F351836

General Info

Members Datasets Scaffolds Average Seq Length
239 149 478 208

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100009114|Ga0075431_1000091146
Length 240
Sequence MRSCSGEARVKHFDQVTVVVREIHRQRETGMAAAPEGTRLSAEEALARLIGGNQRFLRGEARSSAFRRETLTALAKAQSPYATVLGCSDSRVPPEWIFDTGLGELFVIRVAGNILSPEIAGTLQYAGSYLETPLFVVLGHEGCGAITAALATKHEGAQFRSRVHLLLANIVGGLPDFDPTLSPEEQASRAVESNVRWTVRQILDSSEGQARIAEGRMKIVGAVYEIETGRVRFLPRDEPT

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
106 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
107 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.6
Rhizosphere 94.98
Stem 0
Stem Tuber 0
Unclassified 15.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100009114 3300006847 Bacteria 9951
2 JGI24748J21848_1000008 3300002074 Bacteria 191483
3 JGI24034J26672_10000002 3300002239 Bacteria 925353
4 JGI25405J52794_10001879 3300003911 Bacteria 3540
5 Ga0070676_10039715 3300005328 Bacteria 2723
6 Ga0070683_100699710 3300005329 Bacteria 971
7 Ga0070690_100033940 3300005330 Bacteria 3196
8 Ga0070670_100045504 3300005331 Bacteria 3773
9 Ga0070666_10066644 3300005335 Unclassified 2443
10 Ga0068868_100099895 3300005338 Bacteria 2348
11 Ga0070689_100037367 3300005340 Bacteria 3713
12 Ga0070689_100071343 3300005340 Unclassified 2713
13 Ga0070669_100003859 3300005353 Bacteria 10829
14 Ga0070675_100270895 3300005354 Bacteria 1490
15 Ga0070671_100012983 3300005355 Bacteria 6712
16 Ga0070671_100022717 3300005355 Bacteria 5125
17 Ga0070671_100187902 3300005355 Bacteria 1751
18 Ga0070674_100003091 3300005356 Bacteria 9262
19 Ga0070673_100061958 3300005364 Unclassified 2970
20 Ga0070673_100397727 3300005364 Bacteria 1231
21 Ga0070673_100961018 3300005364 Bacteria 794
22 Ga0070688_100043325 3300005365 Bacteria 2772
23 Ga0070688_100106284 3300005365 Bacteria 1859
24 Ga0070667_100007444 3300005367 Bacteria 9090
25 Ga0070700_100082571 3300005441 Bacteria 2078
26 Ga0070700_100138746 3300005441 Bacteria 1650
27 Ga0070708_100049579 3300005445 Bacteria 3715
28 Ga0070678_100050748 3300005456 Unclassified 3003
29 Ga0070678_100578905 3300005456 Unclassified 1000
30 Ga0070678_100698965 3300005456 Bacteria 913
31 Ga0070685_10169048 3300005466 Bacteria 1400
32 Ga0070706_100019547 3300005467 Bacteria 6247
33 Ga0070706_100236136 3300005467 Bacteria 1707
34 Ga0070707_100028826 3300005468 Bacteria 5283
35 Ga0070698_100036974 3300005471 Bacteria 5036
36 Ga0070698_100127230 3300005471 Bacteria 2505
37 Ga0070699_100063814 3300005518 Bacteria 3194
38 Ga0070697_100002205 3300005536 Bacteria 14953
39 Ga0070672_100013130 3300005543 Bacteria 5838
40 Ga0070672_100016769 3300005543 Bacteria 5252
41 Ga0070695_100008443 3300005545 Bacteria 6112
42 Ga0070695_100061494 3300005545 Bacteria 2436
43 Ga0070696_100652819 3300005546 Bacteria 853
44 Ga0070665_100018787 3300005548 Bacteria 6930
45 Ga0070665_100359747 3300005548 Bacteria 1461
46 Ga0070665_100889328 3300005548 Bacteria 903
47 Ga0070702_100192957 3300005615 Bacteria 1342
48 Ga0068852_100137817 3300005616 Unclassified 2255
49 Ga0068852_100565792 3300005616 Unclassified 1138
50 Ga0068859_100179384 3300005617 Bacteria 2200
51 Ga0068859_100853560 3300005617 Bacteria 996
52 Ga0068864_100173958 3300005618 Bacteria 1965
53 Ga0068864_100323433 3300005618 Bacteria 1449
