F351079

General Info

Members Datasets Scaffolds Average Seq Length
238 141 476 193

Family's Representative Sequence

Representative Sequence 3300031242|Ga0265329_10067371|Ga0265329_100673712
Length 200
Sequence MPLKSLAEYEQLAEQAHGHLCAGQILGIRMAVYGLKLLGLADPAGADRKRLVTFVEIDRCVTDAIPVVTGCRLGKRALKFRDFGKVAATFCDLERDRAVRILARESARARARELYPDLPGENQPSRNRQQMRAYRELADEDLFAVQWVHVALAPEDIPGYKAPRAVCAQCGEAISFRREVVRDRRTLCRACAGQAYYTLL

Samples

Sample ID Description Type Environment
1 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.84
Rhizosphere 98.74
Stem 0
Stem Tuber 0
Unclassified 22.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265329_10067371 3300031242 Unclassified 1132
2 Ga0070658_10132617 3300005327 Bacteria 2077
3 Ga0070683_100000048 3300005329 Bacteria 93771
4 Ga0070683_100238323 3300005329 Bacteria 1730
5 Ga0070683_100686197 3300005329 Bacteria 981
6 Ga0070680_100000314 3300005336 Bacteria 32426
7 Ga0070689_100344099 3300005340 Bacteria 1249
8 Ga0070671_100094653 3300005355 Bacteria 2504
9 Ga0070688_100041499 3300005365 Bacteria 2825
10 Ga0070709_10116045 3300005434 Unclassified 1807
11 Ga0070709_10123722 3300005434 Unclassified 1757
12 Ga0070714_100078014 3300005435 Unclassified 2878
13 Ga0070713_100465483 3300005436 Bacteria 1189
14 Ga0070711_100095495 3300005439 Bacteria 2151
15 Ga0070711_100253428 3300005439 Unclassified 1382
16 Ga0070705_100003731 3300005440 Bacteria 7456
17 Ga0070694_100758841 3300005444 Unclassified 793
18 Ga0070708_100000222 3300005445 Bacteria 42379
19 Ga0070708_100175850 3300005445 Bacteria 2000
20 Ga0070678_100567579 3300005456 Unclassified 1009
21 Ga0070681_10060623 3300005458 Bacteria 3759
22 Ga0070685_10046563 3300005466 Bacteria 2490
23 Ga0070706_100827804 3300005467 Unclassified 856
24 Ga0070707_100324383 3300005468 Unclassified 1496
25 Ga0070698_100003971 3300005471 Bacteria 16278
26 Ga0070699_100010850 3300005518 Bacteria 7884
27 Ga0070699_100087545 3300005518 Bacteria 2719
28 Ga0070699_100414285 3300005518 Unclassified 1219
29 Ga0070679_100028415 3300005530 Bacteria 5514
30 Ga0070679_100076485 3300005530 Bacteria 3337
31 Ga0070684_100000038 3300005535 Bacteria 94959
32 Ga0070684_100610543 3300005535 Unclassified 1014
33 Ga0070697_100009402 3300005536 Bacteria 7642
34 Ga0070697_100156657 3300005536 Bacteria 1923
35 Ga0070672_100220341 3300005543 Bacteria 1591
36 Ga0070686_100322573 3300005544 Bacteria 1152
37 Ga0070695_100000137 3300005545 Bacteria 33722
38 Ga0070695_100054980 3300005545 Bacteria 2565
39 Ga0070695_100148710 3300005545 Unclassified 1632
40 Ga0070696_100001528 3300005546 Bacteria 15177
41 Ga0070696_100002598 3300005546 Bacteria 11966
42 Ga0070693_100000228 3300005547 Bacteria 26152
43 Ga0070665_100382453 3300005548 Bacteria 1415
44 Ga0068855_100011438 3300005563 Bacteria 10722
45 Ga0068855_100032167 3300005563 Bacteria 6263
46 Ga0068856_100268772 3300005614 Unclassified 1721
47 Ga0068852_100029474 3300005616 Bacteria 4510
48 Ga0068852_100131031 3300005616 Bacteria 2309
49 Ga0068859_100523207 3300005617 Bacteria 1281
50 Ga0068858_100506755 3300005842 Unclassified 1166
51 Ga0070717_10018075 3300006028 Bacteria 5500
52 Ga0070717_10441052 3300006028 Archaea 1173
53 Ga0070715_10177344 3300006163 Unclassified 1066
54 Ga0070716_100024147 3300006173 Unclassified 3233
55 Ga0070712_100098969 3300006175 Bacteria 2152
56 Ga0070712_100150115 3300006175 Unclassified 1788
57 Ga0068871_100503325 3300006358 Bacteria 1092
58 Ga0068871_100615977 3300006358 Unclassified 988
59 Ga0075428_100789987 3300006844 Unclassified 1009
