3300009148 Bacteria 1447
52 Ga0105241_10503161 3300009174 Unclassified 1081
53 Ga0105242_10555627 3300009176 Bacteria 1101
54 Ga0105248_10009610 3300009177 Bacteria 10647
55 Ga0105248_10023747 3300009177 Bacteria 6813
56 Ga0105248_10118477 3300009177 Bacteria 2987
57 Ga0105248_10211078 3300009177 Unclassified 2187
58 Ga0105248_10259383 3300009177 Bacteria 1957
59 Ga0105248_10294597 3300009177 Bacteria 1827
60 Ga0105248_10355092 3300009177 Bacteria 1650
61 Ga0105248_11379597 3300009177 Unclassified 797
62 Ga0105237_10192641 3300009545 Unclassified 2038
63 Ga0105237_10202406 3300009545 Unclassified 1986
64 Ga0105237_10413815 3300009545 Bacteria 1353
65 Ga0105249_10100199 3300009553 Bacteria 2724
66 Ga0105239_10278517 3300010375 Bacteria 1882
67 Ga0105239_10420801 3300010375 Bacteria 1513
68 Ga0105246_10002285 3300011119 Bacteria 11554
69 Ga0157369_10045667 3300013105 Bacteria 4762
70 Ga0157374_10408512 3300013296 Unclassified 1355
71 Ga0157378_10164825 3300013297 Unclassified 2075
72 Ga0157378_10252755 3300013297 Bacteria 1688
73 Ga0163162_10140324 3300013306 Bacteria 2530
74 Ga0163162_10202891 3300013306 Bacteria 2112
75 Ga0163162_10435210 3300013306 Unclassified 1444
76 Ga0163162_10507349 3300013306 Bacteria 1336
77 Ga0157372_10597540 3300013307 Bacteria 1286
78 Ga0157372_10792059 3300013307 Bacteria 1101
79 Ga0157375_10004198 3300013308 Bacteria 12508
80 Ga0157375_10042627 3300013308 Bacteria 4393
81 Ga0157375_10791516 3300013308 Bacteria 1097
82 Ga0163163_10018100 3300014325 Bacteria 6584
83 Ga0163163_10789597 3300014325 Unclassified 1013
84 Ga0163163_11140056 3300014325 Unclassified 842
85 Ga0157376_10062586 3300014969 Bacteria 3131
86 Ga0213874_10020711 3300021377 Bacteria 1806
87 Ga0213874_10073613 3300021377 Bacteria 1094
88 Ga0213876_10009340 3300021384 Bacteria 5280
89 Ga0213876_10072731 3300021384 Bacteria 1815
90 Ga0213876_10138687 3300021384 Bacteria 1293
91 Ga0213876_10287782 3300021384 Bacteria 873
92 Ga0213875_10028615 3300021388 Unclassified 2644
93 Ga0213875_10054671 3300021388 Bacteria 1870
94 Ga0213875_10109970 3300021388 Bacteria 1287
95 Ga0213875_10150424 3300021388 Bacteria 1091
96 Ga0213875_10291057 3300021388 Unclassified 772
97 Ga0207695_10050080 3300025913 Bacteria 4397
98 Ga0207695_10370805 3300025913 Bacteria 1318
99 Ga0207695_10373641 3300025913 Unclassified 1312
100 Ga0207693_10064251 3300025915 Bacteria 2874
101 Ga0207660_10539872 3300025917 Bacteria 948
102 Ga0207694_10524098 3300025924 Bacteria 993
103 Ga0207659_10633433 3300025926 Unclassified 913
104 Ga0207687_10254013 3300025927 Unclassified 1399
105 Ga0207700_10015037 3300025928 Bacteria 5091
106 Ga0207700_10022856 3300025928 Bacteria 4297
107 Ga0207700_10074506 3300025928 Bacteria 2626
108 Ga0207700_10470514 3300025928 Bacteria 1110
109 Ga0207664_10003723 3300025929 Bacteria 10235
110 Ga0207664_10009172 3300025929 Bacteria 6934
111 Ga0207686_10402985 3300025934 Bacteria 1042
112 Ga0207709_10043186 3300025935 Bacteria 2716
113 Ga0207709_10253283 3300025935 Unclassified 1287
114 Ga0207670_10281404 3300025936 Bacteria 1296
115 Ga0207691_10646656 3300025940 Bacteria 894
116 Ga0207711_10002885 3300025941 Bacteria 15065
117 Ga0207711_10237902 3300025941 Bacteria 1669
118 Ga0207661_10000023 3300025944 Bacteria 197512
119 Ga0207661_10075945 3300025944 Bacteria 2759
120 Ga0207661_10228262 3300025944 Unclassified 1648
121 Ga0207667_10305785 3300025949 Bacteria 1624
122 Ga0207658_10196483 3300025986 Bacteria 1681
123 Ga0207658_10664604 3300025986 Unclassified 940
124 Ga0207677_10792759 3300026023 Unclassified 848
125 Ga0207703_10015510 3300026035 Bacteria 5940
126 Ga0207708_10872660 3300026075 Unclassified 778