54 Ga0068864_101323286 3300005618 Unclassified 721
55 Ga0068861_100076442 3300005719 Bacteria 2609
56 Ga0068861_100088377 3300005719 Bacteria 2440
57 Ga0068863_100226022 3300005841 Bacteria 1804
58 Ga0068863_100831105 3300005841 Bacteria 922
59 Ga0068858_100000008 3300005842 Bacteria 238361
60 Ga0068858_100018573 3300005842 Bacteria 6511
61 Ga0068858_100161798 3300005842 Bacteria 2108
62 Ga0068858_100250520 3300005842 Bacteria 1682
63 Ga0068858_100365141 3300005842 Bacteria 1384
64 Ga0068860_100055957 3300005843 Bacteria 3750
65 Ga0068862_100265975 3300005844 Bacteria 1567
66 Ga0068862_101008283 3300005844 Bacteria 824
67 Ga0081455_10001671 3300005937 Bacteria 26899
68 Ga0081538_10042092 3300005981 Bacteria 2888
69 Ga0070712_100199855 3300006175 Bacteria 1569
70 Ga0068871_100080080 3300006358 Bacteria 2704
71 Ga0075428_100036122 3300006844 Bacteria 5445
72 Ga0075428_100037471 3300006844 Bacteria 5338
73 Ga0075430_100000038 3300006846 Bacteria 68465
74 Ga0075431_100144242 3300006847 Bacteria 2454
75 Ga0075431_100397391 3300006847 Unclassified 1380
76 Ga0097620_100179386 3300006931 Bacteria 2200
77 Ga0097620_100853520 3300006931 Bacteria 996
78 Ga0105240_10799475 3300009093 Bacteria 1022
79 Ga0111539_10003068 3300009094 Bacteria 22135
80 Ga0111539_10084521 3300009094 Bacteria 3731
81 Ga0111539_10136042 3300009094 Unclassified 2877
82 Ga0111539_10220525 3300009094 Bacteria 2209
83 Ga0111539_10233111 3300009094 Bacteria 2143
84 Ga0111539_10314003 3300009094 Bacteria 1824
85 Ga0111539_10352249 3300009094 Bacteria 1713
86 Ga0105245_10042447 3300009098 Bacteria 4059
87 Ga0105247_10000001 3300009101 Bacteria 739726
88 Ga0114129_10004506 3300009147 Bacteria 19649
89 Ga0105243_10551825 3300009148 Bacteria 1101
90 Ga0105242_10351904 3300009176 Unclassified 1361
91 Ga0105242_10846506 3300009176 Bacteria 910
92 Ga0105248_10011302 3300009177 Bacteria 9845
93 Ga0105248_10966284 3300009177 Bacteria 962
94 Ga0105249_10267473 3300009553 Bacteria 1702
95 Ga0157374_10023294 3300013296 Bacteria 5537
96 Ga0157378_10085178 3300013297 Unclassified 2863
97 Ga0157378_10227558 3300013297 Bacteria 1775
98 Ga0163162_10130654 3300013306 Bacteria 2620
99 Ga0163162_10402095 3300013306 Bacteria 1502
100 Ga0157372_10318600 3300013307 Bacteria 1810
101 Ga0157372_10662072 3300013307 Bacteria 1216
102 Ga0157375_10046111 3300013308 Bacteria 4247
103 Ga0157375_10207435 3300013308 Bacteria 2116
104 Ga0157375_10294191 3300013308 Unclassified 1787
105 Ga0157375_10846482 3300013308 Bacteria 1061
106 Ga0163163_10006988 3300014325 Bacteria 9917
107 Ga0163163_10919354 3300014325 Unclassified 938
108 Ga0157380_10059642 3300014326 Unclassified 3046
109 Ga0157376_10035824 3300014969 Unclassified 4016
110 Ga0157376_10119015 3300014969 Bacteria 2338
111 Ga0157376_10121086 3300014969 Bacteria 2319
112 Ga0207697_10007941 3300025315 Unclassified 4690
113 Ga0207710_10000003 3300025900 Bacteria 1071597
114 Ga0207680_10157181 3300025903 Unclassified 1521
115 Ga0207680_10401758 3300025903 Bacteria 968
116 Ga0207645_10020245 3300025907 Unclassified 4356
117 Ga0207684_10004357 3300025910 Bacteria 13369
118 Ga0207693_10098976 3300025915 Bacteria 2287
119 Ga0207646_10062574 3300025922 Bacteria 3322
120 Ga0207681_10049051 3300025923 Unclassified 2852
