F352134

General Info

Members Datasets Scaffolds Average Seq Length
239 165 478 356

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1503095|Ga0436364_1503095_3944_5161
Length 405
Sequence VISERLRRPEVLDRLAIPPHLPGAATLRTNLCCNAMSDSLTLDLPVPVLDPVEAAKTAKLRYVSDRKPGITRVRTENGFEYHDTDGSLITDETVLQRIRKLAIPPAYTDVWICRDPRGHLQAVGRDAKGRKQYRYHPRWRVVRDEAKYGKMLVFGRVLPTIREHVKHDLALPGLPKRRVLAAIVALLEKTMMRVGNEEYAKHNKSFGLTTLRNRHVKVKGGHLTFDFRGKHGINHHIDLDDKRLARVVERCRDLPGQDLFQFLDHDGERHSIGSEDVNDYLREITGEEITAKDFRTWAATNLAAATLAELERFDTQAVAKKEVVKAVESVAKRLGNTPAICRKCYIHPAVFEGYLDGSLAEGLKQRADEILDQHAGGLTAEEVALTAFLSRRLAQVVAEPEAKRG

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
155 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
156 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
157 2738543023 Pedobacter sp. OK628 Isolate Unclassified
158 2739367656 Pedobacter sp. CF523 Isolate Unclassified
159 2739367663 Pedobacter sp. YR510 Isolate Unclassified
160 2818991437 Pedobacter terrae 518 Isolate Unclassified
161 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
162 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
163 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
164 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
165 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.4
Metatranscriptomes 0
Isolates 4.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.18
Nodule 0
Rhizoplane 0.84
Rhizosphere 89.54
Stem 0
Stem Tuber 0
Unclassified 6.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1503095 3300037853 Bacteria 20513
2 SwRhRL2b_contig_450531 2162886007 Bacteria 17647
3 SwRhRL2b_contig_821335 2162886007 Bacteria 17585
4 JGI25152J39213_1000182 3300002773 Bacteria 42191
5 JGI25150J39212_1000002 3300002774 Bacteria 537631
6 JGI25151J46595_10000003 3300003187 Bacteria 715330
7 JGI25406J46586_10000077 3300003203 Bacteria 44105
8 JGI25153J46596_10000003 3300003215 Bacteria 553253
9 rootH1_10284823 3300003323 Bacteria 4943
10 Ga0065714_10002757 3300005288 Bacteria 41933
11 Ga0065714_10010771 3300005288 Unclassified 2044
12 Ga0065714_10109027 3300005288 Bacteria 1506
13 Ga0065704_10000217 3300005289 Bacteria 101781
14 Ga0070658_10128153 3300005327 Bacteria 2114
15 Ga0070676_10004104 3300005328 Bacteria 7651
16 Ga0070683_100104643 3300005329 Bacteria 2667
17 Ga0070690_100022414 3300005330 Bacteria 3864
18 Ga0070670_100015010 3300005331 Bacteria 6647
19 Ga0070670_100049529 3300005331 Bacteria 3612
20 Ga0068869_100025991 3300005334 Bacteria 4072
21 Ga0070666_10001808 3300005335 Bacteria 13020
22 Ga0070666_10112633 3300005335 Bacteria 1882
23 Ga0068868_100048237 3300005338 Bacteria 3340
24 Ga0068868_100048887 3300005338 Bacteria 3319
25 Ga0068868_100067181 3300005338 Bacteria 2853
26 Ga0070689_100223138 3300005340 Bacteria 1546
27 Ga0070692_10163218 3300005345 Bacteria 1278
28 Ga0070668_100079359 3300005347 Bacteria 2570
29 Ga0070669_100095562 3300005353 Bacteria 2235
30 Ga0070675_100011189 3300005354 Bacteria 7020
31 Ga0070675_100167908 3300005354 Unclassified 1891
32 Ga0070671_100089359 3300005355 Bacteria 2579
33 Ga0070673_100009709 3300005364 Bacteria 6474
