F351124

General Info

Members Datasets Scaffolds Average Seq Length
238 151 476 156

Family's Representative Sequence

Representative Sequence 3300035112|Ga0373932_0010696|Ga0373932_0010696_366_938
Length 190
Sequence VLSFAAHDARRGSAIACHAAQLRETGARANDGLPLTTVTKSPELDMTTFIDAPPGLVMKAFFDVQALQAWWQVRHAVVSPRMLGPYAIEWPATDFSDELLGRLGGVFRGTVMQADPTDGFFVADAYWLPPDGEPIGPMALHVVITPAGLGTKVRVTQSGFEEGERWRRYYEVVAHGWERALASLKALLEK

Samples

Sample ID Description Type Environment
1 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
117 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 6.3
Rhizosphere 92.02
Stem 0
Stem Tuber 0
Unclassified 21.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373932_0010696 3300035112 Bacteria 2227
2 Ga0070676_10377321 3300005328 Unclassified 981
3 Ga0070676_10467851 3300005328 Bacteria 890
4 Ga0070683_100088108 3300005329 Bacteria 2912
5 Ga0070683_100212664 3300005329 Bacteria 1837
6 Ga0070690_100621255 3300005330 Unclassified 822
7 Ga0068869_100453075 3300005334 Unclassified 1064
8 Ga0070666_10126264 3300005335 Bacteria 1776
9 Ga0068868_100665086 3300005338 Bacteria 929
10 Ga0070668_100041589 3300005347 Bacteria 3521
11 Ga0070669_100034445 3300005353 Bacteria 3666
12 Ga0070675_100106408 3300005354 Bacteria 2368
13 Ga0070671_100177458 3300005355 Bacteria 1803
14 Ga0070674_100000794 3300005356 Bacteria 16226
15 Ga0070674_100185712 3300005356 Bacteria 1595
16 Ga0070673_100103823 3300005364 Bacteria 2346
17 Ga0070701_10248000 3300005438 Unclassified 1074
18 Ga0070700_100212511 3300005441 Unclassified 1366
19 Ga0070694_100149428 3300005444 Bacteria 1705
20 Ga0070694_100795789 3300005444 Bacteria 775
21 Ga0070708_100455352 3300005445 Bacteria 1207
22 Ga0070678_100077565 3300005456 Bacteria 2507
23 Ga0070681_10145398 3300005458 Bacteria 2300
24 Ga0070685_10871159 3300005466 Bacteria 668
25 Ga0070707_100060677 3300005468 Bacteria 3627
26 Ga0070699_100184340 3300005518 Unclassified 1853
27 Ga0070679_100363883 3300005530 Bacteria 1394
28 Ga0070684_100256779 3300005535 Bacteria 1598
29 Ga0070697_100222996 3300005536 Bacteria 1607
30 Ga0070697_100239804 3300005536 Unclassified 1548
31 Ga0070686_100091470 3300005544 Bacteria 2036
32 Ga0070686_100232973 3300005544 Bacteria 1337
33 Ga0070695_100005004 3300005545 Bacteria 7813
34 Ga0070695_100342918 3300005545 Bacteria 1117
35 Ga0070696_100038082 3300005546 Bacteria 3318
36 Ga0070693_100085430 3300005547 Bacteria 1891
37 Ga0070665_100061871 3300005548 Bacteria 3753
38 Ga0070665_100088680 3300005548 Bacteria 3099
39 Ga0070704_100008822 3300005549 Bacteria 6068
40 Ga0070664_100223839 3300005564 Bacteria 1684
41 Ga0068854_100111369 3300005578 Bacteria 2065
42 Ga0068856_100383870 3300005614 Unclassified 1424
43 Ga0068852_100683507 3300005616 Unclassified 1036
44 Ga0068852_100994589 3300005616 Unclassified 857
45 Ga0068859_100678477 3300005617 Bacteria 1122
46 Ga0068859_100829975 3300005617 Bacteria 1011
47 Ga0068866_10146625 3300005718 Unclassified 1362
48 Ga0068866_10229266 3300005718 Bacteria 1125
49 Ga0068863_100100182 3300005841 Bacteria 2754
50 Ga0068863_100278247 3300005841 Bacteria 1621
51 Ga0068858_100039821 3300005842 Unclassified 4357