60 Ga0075428_100877189 3300006844 Bacteria 952
61 Ga0075431_100118922 3300006847 Bacteria 2726
62 Ga0075436_100000761 3300006914 Bacteria 21313
63 Ga0075436_100008977 3300006914 Bacteria 6841
64 Ga0097620_100523186 3300006931 Bacteria 1281
65 Ga0075435_100507115 3300007076 Bacteria 1043
66 Ga0099794_10005719 3300007265 Bacteria 5010
67 Ga0099794_10006607 3300007265 Bacteria 4708
68 Ga0099794_10020702 3300007265 Unclassified 2979
69 Ga0099794_10046736 3300007265 Bacteria 2074
70 Ga0099794_10070290 3300007265 Unclassified 1714
71 Ga0099794_10158869 3300007265 Unclassified 1149
72 Ga0099794_10305203 3300007265 Unclassified 825
73 Ga0105240_10001679 3300009093 Bacteria 37566
74 Ga0105240_10166932 3300009093 Bacteria 2610
75 Ga0105245_10611566 3300009098 Bacteria 1117
76 Ga0114129_10156042 3300009147 Bacteria 3121
77 Ga0114129_10422065 3300009147 Bacteria 1754
78 Ga0105243_11174945 3300009148 Bacteria 779
79 Ga0105241_10324998 3300009174 Bacteria 1328
80 Ga0105248_10032338 3300009177 Bacteria 5847
81 Ga0105248_10253700 3300009177 Bacteria 1980
82 Ga0105248_10992358 3300009177 Unclassified 949
83 Ga0105237_10036108 3300009545 Bacteria 5000
84 Ga0105237_10141595 3300009545 Bacteria 2399
85 Ga0105237_10208957 3300009545 Unclassified 1952
86 Ga0105238_11019341 3300009551 Unclassified 849
87 Ga0105239_10700992 3300010375 Unclassified 1157
88 Ga0157370_10005567 3300013104 Bacteria 14116
89 Ga0157370_10978043 3300013104 Unclassified 767
90 Ga0157369_10003478 3300013105 Bacteria 18686
91 Ga0157369_10091815 3300013105 Bacteria 3241
92 Ga0157378_10246001 3300013297 Bacteria 1710
93 Ga0157372_10067246 3300013307 Bacteria 4026
94 Ga0157372_10412937 3300013307 Bacteria 1573
95 Ga0157375_10832232 3300013308 Bacteria 1070
96 Ga0157376_10187885 3300014969 Unclassified 1893
97 Ga0157376_11063883 3300014969 Bacteria 834
98 Ga0157376_11168258 3300014969 Unclassified 797
99 Ga0206355_1307302 3300020076 Unclassified 750
100 Ga0213875_10067696 3300021388 Unclassified 1668
101 Ga0207653_10000567 3300025885 Bacteria 13300
102 Ga0207685_10132761 3300025905 Bacteria 1107
103 Ga0207684_10676372 3300025910 Unclassified 878
104 Ga0207707_10003637 3300025912 Bacteria 13670
105 Ga0207695_10008053 3300025913 Bacteria 13268
106 Ga0207695_10122864 3300025913 Bacteria 2562
107 Ga0207693_10076638 3300025915 Bacteria 2619
108 Ga0207693_10107296 3300025915 Unclassified 2191
109 Ga0207663_10018644 3300025916 Bacteria 3894
110 Ga0207663_10041804 3300025916 Bacteria 2796
111 Ga0207660_10005184 3300025917 Bacteria 8471
112 Ga0207660_10152064 3300025917 Bacteria 1779
113 Ga0207652_10017147 3300025921 Bacteria 5923
114 Ga0207687_10466867 3300025927 Bacteria 1049
115 Ga0207664_10084084 3300025929 Unclassified 2595
116 Ga0207664_10146563 3300025929 Archaea 2002
117 Ga0207644_10586358 3300025931 Bacteria 925
118 Ga0207670_10269312 3300025936 Bacteria 1323
119 Ga0207665_10000213 3300025939 Bacteria 39281
120 Ga0207665_10576163 3300025939 Bacteria 877
121 Ga0207661_10000049 3300025944 Bacteria 93797
122 Ga0207661_10350553 3300025944 Unclassified 1332
123 Ga0207667_10042446 3300025949 Bacteria 4834
124 Ga0207667_10524902 3300025949 Bacteria 1199
125 Ga0207703_10034908 3300026035 Bacteria 3994
126 Ga0207702_10568732 3300026078 Bacteria 1110
127 Ga0207702_11169576 3300026078 Unclassified 763
128 Ga0207648_10706688 3300026089 Bacteria 934
129 Ga0207676_11251566 3300026095 Unclassified 736
130 Ga0207698_10105103 3300026142 Unclassified 2352
131 Ga0207698_10300695 3300026142 Bacteria 1493
132 Ga0209588_1005611 3300027671 Bacteria 3604