34 Ga0070673_100018154 3300005364 Bacteria 5021
35 Ga0070673_100251283 3300005364 Unclassified 1541
36 Ga0070688_100011822 3300005365 Bacteria 4867
37 Ga0070667_100062340 3300005367 Bacteria 3158
38 Ga0070667_100086607 3300005367 Bacteria 2688
39 Ga0070714_100003362 3300005435 Bacteria 11923
40 Ga0070701_10070380 3300005438 Bacteria 1869
41 Ga0070705_100088409 3300005440 Bacteria 1923
42 Ga0070663_100010165 3300005455 Bacteria 5857
43 Ga0070681_10002419 3300005458 Bacteria 17076
44 Ga0068867_100000877 3300005459 Bacteria 20327
45 Ga0068867_100106306 3300005459 Bacteria 2150
46 Ga0070699_100003878 3300005518 Bacteria 13220
47 Ga0070697_100033786 3300005536 Bacteria 4122
48 Ga0068853_100009755 3300005539 Bacteria 7746
49 Ga0070672_100038514 3300005543 Bacteria 3654
50 Ga0070672_100214468 3300005543 Bacteria 1613
51 Ga0070686_100177826 3300005544 Unclassified 1510
52 Ga0070695_100022028 3300005545 Bacteria 3905
53 Ga0070693_100229738 3300005547 Bacteria 1220
54 Ga0070665_100000414 3300005548 Bacteria 62478
55 Ga0070665_100034744 3300005548 Bacteria 5070
56 Ga0070665_100049077 3300005548 Bacteria 4237
57 Ga0070665_100096416 3300005548 Bacteria 2963
58 Ga0068855_100036850 3300005563 Bacteria 5818
59 Ga0068855_100089433 3300005563 Bacteria 3555
60 Ga0068857_100060122 3300005577 Bacteria 3376
61 Ga0068854_100003218 3300005578 Bacteria 10188
62 Ga0068856_100064497 3300005614 Bacteria 3619
63 Ga0068852_100138955 3300005616 Unclassified 2246
64 Ga0068859_100028196 3300005617 Bacteria 5629
65 Ga0068859_100191309 3300005617 Bacteria 2130
66 Ga0068859_100262877 3300005617 Bacteria 1817
67 Ga0068851_10026708 3300005834 Bacteria 2840
68 Ga0068858_100000101 3300005842 Bacteria 89093
69 Ga0068858_100107714 3300005842 Bacteria 2601
70 Ga0068860_100007004 3300005843 Bacteria 11296
71 Ga0068860_100365963 3300005843 Bacteria 1421
72 Ga0068862_100390886 3300005844 Bacteria 1299
73 Ga0081539_10000084 3300005985 Bacteria 218801
74 Ga0081539_10002452 3300005985 Bacteria 26169
75 Ga0070717_10025739 3300006028 Bacteria 4685
76 Ga0097621_100026145 3300006237 Bacteria 4576
77 Ga0075370_10035485 3300006353 Bacteria 2798
78 Ga0068871_100010272 3300006358 Bacteria 6824
79 Ga0068871_100093153 3300006358 Bacteria 2513
80 Ga0068871_100226628 3300006358 Unclassified 1621
81 Ga0075428_100244474 3300006844 Bacteria 1935
82 Ga0075431_100261769 3300006847 Bacteria 1755
83 Ga0075434_100319483 3300006871 Unclassified 1573
84 Ga0075429_100056556 3300006880 Bacteria 3415
85 Ga0068865_100010336 3300006881 Bacteria 5806
86 Ga0068865_100126108 3300006881 Bacteria 1911
87 Ga0068865_100181795 3300006881 Unclassified 1620
88 Ga0097620_100028195 3300006931 Bacteria 5629
89 Ga0097620_100191306 3300006931 Bacteria 2130
90 Ga0097620_100262862 3300006931 Bacteria 1817
91 Ga0105240_10000595 3300009093 Bacteria 67094
92 Ga0105240_10014989 3300009093 Bacteria 10558
93 Ga0105240_10089322 3300009093 Bacteria 3769
94 Ga0105240_10108168 3300009093 Bacteria 3369
95 Ga0111539_10000357 3300009094 Bacteria 56214
96 Ga0105245_10005065 3300009098 Bacteria 11591
97 Ga0114129_10004151 3300009147 Bacteria 20475