52 Ga0068858_100265345 3300005842 Bacteria 1633
53 Ga0081540_1259104 3300005983 Bacteria 605
54 Ga0081539_10011824 3300005985 Bacteria 6829
55 Ga0097621_100003987 3300006237 Bacteria 10230
56 Ga0097621_100044139 3300006237 Bacteria 3596
57 Ga0097621_100076058 3300006237 Bacteria 2784
58 Ga0097621_100085905 3300006237 Bacteria 2625
59 Ga0097621_100256858 3300006237 Bacteria 1532
60 Ga0097621_100386127 3300006237 Bacteria 1251
61 Ga0068871_100002245 3300006358 Bacteria 13132
62 Ga0068871_100006871 3300006358 Bacteria 8102
63 Ga0068871_100027746 3300006358 Bacteria 4431
64 Ga0068871_100051708 3300006358 Bacteria 3327
65 Ga0068871_101440009 3300006358 Bacteria 650
66 Ga0068871_101486345 3300006358 Bacteria 640
67 Ga0075433_10029853 3300006852 Bacteria 4648
68 Ga0075434_100109338 3300006871 Bacteria 2775
69 Ga0068865_100254277 3300006881 Unclassified 1388
70 Ga0097620_100678490 3300006931 Bacteria 1122
71 Ga0097620_100830000 3300006931 Bacteria 1011
72 Ga0075435_100267685 3300007076 Unclassified 1457
73 Ga0099794_10039743 3300007265 Bacteria 2234
74 Ga0105240_10851231 3300009093 Bacteria 984
75 Ga0111539_12925522 3300009094 Bacteria 552
76 Ga0114129_10014660 3300009147 Bacteria 11165
77 Ga0114129_10958123 3300009147 Bacteria 1080
78 Ga0105243_10085515 3300009148 Bacteria 2585
79 Ga0105242_10004987 3300009176 Bacteria 10269
80 Ga0105242_10058881 3300009176 Bacteria 3151
81 Ga0105242_10071020 3300009176 Bacteria 2888
82 Ga0105242_11497590 3300009176 Unclassified 705
83 Ga0105248_10055519 3300009177 Bacteria 4443
84 Ga0105248_10191189 3300009177 Bacteria 2306
85 Ga0105248_10279087 3300009177 Bacteria 1881
86 Ga0105248_12387922 3300009177 Unclassified 602
87 Ga0105238_11094685 3300009551 Unclassified 819
88 Ga0105238_11353042 3300009551 Bacteria 739
89 Ga0105249_10095518 3300009553 Unclassified 2787
90 Ga0105249_10221774 3300009553 Bacteria 1861
91 Ga0157374_10515950 3300013296 Bacteria 1201
92 Ga0157374_10655124 3300013296 Unclassified 1062
93 Ga0157378_10007207 3300013297 Bacteria 9714
94 Ga0157378_10276817 3300013297 Bacteria 1616
95 Ga0157375_10029136 3300013308 Bacteria 5187
96 Ga0157375_10192831 3300013308 Bacteria 2192
97 Ga0157375_12283898 3300013308 Bacteria 645
98 Ga0163163_10042548 3300014325 Bacteria 4450
99 Ga0163163_10793575 3300014325 Unclassified 1010
100 Ga0157380_10529724 3300014326 Bacteria 1151
101 Ga0157380_10601388 3300014326 Bacteria 1088
102 Ga0157377_10020340 3300014745 Bacteria 3476
103 Ga0157379_10893651 3300014968 Unclassified 842
104 Ga0157376_10142789 3300014969 Bacteria 2150
105 Ga0157376_11518913 3300014969 Bacteria 703
106 Ga0157376_12341611 3300014969 Unclassified 573
107 Ga0163161_10215788 3300017792 Bacteria 1484
108 Ga0163161_10700310 3300017792 Unclassified 843
109 Ga0213876_10244984 3300021384 Bacteria 952
110 Ga0207653_10080698 3300025885 Unclassified 1126
111 Ga0207680_10244670 3300025903 Bacteria 1237
112 Ga0207685_10014635 3300025905 Bacteria 2461
113 Ga0207699_10108934 3300025906 Unclassified 1772
114 Ga0207645_10077997 3300025907 Bacteria 2122
115 Ga0207645_10111331 3300025907 Bacteria 1772
116 Ga0207645_10137837 3300025907 Bacteria 1589
117 Ga0207707_10146975 3300025912 Bacteria 2061