133 Ga0209588_1008968 3300027671 Unclassified 2978
134 Ga0209588_1009332 3300027671 Bacteria 2931
135 Ga0209588_1009877 3300027671 Bacteria 2860
136 Ga0209588_1131780 3300027671 Bacteria 797
137 Ga0268266_10617230 3300028379 Unclassified 1042
138 Ga0265330_10292649 3300031235 Unclassified 686
139 Ga0265325_10190176 3300031241 Bacteria 952
140 Ga0265331_10011617 3300031250 Bacteria 4816
141 Ga0265316_10001962 3300031344 Bacteria 21630
142 Ga0307408_100112842 3300031548 Bacteria 2091
143 Ga0265313_10229466 3300031595 Bacteria 763
144 Ga0265314_10015230 3300031711 Bacteria 6108
145 Ga0265314_10080996 3300031711 Bacteria 2141
146 Ga0265342_10133087 3300031712 Bacteria 1391
147 Ga0373926_0060284 3300035083 Bacteria 1382
148 Ga0373934_0002237 3300035086 Bacteria 7113
149 Ga0373934_0019896 3300035086 Bacteria 2580
150 Ga0373923_0276005 3300035111 Bacteria 791
151 Ga0373945_0051869 3300035116 Bacteria 1510
152 Ga0373953_0039327 3300035117 Unclassified 1874
153 Ga0373953_0415886 3300035117 Bacteria 593
154 Ga0373954_0001400 3300035118 Bacteria 9773
155 Ga0373954_0012705 3300035118 Bacteria 3747
156 Ga0373954_0043507 3300035118 Bacteria 2095
157 Ga0373956_0060919 3300035119 Archaea 1709
158 Ga0373956_0251056 3300035119 Bacteria 841
159 Ga0373956_0264262 3300035119 Bacteria 818
160 Ga0373957_0009018 3300035120 Unclassified 3253
161 Ga0373943_0008861 3300035170 Unclassified 4507
162 Ga0373943_0142484 3300035170 Bacteria 1292
163 Ga0373946_0052158 3300035171 Bacteria 1714
164 Ga0373955_0002485 3300035172 Bacteria 8057
165 Ga0373955_0066968 3300035172 Bacteria 1998
166 Ga0373955_0330433 3300035172 Bacteria 922
167 Ga0373935_0915463 3300035692 Bacteria 650
168 Ga0373927_0001757 3300035695 Bacteria 16176
169 Ga0373927_0008694 3300035695 Bacteria 6823
170 Ga0373927_0101677 3300035695 Bacteria 1869
171 Ga0373933_0002206 3300035724 Bacteria 11123
172 Ga0373933_0109772 3300035724 Bacteria 1720
173 Ga0373933_0478604 3300035724 Bacteria 815
174 Ga0373947_0003516 3300035725 Bacteria 9254
175 Ga0373947_0084258 3300035725 Bacteria 1972
176 Ga0373937_0002306 3300036401 Bacteria 15942
177 Ga0373937_0009259 3300036401 Bacteria 8551
178 Ga0373937_0013776 3300036401 Bacteria 7125
179 Ga0373937_0332687 3300036401 Bacteria 1438
180 Ga0373937_0567799 3300036401 Bacteria 1078
181 Ga0373937_0991488 3300036401 Unclassified 789
182 Ga0373925_0000290 3300037068 Bacteria 52495
183 Ga0373925_0012063 3300037068 Bacteria 6257
184 Ga0373925_0037902 3300037068 Bacteria 3561
185 Ga0373925_0295187 3300037068 Bacteria 1308
186 Ga0373925_0321443 3300037068 Bacteria 1252
187 Ga0373925_0437305 3300037068 Bacteria 1070
188 Ga0373925_0459594 3300037068 Bacteria 1043
189 Ga0373925_0800132 3300037068 Unclassified 777
190 Ga0451576_0737485 3300045051 Bacteria 1035
191 Ga0451576_0878342 3300045051 Bacteria 941
192 Ga0451576_1424837 3300045051 Bacteria 721
193 Ga0466958_0463711 3300045836 Bacteria 821
194 Ga0495651_0244961 3300046462 Bacteria 1227
195 Ga0495651_0379768 3300046462 Archaea 927
196 Ga0495653_0174621 3300046463 Archaea 1480
197 Ga0495580_0000286 3300046472 Bacteria 41000
198 Ga0495580_0024601 3300046472 Bacteria 4406
199 Ga0495580_0024745 3300046472 Bacteria 4391
200 Ga0495580_0113072 3300046472 Unclassified 1886
201 Ga0495580_0363669 3300046472 Bacteria 979
202 Ga0495580_0431418 3300046472 Bacteria 886
203 Ga0495605_0297646 3300046474 Unclassified 683
204 Ga0495664_0251970 3300046477 Bacteria 1068
205 Ga0495608_0204373 3300046511 Bacteria 1243
206 Ga0495608_0315713 3300046511 Archaea 966