98 Ga0105243_10011658 3300009148 Bacteria 6649
99 Ga0105241_10009255 3300009174 Bacteria 7245
100 Ga0105241_10250649 3300009174 Bacteria 1501
101 Ga0105242_10007017 3300009176 Bacteria 8697
102 Ga0105248_10527041 3300009177 Bacteria 1332
103 Ga0105237_10050883 3300009545 Bacteria 4163
104 Ga0105238_10009125 3300009551 Bacteria 9926
105 Ga0105238_10024630 3300009551 Bacteria 6134
106 Ga0105238_10299882 3300009551 Bacteria 1590
107 Ga0105249_10024179 3300009553 Bacteria 5459
108 Ga0105249_10226665 3300009553 Unclassified 1841
109 Ga0105239_10087435 3300010375 Bacteria 3436
110 Ga0105239_10163037 3300010375 Bacteria 2491
111 Ga0157373_10001628 3300013100 Bacteria 17143
112 Ga0157370_10000392 3300013104 Bacteria 55046
113 Ga0157369_10009613 3300013105 Bacteria 11056
114 Ga0157369_10066990 3300013105 Bacteria 3862
115 Ga0157369_10106448 3300013105 Bacteria 2984
116 Ga0157369_10309806 3300013105 Bacteria 1642
117 Ga0157374_10012141 3300013296 Bacteria 7482
118 Ga0157374_10068292 3300013296 Bacteria 3344
119 Ga0157374_10093897 3300013296 Bacteria 2865
120 Ga0157374_10104830 3300013296 Unclassified 2715
121 Ga0157378_10047943 3300013297 Bacteria 3799
122 Ga0157378_10066063 3300013297 Bacteria 3239
123 Ga0157378_10152617 3300013297 Bacteria 2153
124 Ga0163162_10000109 3300013306 Bacteria 74550
125 Ga0163162_10000439 3300013306 Bacteria 38391
126 Ga0163162_10015805 3300013306 Bacteria 7375
127 Ga0163162_10043543 3300013306 Bacteria 4495
128 Ga0157372_10021832 3300013307 Bacteria 6920
129 Ga0157372_10124953 3300013307 Bacteria 2958
130 Ga0163163_10188860 3300014325 Bacteria 2109
131 Ga0182008_10000001 3300014497 Bacteria 540790
132 Ga0182008_10000549 3300014497 Bacteria 27943
133 Ga0157379_10000402 3300014968 Bacteria 35046
134 Ga0157379_10015969 3300014968 Bacteria 6601
135 Ga0157379_10031125 3300014968 Bacteria 4754
136 Ga0182006_1000298 3300015261 Bacteria 43678
137 Ga0163161_10002521 3300017792 Bacteria 13064
138 Ga0163161_10003700 3300017792 Bacteria 10712
139 Ga0163161_10048843 3300017792 Bacteria 3056
140 Ga0213874_10024357 3300021377 Bacteria 1697
141 Ga0213876_10039184 3300021384 Bacteria 2503
142 Ga0213875_10003923 3300021388 Bacteria 8319
143 Ga0207425_1000004 3300025245 Bacteria 1092421
144 Ga0209129_1000005 3300025258 Bacteria 777812
145 Ga0209025_1000009 3300025294 Bacteria 1092561
146 Ga0209758_1000010 3300025297 Bacteria 1092782
147 Ga0207656_10005929 3300025321 Bacteria 4360
148 Ga0207680_10002249 3300025903 Bacteria 9010
149 Ga0207647_10000828 3300025904 Bacteria 24018
150 Ga0207645_10010915 3300025907 Bacteria 6220
151 Ga0207705_10165702 3300025909 Bacteria 1662
152 Ga0207707_10005249 3300025912 Bacteria 11351
153 Ga0207707_10323696 3300025912 Bacteria 1331
154 Ga0207695_10024330 3300025913 Bacteria 6816
155 Ga0207695_10058872 3300025913 Bacteria 3987
156 Ga0207695_10059921 3300025913 Bacteria 3945
157 Ga0207671_10031479 3300025914 Bacteria 3953
158 Ga0207652_10283351 3300025921 Bacteria 1495
159 Ga0207681_10289363 3300025923 Bacteria 1293
160 Ga0207694_10002232 3300025924 Bacteria 15893
161 Ga0207694_10242825 3300025924 Bacteria 1472