121 Ga0207650_10095273 3300025925 Bacteria 2282
122 Ga0207659_10195889 3300025926 Bacteria 1610
123 Ga0207659_10265872 3300025926 Unclassified 1397
124 Ga0207644_10001091 3300025931 Bacteria 17412
125 Ga0207644_10041805 3300025931 Bacteria 3245
126 Ga0207644_10043359 3300025931 Bacteria 3192
127 Ga0207686_10574054 3300025934 Unclassified 884
128 Ga0207670_10070255 3300025936 Bacteria 2418
129 Ga0207669_10034294 3300025937 Bacteria 2874
130 Ga0207669_10143562 3300025937 Unclassified 1661
131 Ga0207691_10001729 3300025940 Bacteria 21513
132 Ga0207691_10005353 3300025940 Bacteria 12385
133 Ga0207691_10021906 3300025940 Bacteria 6030
134 Ga0207691_10213135 3300025940 Bacteria 1677
135 Ga0207691_10501488 3300025940 Unclassified 1031
136 Ga0207711_10092831 3300025941 Bacteria 2657
137 Ga0207679_10285399 3300025945 Bacteria 1417
138 Ga0207651_10375881 3300025960 Bacteria 1203
139 Ga0207651_10712031 3300025960 Bacteria 885
140 Ga0207712_10540861 3300025961 Unclassified 1001
141 Ga0207668_10010494 3300025972 Bacteria 5599
142 Ga0207668_10128459 3300025972 Bacteria 1932
143 Ga0207640_10596951 3300025981 Bacteria 934
144 Ga0207658_10016091 3300025986 Bacteria 5138
145 Ga0207658_10144844 3300025986 Bacteria 1928
146 Ga0207677_10076972 3300026023 Bacteria 2377
147 Ga0207703_10000198 3300026035 Bacteria 70218
148 Ga0207703_10077443 3300026035 Bacteria 2760
149 Ga0207703_10438791 3300026035 Bacteria 1218
150 Ga0207708_10150459 3300026075 Bacteria 1832
151 Ga0207708_10635565 3300026075 Unclassified 907
152 Ga0207641_10476719 3300026088 Bacteria 1209
153 Ga0207641_10591814 3300026088 Bacteria 1085
154 Ga0207648_10007932 3300026089 Bacteria 10353
155 Ga0207648_10152302 3300026089 Bacteria 2041
156 Ga0207676_10155567 3300026095 Bacteria 1975
157 Ga0207675_100004742 3300026118 Bacteria 13093
158 Ga0207675_100092650 3300026118 Bacteria 2842
159 Ga0207683_10063500 3300026121 Bacteria 3253
160 Ga0207428_10006860 3300027907 Bacteria 10436
161 Ga0268266_10022208 3300028379 Bacteria 5407
162 Ga0268266_10180715 3300028379 Bacteria 1920
163 Ga0268266_10220331 3300028379 Bacteria 1744
164 Ga0268264_10430969 3300028381 Unclassified 1273
165 Ga0307408_101008489 3300031548 Bacteria 768
166 Ga0373923_0104425 3300035111 Bacteria 1253
167 Ga0373954_0028833 3300035118 Unclassified 2553
168 Ga0373954_0305750 3300035118 Bacteria 784
169 Ga0373931_0059892 3300035691 Bacteria 2049
170 Ga0373933_0436923 3300035724 Bacteria 855
171 Ga0373947_0144165 3300035725 Bacteria 1530
172 Ga0373937_0128615 3300036401 Unclassified 2364
173 Ga0373937_0185288 3300036401 Bacteria 1955
174 Ga0451835_1206405 3300041492 Bacteria 827
175 Ga0450896_003964 3300042133 Bacteria 1994
176 Ga0439464_0028163 3300042439 Unclassified 1565
177 Ga0495592_0078732 3300046454 Bacteria 2387
178 Ga0495651_0065734 3300046462 Bacteria 2769
179 Ga0495580_0001763 3300046472 Bacteria 18996
180 Ga0495580_0026967 3300046472 Unclassified 4184
181 Ga0495594_0064369 3300046499 Bacteria 2033
182 Ga0495594_0219578 3300046499 Bacteria 1084
183 Ga0495608_0004018 3300046511 Bacteria 10555
184 Ga0495618_0328825 3300046514 Bacteria 945
185 Ga0495628_0058263 3300046516 Bacteria 3036
186 Ga0495628_0573784 3300046516 Bacteria 808
187 Ga0495630_0093500 3300046517 Bacteria 2273
188 Ga0495630_0443971 3300046517 Bacteria 994