118 Ga0207652_11051635 3300025921 Unclassified 714
119 Ga0207694_10857628 3300025924 Bacteria 768
120 Ga0207694_11621726 3300025924 Unclassified 545
121 Ga0207659_10000249 3300025926 Bacteria 32757
122 Ga0207659_10059085 3300025926 Bacteria 2755
123 Ga0207687_10024433 3300025927 Bacteria 4038
124 Ga0207644_10161731 3300025931 Bacteria 1741
125 Ga0207690_11336080 3300025932 Unclassified 599
126 Ga0207706_10124427 3300025933 Bacteria 2268
127 Ga0207706_10800721 3300025933 Unclassified 800
128 Ga0207686_10126731 3300025934 Unclassified 1746
129 Ga0207686_10557349 3300025934 Bacteria 897
130 Ga0207709_10032920 3300025935 Bacteria 3039
131 Ga0207669_10003660 3300025937 Bacteria 6675
132 Ga0207669_10149259 3300025937 Bacteria 1635
133 Ga0207704_10025870 3300025938 Bacteria 3209
134 Ga0207704_10088243 3300025938 Bacteria 2028
135 Ga0207704_10307821 3300025938 Bacteria 1217
136 Ga0207704_10325886 3300025938 Bacteria 1187
137 Ga0207691_10315108 3300025940 Bacteria 1342
138 Ga0207711_10141464 3300025941 Bacteria 2165
139 Ga0207711_10295852 3300025941 Bacteria 1492
140 Ga0207711_10863773 3300025941 Unclassified 842
141 Ga0207689_10297034 3300025942 Bacteria 1339
142 Ga0207661_10131841 3300025944 Bacteria 2142
143 Ga0207661_10413654 3300025944 Bacteria 1224
144 Ga0207679_10772068 3300025945 Unclassified 875
145 Ga0207651_10021712 3300025960 Bacteria 3908
146 Ga0207712_10155442 3300025961 Bacteria 1771
147 Ga0207668_10298214 3300025972 Unclassified 1329
148 Ga0207640_10040549 3300025981 Bacteria 2954
149 Ga0207677_10582487 3300026023 Bacteria 979
150 Ga0207703_10054735 3300026035 Bacteria 3245
151 Ga0207703_10065562 3300026035 Bacteria 2985
152 Ga0207703_10070559 3300026035 Bacteria 2884
153 Ga0207703_10475088 3300026035 Bacteria 1171
154 Ga0207708_10389707 3300026075 Unclassified 1150
155 Ga0207702_10617052 3300026078 Bacteria 1065
156 Ga0207641_10433082 3300026088 Bacteria 1268
157 Ga0207648_10019706 3300026089 Bacteria 6087
158 Ga0207648_10090835 3300026089 Bacteria 2669
159 Ga0207675_100016861 3300026118 Bacteria 6823
160 Ga0207675_100224437 3300026118 Bacteria 1811
161 Ga0207683_10251999 3300026121 Bacteria 1611
162 Ga0207698_10615851 3300026142 Bacteria 1072
163 Ga0207698_10719199 3300026142 Bacteria 995
164 Ga0207698_10739405 3300026142 Unclassified 982
165 Ga0268266_10049713 3300028379 Bacteria 3596
166 Ga0268264_10102920 3300028381 Bacteria 2486
167 Ga0265318_10023114 3300028577 Bacteria 2481
168 Ga0265318_10258257 3300028577 Unclassified 636
169 Ga0265328_10083545 3300031239 Bacteria 1178
170 Ga0373932_0030331 3300035112 Bacteria 1498
171 Ga0373936_0455626 3300035113 Unclassified 592
172 Ga0373941_0003731 3300035115 Bacteria 3472
173 Ga0373953_0154218 3300035117 Bacteria 986
174 Ga0373957_0253390 3300035120 Bacteria 741
175 Ga0373946_0084375 3300035171 Bacteria 1397
176 Ga0373935_0348287 3300035692 Bacteria 1056
177 Ga0373935_0436687 3300035692 Bacteria 944
178 Ga0373935_0988379 3300035692 Bacteria 625
179 Ga0373937_0184449 3300036401 Bacteria 1960
180 Ga0373925_0062376 3300037068 Bacteria 2803
181 Ga0436365_0861194 3300039437 Unclassified 532
182 Ga0451839_0271284 3300041496 Bacteria 947
183 Ga0450916_006787 3300042530 Bacteria 1358