162 Ga0207650_10013948 3300025925 Bacteria 5576
163 Ga0207650_10023422 3300025925 Bacteria 4378
164 Ga0207659_10141956 3300025926 Unclassified 1865
165 Ga0207706_10002400 3300025933 Bacteria 18269
166 Ga0207706_10069037 3300025933 Bacteria 3108
167 Ga0207686_10156872 3300025934 Bacteria 1591
168 Ga0207704_10147132 3300025938 Unclassified 1657
169 Ga0207691_10001073 3300025940 Bacteria 27194
170 Ga0207691_10104356 3300025940 Bacteria 2526
171 Ga0207691_10226406 3300025940 Bacteria 1620
172 Ga0207689_10043556 3300025942 Bacteria 3710
173 Ga0207689_10083600 3300025942 Unclassified 2624
174 Ga0207689_10172073 3300025942 Bacteria 1785
175 Ga0207661_10112293 3300025944 Bacteria 2307
176 Ga0207667_10003348 3300025949 Bacteria 19779
177 Ga0207651_10002256 3300025960 Bacteria 9155
178 Ga0207640_10001835 3300025981 Bacteria 11391
179 Ga0207658_10320480 3300025986 Unclassified 1341
180 Ga0207677_10029143 3300026023 Bacteria 3504
181 Ga0207677_10060098 3300026023 Bacteria 2625
182 Ga0207677_10093013 3300026023 Bacteria 2197
183 Ga0207703_10000180 3300026035 Bacteria 73584
184 Ga0207703_10033053 3300026035 Bacteria 4098
185 Ga0207639_10000367 3300026041 Bacteria 31306
186 Ga0207639_10246340 3300026041 Bacteria 1556
187 Ga0207678_10002313 3300026067 Bacteria 17269
188 Ga0207708_10051923 3300026075 Bacteria 3122
189 Ga0207708_10228612 3300026075 Bacteria 1493
190 Ga0207702_10119721 3300026078 Bacteria 2354
191 Ga0207648_10003240 3300026089 Bacteria 17123
192 Ga0207676_10060780 3300026095 Bacteria 2990
193 Ga0207674_10071909 3300026116 Bacteria 3475
194 Ga0268266_10000008 3300028379 Bacteria 1161875
195 Ga0268266_10014192 3300028379 Bacteria 6852
196 Ga0268266_10019013 3300028379 Bacteria 5853
197 Ga0268266_10028492 3300028379 Bacteria 4746
198 Ga0268264_10004928 3300028381 Bacteria 11309
199 Ga0307408_100002002 3300031548 Bacteria 14726
200 Ga0307405_10000043 3300031731 Bacteria 78391
201 Ga0307405_10016541 3300031731 Bacteria 4024
202 Ga0307413_10012521 3300031824 Bacteria 4225
203 Ga0307410_10002981 3300031852 Bacteria 8355
204 Ga0307407_10084204 3300031903 Bacteria 1931
205 Ga0307412_10003168 3300031911 Bacteria 9142
206 Ga0307409_100092645 3300031995 Bacteria 2480
207 Ga0307416_100003105 3300032002 Bacteria 9723
208 Ga0307411_10028093 3300032005 Bacteria 3415
209 Ga0307415_100325554 3300032126 Bacteria 1283
210 Ga0373937_0008573 3300036401 Bacteria 8879
211 Ga0395900_0365767 3300037418 Bacteria 1413
212 Ga0436365_0188384 3300039437 Bacteria 1694
213 Ga0436365_0464304 3300039437 Bacteria 27078
214 Ga0495592_0136900 3300046454 Bacteria 1707
215 Ga0495610_0000386 3300046512 Bacteria 45558
216 Ga0495609_0018464 3300046538 Bacteria 3231
217 Ga0495611_0068662 3300046648 Bacteria 1618
218 Ga0495599_0145418 3300046678 Bacteria 1470
219 Ga0496105_0299101 3300048908 Bacteria 1294
220 Ga0496112_0083562 3300048915 Unclassified 3158
221 Ga0501034_0026252 3300049571 Bacteria 5932
222 Ga0501034_0206908 3300049571 Bacteria 1918
223 Ga0501047_0066593 3300049581 Bacteria 3472
224 Ga0501072_0259821 3300049588 Bacteria 1382
225 nmdc:mga05p37_19906_c1 3300050507 Bacteria 8117