127 Ga0207702_10084646 3300026078 Unclassified 2762
128 Ga0207641_10148208 3300026088 Bacteria 2123
129 Ga0207641_10549343 3300026088 Unclassified 1126
130 Ga0207683_10413703 3300026121 Unclassified 1241
131 Ga0207698_10178211 3300026142 Bacteria 1879
132 Ga0268266_10020089 3300028379 Bacteria 5693
133 Ga0268266_10368210 3300028379 Bacteria 1353
134 Ga0265323_10005842 3300028653 Bacteria 5204
135 Ga0265338_10056234 3300028800 Bacteria 3492
136 Ga0265331_10072985 3300031250 Viruses 1603
137 Ga0265331_10095567 3300031250 Unclassified 1371
138 Ga0265316_10001748 3300031344 Bacteria 23044
139 Ga0265316_10003802 3300031344 Bacteria 15166
140 Ga0265316_10007822 3300031344 Bacteria 10006
141 Ga0265316_10031736 3300031344 Bacteria 4317
142 Ga0265316_10040356 3300031344 Bacteria 3742
143 Ga0265314_10134540 3300031711 Bacteria 1537
144 Ga0265342_10060332 3300031712 Bacteria 2237
145 Ga0265342_10284499 3300031712 Unclassified 874
146 Ga0373954_0163375 3300035118 Bacteria 1090
147 Ga0373935_0020763 3300035692 Unclassified 4016
148 Ga0373927_0178683 3300035695 Unclassified 1392
149 Ga0373933_0035472 3300035724 Bacteria 2913
150 Ga0373947_0051263 3300035725 Unclassified 2483
151 Ga0373947_0143132 3300035725 Bacteria 1535
152 Ga0373947_0304638 3300035725 Bacteria 1063
153 Ga0373937_0016573 3300036401 Bacteria 6545
154 Ga0373937_0285582 3300036401 Bacteria 1559
155 Ga0373925_0504739 3300037068 Bacteria 993
156 Ga0436364_0291314 3300037853 Unclassified 2642
157 Ga0436364_0335417 3300037853 Bacteria 1600
158 Ga0436364_0454244 3300037853 Bacteria 17441
159 Ga0436364_0501006 3300037853 Bacteria 3305
160 Ga0436364_0842442 3300037853 Bacteria 1430
161 Ga0436364_0972903 3300037853 Bacteria 1868
162 Ga0436364_1016627 3300037853 Bacteria 4848
163 Ga0436364_1070577 3300037853 Bacteria 1205
164 Ga0436364_1077504 3300037853 Bacteria 5675
165 Ga0436364_1090830 3300037853 Bacteria 15513
166 Ga0436364_1099941 3300037853 Unclassified 2111
167 Ga0436364_1149009 3300037853 Bacteria 4125
168 Ga0436364_1229765 3300037853 Bacteria 1692
169 Ga0436364_1452710 3300037853 Bacteria 2953
170 Ga0436365_0238978 3300039437 Bacteria 2236
171 Ga0436365_0478205 3300039437 Unclassified 3387
172 Ga0436365_0547943 3300039437 Bacteria 13340
173 Ga0436365_0770571 3300039437 Bacteria 1565
174 Ga0436365_0818631 3300039437 Bacteria 1340
175 Ga0436365_1532948 3300039437 Bacteria 4002
176 Ga0436365_1720053 3300039437 Bacteria 1010
177 Ga0436365_1828942 3300039437 Bacteria 1946
178 Ga0436360_1327043 3300039438 Bacteria 1486
179 Ga0436363_0231453 3300039450 Bacteria 4733
180 Ga0436363_0705074 3300039450 Unclassified 1127
181 Ga0436363_1384971 3300039450 Bacteria 1694
182 Ga0436362_0462610 3300039453 Unclassified 2302
183 Ga0436362_1162162 3300039453 Bacteria 1286
184 Ga0436362_1257735 3300039453 Bacteria 1384
185 Ga0466966_0085031 3300044684 Bacteria 1967
186 Ga0466957_0474941 3300044842 Unclassified 864
187 Ga0451576_0069793 3300045051 Bacteria 3657
188 Ga0495592_0257168 3300046454 Bacteria 1152
189 Ga0495651_0031336 3300046462 Unclassified 4146
190 Ga0495651_0074904 3300046462 Bacteria 2567
191 Ga0495653_0019769 3300046463 Bacteria 5461
192 Ga0495580_0000396 3300046472 Bacteria 35673
193 Ga0495580_0004603 3300046472 Bacteria 11574
194 Ga0495580_0127585 3300046472 Bacteria 1766
195 Ga0495580_0187040 3300046472 Unclassified 1429
196 Ga0495580_0229813 3300046472 Bacteria 1274
197 Ga0495662_0005345 3300046476 Bacteria 6432
198 Ga0495664_0004053 3300046477 Bacteria 7986
199 Ga0495608_0040582 3300046511 Unclassified 3118
200 Ga0495608_0181954 3300046511 Bacteria 1329
201 Ga0495628_0004865 3300046516 Bacteria 11822
202 Ga0495628_0359122 3300046516 Bacteria 1070