189 Ga0495666_0220495 3300046526 Bacteria 869
190 Ga0495652_0025557 3300046529 Bacteria 5222
191 Ga0495586_0073796 3300046535 Bacteria 1866
192 Ga0495645_0137486 3300046543 Bacteria 1708
193 Ga0495667_0036062 3300046559 Bacteria 3303
194 Ga0495667_0165183 3300046559 Bacteria 1423
195 Ga0495656_0312725 3300046615 Bacteria 807
196 Ga0495634_0023090 3300046642 Unclassified 4378
197 Ga0495634_0249446 3300046642 Bacteria 1086
198 Ga0495658_0110329 3300046683 Bacteria 1653
199 Ga0495613_0004583 3300046689 Bacteria 10371
200 Ga0495613_0167996 3300046689 Bacteria 1558
201 Ga0495613_0281761 3300046689 Bacteria 1154
202 Ga0495613_0464751 3300046689 Unclassified 856
203 Ga0495600_0179941 3300046809 Bacteria 1363
204 Ga0495581_0175780 3300047315 Unclassified 1252
205 Ga0495604_0118347 3300047317 Bacteria 1920
206 Ga0495674_0170772 3300047319 Bacteria 1815
207 Ga0495674_0274124 3300047319 Bacteria 1383
208 Ga0495680_0017981 3300047322 Bacteria 6014
209 Ga0495675_0013601 3300047444 Bacteria 5141
210 Ga0495684_0031540 3300047471 Bacteria 4069
211 Ga0495684_0043967 3300047471 Bacteria 3420
212 Ga0495684_0234592 3300047471 Bacteria 1341
213 Ga0495593_0310905 3300047673 Bacteria 788
214 Ga0496104_0117940 3300048907 Bacteria 2547
215 Ga0496104_0504308 3300048907 Bacteria 1121
216 Ga0496105_0291018 3300048908 Bacteria 1315
217 Ga0496108_0712027 3300048911 Unclassified 870
218 Ga0496110_0232681 3300048913 Bacteria 1676
219 Ga0496110_0363782 3300048913 Bacteria 1318
220 Ga0496111_0211682 3300048914 Unclassified 1440
221 Ga0496112_0145674 3300048915 Bacteria 2337
222 Ga0496113_0096663 3300048916 Unclassified 2284
223 Ga0496114_0557718 3300048917 Bacteria 1012
224 Ga0496115_0009161 3300048918 Bacteria 7347
225 nmdc:mga05p37_14955_c1 3300050507 Bacteria 8298
226 nmdc:mga0qj67_234_c1 3300050509 Bacteria 37735
227 nmdc:mga0qj67_859120_c1 3300050509 Bacteria 716
228 nmdc:mga06r32_152080_c1 3300050510 Bacteria 2293
229 nmdc:mga06r32_730_c1 3300050510 Bacteria 28814
230 nmdc:mga08y16_186401_c1 3300050511 Bacteria 2153
231 nmdc:mga08y16_200134_c1 3300050511 Bacteria 2070
232 nmdc:mga08y16_205658_c1 3300050511 Bacteria 2040
233 nmdc:mga08y16_81556_c1 3300050511 Bacteria 3372
234 Ga0495601_0001372 3300053077 Bacteria 13398
235 Ga0495601_0254680 3300053077 Bacteria 1146
236 Ga0495601_0552172 3300053077 Unclassified 741
237 Ga0495619_0011275 3300053085 Bacteria 5623
238 Ga0501084_0055054 3300054114 Bacteria 3328
239 Ga0501082_0160297 3300060353 Bacteria 1955
240 Ga0075431_100009114
241 JGI24748J21848_1000008
242 JGI24034J26672_10000002
243 JGI25405J52794_10001879
244 Ga0070676_10039715
245 Ga0070683_100699710
246 Ga0070690_100033940
247 Ga0070670_100045504
248 Ga0070666_10066644
249 Ga0068868_100099895
250 Ga0070689_100037367
251 Ga0070689_100071343
252 Ga0070669_100003859
253 Ga0070675_100270895
254 Ga0070671_100012983
255 Ga0070671_100022717
256 Ga0070671_100187902
257 Ga0070674_100003091
258 Ga0070673_100061958
259 Ga0070673_100397727
260 Ga0070673_100961018
261 Ga0070688_100043325
262 Ga0070688_100106284
263 Ga0070667_100007444
264 Ga0070700_100082571
265 Ga0070700_100138746
266 Ga0070708_100049579
267 Ga0070678_100050748
268 Ga0070678_100578905
269 Ga0070678_100698965
270 Ga0070685_10169048
271 Ga0070706_100019547