226 nmdc:mga08y16_1452_c1 3300050511 Bacteria 23732
227 Ga0495601_0046896 3300053077 Bacteria 2720
228 Ga0500651_0000640 3300053093 Bacteria 17409
229 2586210245 2585427687 Bacteria 5544917
230 2588218138 2585428184 Bacteria 4978681
231 2739303923 2738543023 Bacteria 6767879
232 2739617901 2739367656 Bacteria 5152243
233 2739644148 2739367663 Bacteria 5040914
234 2819548700 2818991437 Bacteria 5805520
235 2842722569 2842722452 Bacteria 6263924
236 2842914540 2842909656 Bacteria 6185908
237 2904449434 2904445276 Bacteria 5310396
238 2919188271 2919186247 Bacteria 6244071
239 2939664462 2939664404 Bacteria 6364494
240 Ga0436364_1503095
241 SwRhRL2b_contig_450531
242 SwRhRL2b_contig_821335
243 JGI25152J39213_1000182
244 JGI25150J39212_1000002
245 JGI25151J46595_10000003
246 JGI25406J46586_10000077
247 JGI25153J46596_10000003
248 rootH1_10284823
249 Ga0065714_10002757
250 Ga0065714_10010771
251 Ga0065714_10109027
252 Ga0065704_10000217
253 Ga0070658_10128153
254 Ga0070676_10004104
255 Ga0070683_100104643
256 Ga0070690_100022414
257 Ga0070670_100015010
258 Ga0070670_100049529
259 Ga0068869_100025991
260 Ga0070666_10001808
261 Ga0070666_10112633
262 Ga0068868_100048237
263 Ga0068868_100048887
264 Ga0068868_100067181
265 Ga0070689_100223138
266 Ga0070692_10163218
267 Ga0070668_100079359
268 Ga0070669_100095562
269 Ga0070675_100011189
270 Ga0070675_100167908
271 Ga0070671_100089359
272 Ga0070673_100009709
273 Ga0070673_100018154
274 Ga0070673_100251283
275 Ga0070688_100011822
276 Ga0070667_100062340
277 Ga0070667_100086607
278 Ga0070714_100003362
279 Ga0070701_10070380
280 Ga0070705_100088409
281 Ga0070663_100010165
282 Ga0070681_10002419
283 Ga0068867_100000877
284 Ga0068867_100106306
285 Ga0070699_100003878
286 Ga0070697_100033786
287 Ga0068853_100009755
288 Ga0070672_100038514
289 Ga0070672_100214468
290 Ga0070686_100177826
291 Ga0070695_100022028
292 Ga0070693_100229738
293 Ga0070665_100000414
294 Ga0070665_100034744
295 Ga0070665_100049077
296 Ga0070665_100096416
297 Ga0068855_100036850
298 Ga0068855_100089433
299 Ga0068857_100060122
300 Ga0068854_100003218
301 Ga0068856_100064497
302 Ga0068852_100138955
303 Ga0068859_100028196
304 Ga0068859_100191309
305 Ga0068859_100262877
306 Ga0068851_10026708
307 Ga0068858_100000101
308 Ga0068858_100107714
309 Ga0068860_100007004
310 Ga0068860_100365963
311 Ga0068862_100390886
312 Ga0081539_10000084
313 Ga0081539_10002452
314 Ga0070717_10025739
315 Ga0097621_100026145
316 Ga0075370_10035485
317 Ga0068871_100010272
318 Ga0068871_100093153
319 Ga0068871_100226628
320 Ga0075428_100244474
321 Ga0075431_100261769
322 Ga0075434_100319483
323 Ga0075429_100056556
324 Ga0068865_100010336
325 Ga0068865_100126108
326 Ga0068865_100181795
327 Ga0097620_100028195
328 Ga0097620_100191306
329 Ga0097620_100262862
330 Ga0105240_10000595
331 Ga0105240_10014989
332 Ga0105240_10089322
333 Ga0105240_10108168
334 Ga0111539_10000357
335 Ga0105245_10005065
336 Ga0114129_10004151
337 Ga0105243_10011658
338 Ga0105241_10009255
339 Ga0105241_10250649
340 Ga0105242_10007017
341 Ga0105248_10527041
342 Ga0105237_10050883