184 Ga0495580_0481743 3300046472 Unclassified 830
185 Ga0495582_0827771 3300046473 Unclassified 535
186 Ga0495608_0657663 3300046511 Unclassified 626
187 Ga0495618_0468189 3300046514 Unclassified 763
188 Ga0495634_0355900 3300046642 Bacteria 876
189 Ga0495659_0353278 3300046664 Bacteria 628
190 Ga0495659_0423203 3300046664 Bacteria 577
191 Ga0495588_0185827 3300046674 Bacteria 1098
192 Ga0495588_0404954 3300046674 Bacteria 716
193 Ga0495647_0085083 3300046681 Bacteria 1288
194 Ga0495647_0374361 3300046681 Unclassified 651
195 Ga0495658_0069171 3300046683 Bacteria 2046
196 Ga0495658_0094597 3300046683 Bacteria 1775
197 Ga0496100_0000448 3300048903 Bacteria 19914
198 Ga0496101_0002514 3300048904 Bacteria 11257
199 Ga0496102_0055543 3300048905 Bacteria 3611
200 Ga0496104_0313590 3300048907 Bacteria 1481
201 Ga0496104_0465687 3300048907 Bacteria 1175
202 Ga0496105_0052149 3300048908 Bacteria 3378
203 Ga0496105_1260949 3300048908 Unclassified 541
204 Ga0496106_0005072 3300048909 Bacteria 9752
205 Ga0496107_0758231 3300048910 Unclassified 712
206 Ga0496107_1063470 3300048910 Unclassified 586
207 Ga0496110_0638503 3300048913 Bacteria 964
208 Ga0496112_0539162 3300048915 Bacteria 1101
209 Ga0496114_0000462 3300048917 Bacteria 29857
210 Ga0496114_0444879 3300048917 Bacteria 1148
211 Ga0496115_0174081 3300048918 Bacteria 1780
212 Ga0501068_0666225 3300049584 Bacteria 680
213 Ga0501074_0476266 3300049590 Bacteria 885
214 Ga0501076_0319830 3300049592 Bacteria 1273
215 Ga0501076_0711364 3300049592 Bacteria 829
216 Ga0501079_0511854 3300049741 Bacteria 944
217 Ga0501081_0167212 3300049743 Bacteria 1587
218 Ga0501035_0801739 3300049822 Unclassified 752
219 Ga0501035_0885421 3300049822 Unclassified 708
220 nmdc:mga06z11_468491_c1 3300050494 Bacteria 762
221 nmdc:mga05p37_100256_c1 3300050507 Bacteria 3567
222 nmdc:mga05p37_23969_c1 3300050507 Bacteria 7411
223 nmdc:mga05p37_27261_c1 3300050507 Bacteria 6956
224 nmdc:mga05p37_690172_c1 3300050507 Unclassified 1136
225 nmdc:mga05p37_92466_c1 3300050507 Bacteria 3727
226 nmdc:mga0n895_103305_c1 3300050512 Bacteria 2861
227 nmdc:mga0n895_106029_c1 3300050512 Bacteria 2823
228 nmdc:mga0n895_1231941_c1 3300050512 Bacteria 721
229 nmdc:mga0n895_947206_c1 3300050512 Bacteria 844
230 nmdc:mga0rr50_497119_c1 3300050513 Unclassified 1037
231 nmdc:mga0a205_391508_c1 3300050515 Bacteria 1254
232 nmdc:mga0a205_452046_c1 3300050515 Bacteria 1144
233 nmdc:mga0a205_59946_c1 3300050515 Bacteria 3676
234 nmdc:mga0a205_837459_c1 3300050515 Unclassified 767
235 Ga0495601_0098552 3300053077 Bacteria 1887
236 Ga0495601_0405952 3300053077 Bacteria 883
237 Ga0501084_0240649 3300054114 Bacteria 1528
238 Ga0501082_0763604 3300060353 Unclassified 846
239 Ga0373932_0010696
240 Ga0070676_10377321
241 Ga0070676_10467851
242 Ga0070683_100088108
243 Ga0070683_100212664
244 Ga0070690_100621255
245 Ga0068869_100453075
246 Ga0070666_10126264
247 Ga0068868_100665086
248 Ga0070668_100041589
249 Ga0070669_100034445
250 Ga0070675_100106408
251 Ga0070671_100177458
252 Ga0070674_100000794
253 Ga0070674_100185712
254 Ga0070673_100103823
255 Ga0070701_10248000
256 Ga0070700_100212511
257 Ga0070694_100149428
258 Ga0070694_100795789