207 Ga0495630_0440469 3300046517 Bacteria 998
208 Ga0495630_0519925 3300046517 Bacteria 912
209 Ga0495630_0648878 3300046517 Bacteria 808
210 Ga0495666_0030131 3300046526 Bacteria 2665
211 Ga0495587_0088085 3300046536 Archaea 1796
212 Ga0495645_0152285 3300046543 Bacteria 1605
213 Ga0495667_0123472 3300046559 Bacteria 1671
214 Ga0495635_0163026 3300046663 Bacteria 1517
215 Ga0495599_0053140 3300046678 Bacteria 2538
216 Ga0495623_0014707 3300046679 Bacteria 5062
217 Ga0495623_0128904 3300046679 Bacteria 1517
218 Ga0495623_0572669 3300046679 Bacteria 589
219 Ga0495658_0540746 3300046683 Bacteria 746
220 Ga0495624_0108306 3300046690 Bacteria 1709
221 Ga0495604_0008296 3300047317 Bacteria 8217
222 Ga0495674_0014764 3300047319 Bacteria 7306
223 Ga0495674_0289860 3300047319 Bacteria 1339
224 Ga0495676_0629420 3300047321 Unclassified 697
225 Ga0495684_0009440 3300047471 Bacteria 7532
226 Ga0495684_0036920 3300047471 Bacteria 3746
227 Ga0495684_0045132 3300047471 Bacteria 3373
228 Ga0495602_0008953 3300048088 Bacteria 10434
229 Ga0495602_0147707 3300048088 Bacteria 1852
230 Ga0496104_0556469 3300048907 Unclassified 1058
231 Ga0496112_0614878 3300048915 Unclassified 1018
232 Ga0501079_0354415 3300049741 Bacteria 1150
233 nmdc:mga05p37_231928_c1 3300050507 Bacteria 2223
234 nmdc:mga05p37_807703_c1 3300050507 Bacteria 1025
235 nmdc:mga06r32_40793_c1 3300050510 Bacteria 4408
236 nmdc:mga0rr50_741505_c1 3300050513 Unclassified 838
237 nmdc:mga08x19_901_c1 3300050514 Bacteria 18860
238 nmdc:mga08x19_984_c1 3300050514 Bacteria 17781
239 Ga0265329_10067371
240 Ga0070658_10132617
241 Ga0070683_100000048
242 Ga0070683_100238323
243 Ga0070683_100686197
244 Ga0070680_100000314
245 Ga0070689_100344099
246 Ga0070671_100094653
247 Ga0070688_100041499
248 Ga0070709_10116045
249 Ga0070709_10123722
250 Ga0070714_100078014
251 Ga0070713_100465483
252 Ga0070711_100095495
253 Ga0070711_100253428
254 Ga0070705_100003731
255 Ga0070694_100758841
256 Ga0070708_100000222
257 Ga0070708_100175850
258 Ga0070678_100567579
259 Ga0070681_10060623
260 Ga0070685_10046563
261 Ga0070706_100827804
262 Ga0070707_100324383
263 Ga0070698_100003971
264 Ga0070699_100010850
265 Ga0070699_100087545
266 Ga0070699_100414285
267 Ga0070679_100028415
268 Ga0070679_100076485
269 Ga0070684_100000038
270 Ga0070684_100610543
271 Ga0070697_100009402
272 Ga0070697_100156657
273 Ga0070672_100220341
274 Ga0070686_100322573
275 Ga0070695_100000137
276 Ga0070695_100054980
277 Ga0070695_100148710
278 Ga0070696_100001528
279 Ga0070696_100002598
280 Ga0070693_100000228
281 Ga0070665_100382453
282 Ga0068855_100011438
283 Ga0068855_100032167
284 Ga0068856_100268772
285 Ga0068852_100029474
286 Ga0068852_100131031
287 Ga0068859_100523207
288 Ga0068858_100506755
289 Ga0070717_10018075
290 Ga0070717_10441052
291 Ga0070715_10177344
292 Ga0070716_100024147
293 Ga0070712_100098969
294 Ga0070712_100150115
295 Ga0068871_100503325
296 Ga0068871_100615977
297 Ga0075428_100789987
298 Ga0075428_100877189
299 Ga0075431_100118922
300 Ga0075436_100000761
301 Ga0075436_100008977
302 Ga0097620_100523186
303 Ga0075435_100507115
304 Ga0099794_10005719
305 Ga0099794_10006607
306 Ga0099794_10020702
307 Ga0099794_10046736
308 Ga0099794_10070290
309 Ga0099794_10158869
310 Ga0099794_10305203
311 Ga0105240_10001679
312 Ga0105240_10166932
313 Ga0105245_10611566
314 Ga0114129_10156042
315 Ga0114129_10422065
316 Ga0105243_11174945
317 Ga0105241_10324998
318 Ga0105248_10032338
319 Ga0105248_10253700
320 Ga0105248_10992358
321 Ga0105237_10036108
322 Ga0105237_10141595