343 Ga0105238_10009125
344 Ga0105238_10024630
345 Ga0105238_10299882
346 Ga0105249_10024179
347 Ga0105249_10226665
348 Ga0105239_10087435
349 Ga0105239_10163037
350 Ga0157373_10001628
351 Ga0157370_10000392
352 Ga0157369_10009613
353 Ga0157369_10066990
354 Ga0157369_10106448
355 Ga0157369_10309806
356 Ga0157374_10012141
357 Ga0157374_10068292
358 Ga0157374_10093897
359 Ga0157374_10104830
360 Ga0157378_10047943
361 Ga0157378_10066063
362 Ga0157378_10152617
363 Ga0163162_10000109
364 Ga0163162_10000439
365 Ga0163162_10015805
366 Ga0163162_10043543
367 Ga0157372_10021832
368 Ga0157372_10124953
369 Ga0163163_10188860
370 Ga0182008_10000001
371 Ga0182008_10000549
372 Ga0157379_10000402
373 Ga0157379_10015969
374 Ga0157379_10031125
375 Ga0182006_1000298
376 Ga0163161_10002521
377 Ga0163161_10003700
378 Ga0163161_10048843
379 Ga0213874_10024357
380 Ga0213876_10039184
381 Ga0213875_10003923
382 Ga0207425_1000004
383 Ga0209129_1000005
384 Ga0209025_1000009
385 Ga0209758_1000010
386 Ga0207656_10005929
387 Ga0207680_10002249
388 Ga0207647_10000828
389 Ga0207645_10010915
390 Ga0207705_10165702
391 Ga0207707_10005249
392 Ga0207707_10323696
393 Ga0207695_10024330
394 Ga0207695_10058872
395 Ga0207695_10059921
396 Ga0207671_10031479
397 Ga0207652_10283351
398 Ga0207681_10289363
399 Ga0207694_10002232
400 Ga0207694_10242825
401 Ga0207650_10013948
402 Ga0207650_10023422
403 Ga0207659_10141956
404 Ga0207706_10002400
405 Ga0207706_10069037
406 Ga0207686_10156872
407 Ga0207704_10147132
408 Ga0207691_10001073
409 Ga0207691_10104356
410 Ga0207691_10226406
411 Ga0207689_10043556
412 Ga0207689_10083600
413 Ga0207689_10172073
414 Ga0207661_10112293
415 Ga0207667_10003348
416 Ga0207651_10002256
417 Ga0207640_10001835
418 Ga0207658_10320480
419 Ga0207677_10029143
420 Ga0207677_10060098
421 Ga0207677_10093013
422 Ga0207703_10000180
423 Ga0207703_10033053
424 Ga0207639_10000367
425 Ga0207639_10246340
426 Ga0207678_10002313
427 Ga0207708_10051923
428 Ga0207708_10228612
429 Ga0207702_10119721
430 Ga0207648_10003240
431 Ga0207676_10060780
432 Ga0207674_10071909
433 Ga0268266_10000008
434 Ga0268266_10014192
435 Ga0268266_10019013
436 Ga0268266_10028492
437 Ga0268264_10004928
438 Ga0307408_100002002
439 Ga0307405_10000043
440 Ga0307405_10016541
441 Ga0307413_10012521
442 Ga0307410_10002981
443 Ga0307407_10084204
444 Ga0307412_10003168
445 Ga0307409_100092645
446 Ga0307416_100003105
447 Ga0307411_10028093
448 Ga0307415_100325554
449 Ga0373937_0008573
450 Ga0395900_0365767
451 Ga0436365_0188384
452 Ga0436365_0464304
453 Ga0495592_0136900
454 Ga0495610_0000386
455 Ga0495609_0018464
456 Ga0495611_0068662
457 Ga0495599_0145418
458 Ga0496105_0299101
459 Ga0496112_0083562
460 Ga0501034_0026252
461 Ga0501034_0206908
462 Ga0501047_0066593
463 Ga0501072_0259821
464 nmdc:mga05p37_19906_c1
465 nmdc:mga08y16_1452_c1
466 Ga0495601_0046896
467 Ga0500651_0000640
468 2586210245
469 2588218138
470 2739303923
471 2739617901
472 2739644148
473 2819548700
474 2842722569
475 2842914540
476 2904449434
477 2919188271
478 2939664462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21338