203 Ga0495628_0444681 3300046516 Bacteria 942
204 Ga0495630_0077700 3300046517 Unclassified 2502
205 Ga0495642_0056118 3300046528 Bacteria 1627
206 Ga0495652_0012693 3300046529 Bacteria 7590
207 Ga0495640_0054794 3300046533 Unclassified 2730
208 Ga0495645_0001931 3300046543 Bacteria 14075
209 Ga0495645_0053690 3300046543 Bacteria 2929
210 Ga0495667_0052303 3300046559 Bacteria 2691
211 Ga0495667_0056273 3300046559 Unclassified 2586
212 Ga0495634_0008558 3300046642 Bacteria 7604
213 Ga0495635_0005861 3300046663 Bacteria 8563
214 Ga0495635_0217429 3300046663 Unclassified 1293
215 Ga0495657_0224901 3300046675 Bacteria 1137
216 Ga0495599_0006543 3300046678 Bacteria 7030
217 Ga0495599_0021099 3300046678 Unclassified 4061
218 Ga0495623_0009260 3300046679 Bacteria 6393
219 Ga0495623_0050594 3300046679 Bacteria 2631
220 Ga0495581_0408130 3300047315 Unclassified 792
221 Ga0495604_0173117 3300047317 Bacteria 1516
222 Ga0495674_0007166 3300047319 Bacteria 10663
223 Ga0495674_0027564 3300047319 Bacteria 5190
224 Ga0495674_0318253 3300047319 Bacteria 1268
225 Ga0495674_0376790 3300047319 Unclassified 1149
226 Ga0495680_0052039 3300047322 Unclassified 3194
227 Ga0495675_0216739 3300047444 Bacteria 1160
228 Ga0495675_0387133 3300047444 Unclassified 817
229 Ga0495684_0032113 3300047471 Bacteria 4029
230 Ga0495684_0034096 3300047471 Bacteria 3906
231 Ga0495684_0121087 3300047471 Bacteria 1970
232 Ga0495602_0013859 3300048088 Bacteria 8219
233 Ga0496105_0569855 3300048908 Unclassified 882
234 nmdc:mga05p37_358811_c1 3300050507 Unclassified 1714
235 nmdc:mga06r32_111103_c1 3300050510 Bacteria 2697
236 nmdc:mga0n895_646911_c1 3300050512 Unclassified 1056
237 Ga0495601_0189787 3300053077 Bacteria 1343
238 Ga0495619_0513256 3300053085 Unclassified 824
239 Ga0501082_0009592 3300060353 Bacteria 8332
240 Ga0495623_0193707
241 Ga0070683_100000047
242 Ga0070683_100021393
243 Ga0070683_100242572
244 Ga0070689_100206247
245 Ga0070673_100443275
246 Ga0070667_100531785
247 Ga0070667_100783182
248 Ga0070714_100044047
249 Ga0070713_100002584
250 Ga0070713_100030286
251 Ga0070713_100156640
252 Ga0070711_100050364
253 Ga0070678_100735658
254 Ga0070684_100154902
255 Ga0070684_100257714
256 Ga0070684_100535779
257 Ga0070697_100021654
258 Ga0068853_100901599
259 Ga0070665_100009687
260 Ga0068855_100084840
261 Ga0068855_100174387
262 Ga0068856_100010620
263 Ga0068852_100204891
264 Ga0068859_100245575
265 Ga0068859_100254231
266 Ga0068864_100145432
267 Ga0068863_100066273
268 Ga0068863_100651451
269 Ga0068858_100003926
270 Ga0068860_100063368
271 Ga0070717_10030663
272 Ga0097621_100443908
273 Ga0068871_100098097
274 Ga0068871_100137988
275 Ga0068871_100175376
276 Ga0075434_100713422
277 Ga0097620_100245577
278 Ga0097620_100254227
279 Ga0097620_100716944
280 Ga0105240_10009368
281 Ga0105240_10125875
282 Ga0105240_10462275
283 Ga0111539_10592711
284 Ga0111539_10777815
285 Ga0105245_10128388
286 Ga0105245_10285907
287 Ga0105245_10322927
288 Ga0105245_10524044
289 Ga0105243_10018168
290 Ga0105243_10303854
291 Ga0105241_10503161
292 Ga0105242_10555627
293 Ga0105248_10009610
294 Ga0105248_10023747
295 Ga0105248_10118477
296 Ga0105248_10211078
297 Ga0105248_10259383
298 Ga0105248_10294597
299 Ga0105248_10355092
300 Ga0105248_11379597
301 Ga0105237_10192641
302 Ga0105237_10202406
303 Ga0105237_10413815
304 Ga0105249_10100199
305 Ga0105239_10278517
306 Ga0105239_10420801
307 Ga0105246_10002285
308 Ga0157369_10045667
309 Ga0157374_10408512
310 Ga0157378_10164825
311 Ga0157378_10252755
312 Ga0163162_10140324
313 Ga0163162_10202891
314 Ga0163162_10435210
315 Ga0163162_10507349
316 Ga0157372_10597540
317 Ga0157372_10792059
318 Ga0157375_10004198