272 Ga0070706_100236136
273 Ga0070707_100028826
274 Ga0070698_100036974
275 Ga0070698_100127230
276 Ga0070699_100063814
277 Ga0070697_100002205
278 Ga0070672_100013130
279 Ga0070672_100016769
280 Ga0070695_100008443
281 Ga0070695_100061494
282 Ga0070696_100652819
283 Ga0070665_100018787
284 Ga0070665_100359747
285 Ga0070665_100889328
286 Ga0070702_100192957
287 Ga0068852_100137817
288 Ga0068852_100565792
289 Ga0068859_100179384
290 Ga0068859_100853560
291 Ga0068864_100173958
292 Ga0068864_100323433
293 Ga0068864_101323286
294 Ga0068861_100076442
295 Ga0068861_100088377
296 Ga0068863_100226022
297 Ga0068863_100831105
298 Ga0068858_100000008
299 Ga0068858_100018573
300 Ga0068858_100161798
301 Ga0068858_100250520
302 Ga0068858_100365141
303 Ga0068860_100055957
304 Ga0068862_100265975
305 Ga0068862_101008283
306 Ga0081455_10001671
307 Ga0081538_10042092
308 Ga0070712_100199855
309 Ga0068871_100080080
310 Ga0075428_100036122
311 Ga0075428_100037471
312 Ga0075430_100000038
313 Ga0075431_100144242
314 Ga0075431_100397391
315 Ga0097620_100179386
316 Ga0097620_100853520
317 Ga0105240_10799475
318 Ga0111539_10003068
319 Ga0111539_10084521
320 Ga0111539_10136042
321 Ga0111539_10220525
322 Ga0111539_10233111
323 Ga0111539_10314003
324 Ga0111539_10352249
325 Ga0105245_10042447
326 Ga0105247_10000001
327 Ga0114129_10004506
328 Ga0105243_10551825
329 Ga0105242_10351904
330 Ga0105242_10846506
331 Ga0105248_10011302
332 Ga0105248_10966284
333 Ga0105249_10267473
334 Ga0157374_10023294
335 Ga0157378_10085178
336 Ga0157378_10227558
337 Ga0163162_10130654
338 Ga0163162_10402095
339 Ga0157372_10318600
340 Ga0157372_10662072
341 Ga0157375_10046111
342 Ga0157375_10207435
343 Ga0157375_10294191
344 Ga0157375_10846482
345 Ga0163163_10006988
346 Ga0163163_10919354
347 Ga0157380_10059642
348 Ga0157376_10035824
349 Ga0157376_10119015
350 Ga0157376_10121086
351 Ga0207697_10007941
352 Ga0207710_10000003
353 Ga0207680_10157181
354 Ga0207680_10401758
355 Ga0207645_10020245
356 Ga0207684_10004357
357 Ga0207693_10098976
358 Ga0207646_10062574
359 Ga0207681_10049051
360 Ga0207650_10095273
361 Ga0207659_10195889
362 Ga0207659_10265872
363 Ga0207644_10001091
364 Ga0207644_10041805
365 Ga0207644_10043359
366 Ga0207686_10574054
367 Ga0207670_10070255
368 Ga0207669_10034294
369 Ga0207669_10143562
370 Ga0207691_10001729
371 Ga0207691_10005353
372 Ga0207691_10021906
373 Ga0207691_10213135
374 Ga0207691_10501488
375 Ga0207711_10092831
376 Ga0207679_10285399
377 Ga0207651_10375881
378 Ga0207651_10712031
379 Ga0207712_10540861
380 Ga0207668_10010494
381 Ga0207668_10128459
382 Ga0207640_10596951
383 Ga0207658_10016091
384 Ga0207658_10144844
385 Ga0207677_10076972
386 Ga0207703_10000198
387 Ga0207703_10077443
388 Ga0207703_10438791
389 Ga0207708_10150459
390 Ga0207708_10635565
391 Ga0207641_10476719
392 Ga0207641_10591814
393 Ga0207648_10007932
394 Ga0207648_10152302
395 Ga0207676_10155567
396 Ga0207675_100004742
397 Ga0207675_100092650
398 Ga0207683_10063500
399 Ga0207428_10006860
400 Ga0268266_10022208
401 Ga0268266_10180715
402 Ga0268266_10220331
403 Ga0268264_10430969
404 Ga0307408_101008489
405 Ga0373923_0104425
406 Ga0373954_0028833
407 Ga0373954_0305750
408 Ga0373931_0059892
409 Ga0373933_0436923
410 Ga0373947_0144165
411 Ga0373937_0128615
412 Ga0373937_0185288