259 Ga0070708_100455352
260 Ga0070678_100077565
261 Ga0070681_10145398
262 Ga0070685_10871159
263 Ga0070707_100060677
264 Ga0070699_100184340
265 Ga0070679_100363883
266 Ga0070684_100256779
267 Ga0070697_100222996
268 Ga0070697_100239804
269 Ga0070686_100091470
270 Ga0070686_100232973
271 Ga0070695_100005004
272 Ga0070695_100342918
273 Ga0070696_100038082
274 Ga0070693_100085430
275 Ga0070665_100061871
276 Ga0070665_100088680
277 Ga0070704_100008822
278 Ga0070664_100223839
279 Ga0068854_100111369
280 Ga0068856_100383870
281 Ga0068852_100683507
282 Ga0068852_100994589
283 Ga0068859_100678477
284 Ga0068859_100829975
285 Ga0068866_10146625
286 Ga0068866_10229266
287 Ga0068863_100100182
288 Ga0068863_100278247
289 Ga0068858_100039821
290 Ga0068858_100265345
291 Ga0081540_1259104
292 Ga0081539_10011824
293 Ga0097621_100003987
294 Ga0097621_100044139
295 Ga0097621_100076058
296 Ga0097621_100085905
297 Ga0097621_100256858
298 Ga0097621_100386127
299 Ga0068871_100002245
300 Ga0068871_100006871
301 Ga0068871_100027746
302 Ga0068871_100051708
303 Ga0068871_101440009
304 Ga0068871_101486345
305 Ga0075433_10029853
306 Ga0075434_100109338
307 Ga0068865_100254277
308 Ga0097620_100678490
309 Ga0097620_100830000
310 Ga0075435_100267685
311 Ga0099794_10039743
312 Ga0105240_10851231
313 Ga0111539_12925522
314 Ga0114129_10014660
315 Ga0114129_10958123
316 Ga0105243_10085515
317 Ga0105242_10004987
318 Ga0105242_10058881
319 Ga0105242_10071020
320 Ga0105242_11497590
321 Ga0105248_10055519
322 Ga0105248_10191189
323 Ga0105248_10279087
324 Ga0105248_12387922
325 Ga0105238_11094685
326 Ga0105238_11353042
327 Ga0105249_10095518
328 Ga0105249_10221774
329 Ga0157374_10515950
330 Ga0157374_10655124
331 Ga0157378_10007207
332 Ga0157378_10276817
333 Ga0157375_10029136
334 Ga0157375_10192831
335 Ga0157375_12283898
336 Ga0163163_10042548
337 Ga0163163_10793575
338 Ga0157380_10529724
339 Ga0157380_10601388
340 Ga0157377_10020340
341 Ga0157379_10893651
342 Ga0157376_10142789
343 Ga0157376_11518913
344 Ga0157376_12341611
345 Ga0163161_10215788
346 Ga0163161_10700310
347 Ga0213876_10244984
348 Ga0207653_10080698
349 Ga0207680_10244670
350 Ga0207685_10014635
351 Ga0207699_10108934
352 Ga0207645_10077997
353 Ga0207645_10111331
354 Ga0207645_10137837
355 Ga0207707_10146975
356 Ga0207652_11051635
357 Ga0207694_10857628
358 Ga0207694_11621726
359 Ga0207659_10000249
360 Ga0207659_10059085
361 Ga0207687_10024433
362 Ga0207644_10161731
363 Ga0207690_11336080
364 Ga0207706_10124427
365 Ga0207706_10800721
366 Ga0207686_10126731
367 Ga0207686_10557349
368 Ga0207709_10032920
369 Ga0207669_10003660
370 Ga0207669_10149259
371 Ga0207704_10025870
372 Ga0207704_10088243
373 Ga0207704_10307821
374 Ga0207704_10325886
375 Ga0207691_10315108
376 Ga0207711_10141464
377 Ga0207711_10295852
378 Ga0207711_10863773
379 Ga0207689_10297034
380 Ga0207661_10131841
381 Ga0207661_10413654
382 Ga0207679_10772068
383 Ga0207651_10021712
384 Ga0207712_10155442
385 Ga0207668_10298214
386 Ga0207640_10040549
387 Ga0207677_10582487
388 Ga0207703_10054735
389 Ga0207703_10065562
390 Ga0207703_10070559
391 Ga0207703_10475088
392 Ga0207708_10389707
393 Ga0207702_10617052
394 Ga0207641_10433082