319 Ga0157375_10042627
320 Ga0157375_10791516
321 Ga0163163_10018100
322 Ga0163163_10789597
323 Ga0163163_11140056
324 Ga0157376_10062586
325 Ga0213874_10020711
326 Ga0213874_10073613
327 Ga0213876_10009340
328 Ga0213876_10072731
329 Ga0213876_10138687
330 Ga0213876_10287782
331 Ga0213875_10028615
332 Ga0213875_10054671
333 Ga0213875_10109970
334 Ga0213875_10150424
335 Ga0213875_10291057
336 Ga0207695_10050080
337 Ga0207695_10370805
338 Ga0207695_10373641
339 Ga0207693_10064251
340 Ga0207660_10539872
341 Ga0207694_10524098
342 Ga0207659_10633433
343 Ga0207687_10254013
344 Ga0207700_10015037
345 Ga0207700_10022856
346 Ga0207700_10074506
347 Ga0207700_10470514
348 Ga0207664_10003723
349 Ga0207664_10009172
350 Ga0207686_10402985
351 Ga0207709_10043186
352 Ga0207709_10253283
353 Ga0207670_10281404
354 Ga0207691_10646656
355 Ga0207711_10002885
356 Ga0207711_10237902
357 Ga0207661_10000023
358 Ga0207661_10075945
359 Ga0207661_10228262
360 Ga0207667_10305785
361 Ga0207658_10196483
362 Ga0207658_10664604
363 Ga0207677_10792759
364 Ga0207703_10015510
365 Ga0207708_10872660
366 Ga0207702_10084646
367 Ga0207641_10148208
368 Ga0207641_10549343
369 Ga0207683_10413703
370 Ga0207698_10178211
371 Ga0268266_10020089
372 Ga0268266_10368210
373 Ga0265323_10005842
374 Ga0265338_10056234
375 Ga0265331_10072985
376 Ga0265331_10095567
377 Ga0265316_10001748
378 Ga0265316_10003802
379 Ga0265316_10007822
380 Ga0265316_10031736
381 Ga0265316_10040356
382 Ga0265314_10134540
383 Ga0265342_10060332
384 Ga0265342_10284499
385 Ga0373954_0163375
386 Ga0373935_0020763
387 Ga0373927_0178683
388 Ga0373933_0035472
389 Ga0373947_0051263
390 Ga0373947_0143132
391 Ga0373947_0304638
392 Ga0373937_0016573
393 Ga0373937_0285582
394 Ga0373925_0504739
395 Ga0436364_0291314
396 Ga0436364_0335417
397 Ga0436364_0454244
398 Ga0436364_0501006
399 Ga0436364_0842442
400 Ga0436364_0972903
401 Ga0436364_1016627
402 Ga0436364_1070577
403 Ga0436364_1077504
404 Ga0436364_1090830
405 Ga0436364_1099941
406 Ga0436364_1149009
407 Ga0436364_1229765
408 Ga0436364_1452710
409 Ga0436365_0238978
410 Ga0436365_0478205
411 Ga0436365_0547943
412 Ga0436365_0770571
413 Ga0436365_0818631
414 Ga0436365_1532948
415 Ga0436365_1720053
416 Ga0436365_1828942
417 Ga0436360_1327043
418 Ga0436363_0231453
419 Ga0436363_0705074
420 Ga0436363_1384971
421 Ga0436362_0462610
422 Ga0436362_1162162
423 Ga0436362_1257735
424 Ga0466966_0085031
425 Ga0466957_0474941
426 Ga0451576_0069793
427 Ga0495592_0257168
428 Ga0495651_0031336
429 Ga0495651_0074904
430 Ga0495653_0019769
431 Ga0495580_0000396
432 Ga0495580_0004603
433 Ga0495580_0127585
434 Ga0495580_0187040
435 Ga0495580_0229813
436 Ga0495662_0005345
437 Ga0495664_0004053
438 Ga0495608_0040582
439 Ga0495608_0181954
440 Ga0495628_0004865
441 Ga0495628_0359122
442 Ga0495628_0444681
443 Ga0495630_0077700
444 Ga0495642_0056118
445 Ga0495652_0012693
446 Ga0495640_0054794
447 Ga0495645_0001931
448 Ga0495645_0053690
449 Ga0495667_0052303
450 Ga0495667_0056273
451 Ga0495634_0008558
452 Ga0495635_0005861
453 Ga0495635_0217429
454 Ga0495657_0224901
455 Ga0495599_0006543
456 Ga0495599_0021099
457 Ga0495623_0009260
458 Ga0495623_0050594
459 Ga0495581_0408130
460 Ga0495604_0173117
461 Ga0495674_0007166
462 Ga0495674_0027564
463 Ga0495674_0318253
464 Ga0495674_0376790
465 Ga0495680_0052039
466 Ga0495675_0216739
467 Ga0495675_0387133
468 Ga0495684_0032113
469 Ga0495684_0034096
470 Ga0495684_0121087
471 Ga0495602_0013859
472 Ga0496105_0569855
473 nmdc:mga05p37_358811_c1
474 nmdc:mga06r32_111103_c1
475 nmdc:mga0n895_646911_c1
476 Ga0495601_0189787
477 Ga0495619_0513256
478 Ga0501082_0009592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00481