413 Ga0451835_1206405
414 Ga0450896_003964
415 Ga0439464_0028163
416 Ga0495592_0078732
417 Ga0495651_0065734
418 Ga0495580_0001763
419 Ga0495580_0026967
420 Ga0495594_0064369
421 Ga0495594_0219578
422 Ga0495608_0004018
423 Ga0495618_0328825
424 Ga0495628_0058263
425 Ga0495628_0573784
426 Ga0495630_0093500
427 Ga0495630_0443971
428 Ga0495666_0220495
429 Ga0495652_0025557
430 Ga0495586_0073796
431 Ga0495645_0137486
432 Ga0495667_0036062
433 Ga0495667_0165183
434 Ga0495656_0312725
435 Ga0495634_0023090
436 Ga0495634_0249446
437 Ga0495658_0110329
438 Ga0495613_0004583
439 Ga0495613_0167996
440 Ga0495613_0281761
441 Ga0495613_0464751
442 Ga0495600_0179941
443 Ga0495581_0175780
444 Ga0495604_0118347
445 Ga0495674_0170772
446 Ga0495674_0274124
447 Ga0495680_0017981
448 Ga0495675_0013601
449 Ga0495684_0031540
450 Ga0495684_0043967
451 Ga0495684_0234592
452 Ga0495593_0310905
453 Ga0496104_0117940
454 Ga0496104_0504308
455 Ga0496105_0291018
456 Ga0496108_0712027
457 Ga0496110_0232681
458 Ga0496110_0363782
459 Ga0496111_0211682
460 Ga0496112_0145674
461 Ga0496113_0096663
462 Ga0496114_0557718
463 Ga0496115_0009161
464 nmdc:mga05p37_14955_c1
465 nmdc:mga0qj67_234_c1
466 nmdc:mga0qj67_859120_c1
467 nmdc:mga06r32_152080_c1
468 nmdc:mga06r32_730_c1
469 nmdc:mga08y16_186401_c1
470 nmdc:mga08y16_200134_c1
471 nmdc:mga08y16_205658_c1
472 nmdc:mga08y16_81556_c1
473 Ga0495601_0001372
474 Ga0495601_0254680
475 Ga0495601_0552172
476 Ga0495619_0011275
477 Ga0501084_0055054
478 Ga0501082_0160297

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

82

231

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a5v-assembly1.cif.gz_A crystal structure of m. tuberculosis beta carbonic anhydrase, rv3588c, tetrameric form 0.9144 6 202
2a5v-assembly1.cif.gz_A crystal structure of m. tuberculosis beta carbonic anhydrase, rv3588c, tetrameric form 0.8836 6 202
3e2x-assembly1.cif.gz_B-2 h. influenzae beta-carbonic anhydrase, variant v47a 0.8815 47 200
4waj-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydase variant p48s/a49p 0.8789 45 200
1ym3-assembly1.cif.gz_A-2 crystal structure of carbonic anhydrase rv3588c from mycobacterium tuberculosis 0.8774 7 202
ID Description Score Start End Superfamily
1ym3A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8774 7 202 3.40.1050.10
1ddzB02 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8691 45 202 3.40.1050.10
af_A0A1D6NHQ1_7_236_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8588 41 202 3.40.1050.10
1ym3A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8383 7 202 3.40.1050.10
4wamA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8147 47 191 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A5C6FRU4-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9744 6 202 GO:0004089
GO:0008270
GO:0015976
AF-A0A1G7XDC1-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9715 5 202 GO:0004089
GO:0008270
GO:0015976
AF-A0A518HNH6-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9715 9 202 GO:0004089
GO:0004423
GO:0005737
GO:0008270
GO:0015976
AF-A0A133XID9-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9696 7 202 GO:0004089
GO:0008270
GO:0015976
AF-A0A2J6HH29-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9688 6 113 GO:0004089
GO:0008270
GO:0015976

Map