323 Ga0105237_10208957
324 Ga0105238_11019341
325 Ga0105239_10700992
326 Ga0157370_10005567
327 Ga0157370_10978043
328 Ga0157369_10003478
329 Ga0157369_10091815
330 Ga0157378_10246001
331 Ga0157372_10067246
332 Ga0157372_10412937
333 Ga0157375_10832232
334 Ga0157376_10187885
335 Ga0157376_11063883
336 Ga0157376_11168258
337 Ga0206355_1307302
338 Ga0213875_10067696
339 Ga0207653_10000567
340 Ga0207685_10132761
341 Ga0207684_10676372
342 Ga0207707_10003637
343 Ga0207695_10008053
344 Ga0207695_10122864
345 Ga0207693_10076638
346 Ga0207693_10107296
347 Ga0207663_10018644
348 Ga0207663_10041804
349 Ga0207660_10005184
350 Ga0207660_10152064
351 Ga0207652_10017147
352 Ga0207687_10466867
353 Ga0207664_10084084
354 Ga0207664_10146563
355 Ga0207644_10586358
356 Ga0207670_10269312
357 Ga0207665_10000213
358 Ga0207665_10576163
359 Ga0207661_10000049
360 Ga0207661_10350553
361 Ga0207667_10042446
362 Ga0207667_10524902
363 Ga0207703_10034908
364 Ga0207702_10568732
365 Ga0207702_11169576
366 Ga0207648_10706688
367 Ga0207676_11251566
368 Ga0207698_10105103
369 Ga0207698_10300695
370 Ga0209588_1005611
371 Ga0209588_1008968
372 Ga0209588_1009332
373 Ga0209588_1009877
374 Ga0209588_1131780
375 Ga0268266_10617230
376 Ga0265330_10292649
377 Ga0265325_10190176
378 Ga0265331_10011617
379 Ga0265316_10001962
380 Ga0307408_100112842
381 Ga0265313_10229466
382 Ga0265314_10015230
383 Ga0265314_10080996
384 Ga0265342_10133087
385 Ga0373926_0060284
386 Ga0373934_0002237
387 Ga0373934_0019896
388 Ga0373923_0276005
389 Ga0373945_0051869
390 Ga0373953_0039327
391 Ga0373953_0415886
392 Ga0373954_0001400
393 Ga0373954_0012705
394 Ga0373954_0043507
395 Ga0373956_0060919
396 Ga0373956_0251056
397 Ga0373956_0264262
398 Ga0373957_0009018
399 Ga0373943_0008861
400 Ga0373943_0142484
401 Ga0373946_0052158
402 Ga0373955_0002485
403 Ga0373955_0066968
404 Ga0373955_0330433
405 Ga0373935_0915463
406 Ga0373927_0001757
407 Ga0373927_0008694
408 Ga0373927_0101677
409 Ga0373933_0002206
410 Ga0373933_0109772
411 Ga0373933_0478604
412 Ga0373947_0003516
413 Ga0373947_0084258
414 Ga0373937_0002306
415 Ga0373937_0009259
416 Ga0373937_0013776
417 Ga0373937_0332687
418 Ga0373937_0567799
419 Ga0373937_0991488
420 Ga0373925_0000290
421 Ga0373925_0012063
422 Ga0373925_0037902
423 Ga0373925_0295187
424 Ga0373925_0321443
425 Ga0373925_0437305
426 Ga0373925_0459594
427 Ga0373925_0800132
428 Ga0451576_0737485
429 Ga0451576_0878342
430 Ga0451576_1424837
431 Ga0466958_0463711
432 Ga0495651_0244961
433 Ga0495651_0379768
434 Ga0495653_0174621
435 Ga0495580_0000286
436 Ga0495580_0024601
437 Ga0495580_0024745
438 Ga0495580_0113072
439 Ga0495580_0363669
440 Ga0495580_0431418
441 Ga0495605_0297646
442 Ga0495664_0251970
443 Ga0495608_0204373
444 Ga0495608_0315713
445 Ga0495630_0440469
446 Ga0495630_0519925
447 Ga0495630_0648878
448 Ga0495666_0030131
449 Ga0495587_0088085
450 Ga0495645_0152285
451 Ga0495667_0123472
452 Ga0495635_0163026
453 Ga0495599_0053140
454 Ga0495623_0014707
455 Ga0495623_0128904
456 Ga0495623_0572669
457 Ga0495658_0540746
458 Ga0495624_0108306
459 Ga0495604_0008296
460 Ga0495674_0014764
461 Ga0495674_0289860
462 Ga0495676_0629420
463 Ga0495684_0009440
464 Ga0495684_0036920
465 Ga0495684_0045132
466 Ga0495602_0008953
467 Ga0495602_0147707
468 Ga0496104_0556469
469 Ga0496112_0614878
470 Ga0501079_0354415
471 nmdc:mga05p37_231928_c1
472 nmdc:mga05p37_807703_c1
473 nmdc:mga06r32_40793_c1
474 nmdc:mga0rr50_741505_c1
475 nmdc:mga08x19_901_c1
476 nmdc:mga08x19_984_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01258