PP2C

Protein phosphatase 2C

40

179

0.78

PF13672

PP2C_2

Protein phosphatase 2C

55

278

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d2u-assembly1.cif.gz_A crystal structure of tppha variant - h39a 0.9096 1 231
2j82-assembly1.cif.gz_A-2 structural analysis of the pp2c family phosphatase tppha from thermosynechococcus elongatus 0.909 1 231
2y09-assembly1.cif.gz_A the cyanobacterial pp2c-like phosphatase tppha requires three metals in the catalytic center for efficient catalysis 0.8991 1 231
2j86-assembly2.cif.gz_B structural analysis of the pp2c family phosphatase tppha of thermosynechococcus elongatus 0.8982 1 231
2j86-assembly1.cif.gz_A structural analysis of the pp2c family phosphatase tppha of thermosynechococcus elongatus 0.8976 1 231
ID Description Score Start End Superfamily
5d2uA00 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.9096 1 231 3.60.40.10
5d2uA00 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.8947 1 231 3.60.40.10
2cm1A00 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.8913 1 229 3.60.40.10
5f1mA00 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.8798 1 234 3.60.40.10
5f1mA00 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.8763 1 234 3.60.40.10
ID Description Score Start End GO Terms
AF-A0A2V8U3I0-F1-model_v4 Serine/threonine-protein phosphatase 0.9432 16 172
AF-A0A538ME54-F1-model_v4 Stp1/IreP family PP2C-type Ser/Thr phosphatase 0.9372 1 231 GO:0004722
GO:0016020
AF-A0A833ANF6-F1-model_v4 Stp1/IreP family PP2C-type Ser/Thr phosphatase 0.9341 1 229 GO:0004722
AF-A0A3M1ZHI8-F1-model_v4 Serine/threonine-protein phosphatase 0.9329 1 233 GO:0004722
AF-A0A7W1MMM7-F1-model_v4 deleted 0.9318 1 234

Map