395 Ga0207648_10019706
396 Ga0207648_10090835
397 Ga0207675_100016861
398 Ga0207675_100224437
399 Ga0207683_10251999
400 Ga0207698_10615851
401 Ga0207698_10719199
402 Ga0207698_10739405
403 Ga0268266_10049713
404 Ga0268264_10102920
405 Ga0265318_10023114
406 Ga0265318_10258257
407 Ga0265328_10083545
408 Ga0373932_0030331
409 Ga0373936_0455626
410 Ga0373941_0003731
411 Ga0373953_0154218
412 Ga0373957_0253390
413 Ga0373946_0084375
414 Ga0373935_0348287
415 Ga0373935_0436687
416 Ga0373935_0988379
417 Ga0373937_0184449
418 Ga0373925_0062376
419 Ga0436365_0861194
420 Ga0451839_0271284
421 Ga0450916_006787
422 Ga0495580_0481743
423 Ga0495582_0827771
424 Ga0495608_0657663
425 Ga0495618_0468189
426 Ga0495634_0355900
427 Ga0495659_0353278
428 Ga0495659_0423203
429 Ga0495588_0185827
430 Ga0495588_0404954
431 Ga0495647_0085083
432 Ga0495647_0374361
433 Ga0495658_0069171
434 Ga0495658_0094597
435 Ga0496100_0000448
436 Ga0496101_0002514
437 Ga0496102_0055543
438 Ga0496104_0313590
439 Ga0496104_0465687
440 Ga0496105_0052149
441 Ga0496105_1260949
442 Ga0496106_0005072
443 Ga0496107_0758231
444 Ga0496107_1063470
445 Ga0496110_0638503
446 Ga0496112_0539162
447 Ga0496114_0000462
448 Ga0496114_0444879
449 Ga0496115_0174081
450 Ga0501068_0666225
451 Ga0501074_0476266
452 Ga0501076_0319830
453 Ga0501076_0711364
454 Ga0501079_0511854
455 Ga0501081_0167212
456 Ga0501035_0801739
457 Ga0501035_0885421
458 nmdc:mga06z11_468491_c1
459 nmdc:mga05p37_100256_c1
460 nmdc:mga05p37_23969_c1
461 nmdc:mga05p37_27261_c1
462 nmdc:mga05p37_690172_c1
463 nmdc:mga05p37_92466_c1
464 nmdc:mga0n895_103305_c1
465 nmdc:mga0n895_106029_c1
466 nmdc:mga0n895_1231941_c1
467 nmdc:mga0n895_947206_c1
468 nmdc:mga0rr50_497119_c1
469 nmdc:mga0a205_391508_c1
470 nmdc:mga0a205_452046_c1
471 nmdc:mga0a205_59946_c1
472 nmdc:mga0a205_837459_c1
473 Ga0495601_0098552
474 Ga0495601_0405952
475 Ga0501084_0240649
476 Ga0501082_0763604

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

51

189

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8415 7 157
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8154 4 157
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8076 7 157
3pu2-assembly8.cif.gz_H crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.806 1 156
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.806 7 157
ID Description Score Start End Superfamily
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8389 8 158 3.30.530.20
af_Q4E5D5_198_328_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7964 5 152 3.30.530.20
af_Q55DB6_248_379_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7958 4 154 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7845 8 158 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7844 5 157 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2V8C6X7-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9879 1 158
AF-A0A2V8BRN1-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9859 2 147
AF-A0A2V8EP34-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9834 7 158
AF-A0A2E8E893-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9792 7 157
AF-A0A2E4W762-F1-model_v4 SRPBCC domain-containing protein 0.9767 7 157

Map