zf-dskA_traR

Prokaryotic dksA/traR C4-type zinc finger

161

197

0.92

PF02663

FmdE

FmdE, Molybdenum formylmethanofuran dehydrogenase operon

16

144

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o13-assembly1.cif.gz_A solution structure of the c-terminal lim domain of mlp/crp3 0.7692 142 168
1b8t-assembly1.cif.gz_A solution structure of the chicken crp1 0.7447 142 169
2glz-assembly1.cif.gz_B crystal structure of a formylmethanofuran dehydrogenase subunit e-like protein (dhaf_2992) from desulfitobacterium hafniense dcb-2 at 1.45 a resolution 0.7053 2 129
3lrv-assembly1.cif.gz_A the prp19 wd40 domain contains a conserved protein interaction region essential for its function. 0.6243 31 88
5lj5-assembly1.cif.gz_v overall structure of the yeast spliceosome immediately after branching. 0.6243 31 88
ID Description Score Start End Superfamily
af_Q54EY5_635_699_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.884 142 168 2.10.110.10
af_B6T925_104_174_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.8687 142 168 2.10.110.10
af_Q54EY5_573_634_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.8635 142 168 2.10.110.10
2gviA03 Alpha Beta;2-Layer Sandwich;Wheat Germ Agglutinin (Isolectin 2); domain 1; 0.8579 137 168 3.30.60.20
af_B0V234_34_94_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.8498 142 168 2.10.110.10
ID Description Score Start End GO Terms
AF-A0A1F9D0W2-F1-model_v4 LIM zinc-binding domain-containing protein 0.9133 139 168
AF-A0A0F3GU52-F1-model_v4 Formylmethanofuran dehydrogenase subunit E (EC 1.2.99.5) 0.9116 1 129 GO:0016491
AF-A0A397FUM0-F1-model_v4 Uncharacterized protein 0.8967 140 168
AF-A0A7Y3CII0-F1-model_v4 Formylmethanofuran dehydrogenase 0.8948 1 120
AF-X1KIY9-F1-model_v4 LIM zinc-binding domain-containing protein 0.8934 139 167

Map