Top1B_N_bact

Bacterial DNA topoisomerase IB, N-terminal domain

78

126

0.99

PF01028

Topoisom_I

Eukaryotic DNA topoisomerase I, catalytic core

136

370

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h7g-assembly1.cif.gz_X structure of variola topoisomerase non-covalently bound to dna 0.8157 20 344
2h7g-assembly1.cif.gz_X structure of variola topoisomerase non-covalently bound to dna 0.8109 20 344
2b9s-assembly1.cif.gz_A crystal structure of heterodimeric l. donovani topoisomerase i-vanadate-dna complex 0.7806 56 290
5zbd-assembly1.cif.gz_A crystal structure of tryptophan oxidase (c395a mutant) from chromobacterium violaceum 0.738 169 193
6esd-assembly1.cif.gz_A crystal structure of l-tryptophan oxidase vioa from chromobacterium violaceum 0.7376 169 193
ID Description Score Start End Superfamily
3m4aA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.9595 124 239 3.90.15.10
3m4aA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.936 124 239 3.90.15.10
2f4qA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.9198 124 239 3.90.15.10
2f4qA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.8951 124 239 3.90.15.10
af_A0A2R8S0L3_185_312_3.90.15.10 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.8916 89 199 3.90.15.10
ID Description Score Start End GO Terms
AF-A0A2A2KIQ3-F1-model_v4 DNA topoisomerase I catalytic core eukaryotic-type domain-containing protein 0.9911 105 226 GO:0003677
GO:0003917
GO:0006265
AF-A0A7X5N244-F1-model_v4 DNA topoisomerase (EC 5.6.2.1) 0.9847 118 258 GO:0003677
GO:0003917
GO:0006265
AF-A0A536GTZ5-F1-model_v4 DNA topoisomerase (EC 5.6.2.1) 0.983 124 262 GO:0003677
GO:0003917
GO:0006265
AF-A0A3M2ZKQ3-F1-model_v4 DNA topoisomerase (EC 5.6.2.1) 0.975 158 251 GO:0003677
GO:0003917
GO:0006265
AF-A0A520B0B9-F1-model_v4 DNA topoisomerase (EC 5.6.2.1) 0.9723 99 343 GO:0003677
GO:0003917
GO:0006265

Map