F350666

General Info

Members Datasets Scaffolds Average Seq Length
238 176 476 89

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100163912|Ga0070661_1001639122
Length 101
Sequence VSYTLLGPDGRPYESAVKGRWGGHSGSKIYGRLDCPAALRALARGGYARHRVFFADEVTAVAAGYRPCATCCRDRYDAWKAARAAAPLPRNPPGSPGADRG

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
104 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
155 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 2547132424 Nocardia nova SH22a Isolate Unclassified
174 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
175 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
176 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0.84
Isolates 1.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 9.66
Rhizosphere 84.03
Stem 0
Stem Tuber 0
Unclassified 14.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100163912 3300005344 Bacteria 1684
2 Ga0070658_10048257 3300005327 Unclassified 3446
3 Ga0070676_10387029 3300005328 Bacteria 970
4 Ga0070683_100599165 3300005329 Unclassified 1054
5 Ga0070683_101815002 3300005329 Unclassified 586
6 Ga0070680_101008819 3300005336 Bacteria 719
7 Ga0070682_100355983 3300005337 Bacteria 1093
8 Ga0068868_101000814 3300005338 Unclassified 765
9 Ga0070660_101549313 3300005339 Unclassified 564
10 Ga0070661_101023518 3300005344 Bacteria 686
11 Ga0070692_11233728 3300005345 Bacteria 534
12 Ga0070668_100384911 3300005347 Bacteria 1194
13 Ga0070668_100486908 3300005347 Bacteria 1066
14 Ga0070669_101064655 3300005353 Bacteria 696
15 Ga0070675_101781593 3300005354 Bacteria 568
16 Ga0070674_100131285 3300005356 Bacteria 1868
17 Ga0070673_102386876 3300005364 Bacteria 503
18 Ga0070659_100042017 3300005366 Unclassified 3575
19 Ga0070667_100350265 3300005367 Bacteria 1337
20 Ga0070709_10021576 3300005434 Bacteria 3753
21 Ga0070714_100125446 3300005435 Bacteria 2288
22 Ga0070713_100061783 3300005436 Bacteria 3135
23 Ga0070713_101814500 3300005436 Bacteria 592
24 Ga0070710_10082827 3300005437 Bacteria 1876
25 Ga0070701_10681452 3300005438 Bacteria 689
26 Ga0070711_100315954 3300005439 Bacteria 1246
27 Ga0070663_100606227 3300005455 Bacteria 921
28 Ga0070662_101724172 3300005457 Bacteria 541
29 Ga0070681_10213723 3300005458 Bacteria 1845
30 Ga0068867_100058583 3300005459 Bacteria 2854
31 Ga0070679_100255085 3300005530 Bacteria 1709
32 Ga0070684_100216245 3300005535 Bacteria 1748
33 Ga0070684_100259526 3300005535 Bacteria 1589
34 Ga0070672_100842687 3300005543 Bacteria 808
35 Ga0070672_101082174 3300005543 Unclassified 712
36 Ga0070664_100017885 3300005564 Bacteria 5820
37 Ga0070664_100357015 3300005564 Bacteria 1331
38 Ga0068857_100042611 3300005577 Bacteria 4027
39 Ga0068856_101213354 3300005614 Bacteria 770
40 Ga0068856_101922452 3300005614 Unclassified 602
41 Ga0070702_101347821 3300005615 Bacteria 581
42 Ga0068852_101337394 3300005616 Bacteria 738
43 Ga0068859_100306264 3300005617 Bacteria 1682
44 Ga0068864_100166584 3300005618 Unclassified 2007
45 Ga0068864_102295564 3300005618 Unclassified 546
46 Ga0068861_100130950 3300005719 Bacteria 2036
47 Ga0068851_10129902 3300005834 Bacteria 1361
48 Ga0068851_10727840 3300005834 Bacteria 612
49 Ga0068863_100120807 3300005841 Unclassified 2498
50 Ga0068858_101038565 3300005842 Unclassified 804
51 Ga0081455_10002212 3300005937 Bacteria 23167
52 Ga0081455_10013054 3300005937 Bacteria 8233
53 Ga0070716_100009120 3300006173 Bacteria 4937
54 Ga0070716_100102436 3300006173 Bacteria 1758
55 Ga0070712_100164648 3300006175 Bacteria 1715
56 Ga0097621_100918331 3300006237 Bacteria 816
57 Ga0068871_101692688 3300006358 Bacteria 600
58 Ga0075430_100013986 3300006846 Bacteria 6841
59 Ga0075430_100090884 3300006846 Unclassified 2553
60 Ga0068865_100141970 3300006881 Bacteria 1812
61 Ga0097620_100306263 3300006931 Bacteria 1682
62 Ga0105245_10786949 3300009098 Bacteria 989
63 Ga0105245_11030476 3300009098 Bacteria 868
64 Ga0114129_10007534 3300009147 Bacteria 15503
65 Ga0114129_10928703 3300009147 Unclassified 1101
66 Ga0105242_10128644 3300009176 Bacteria 2183
67 Ga0105248_10058165 3300009177 Bacteria 4341
68 Ga0105248_10232995 3300009177 Bacteria 2073
69 Ga0105237_10442589 3300009545 Bacteria 1305
70 Ga0105237_11056152 3300009545 Bacteria 819
71 Ga0105249_12300830 3300009553 Bacteria 612
72 Ga0105246_10748994 3300011119 Bacteria 861
73 Ga0157373_10090410 3300013100 Unclassified 2156
74 Ga0157371_10086546 3300013102 Unclassified 2219
75 Ga0157370_10272304 3300013104 Bacteria 1564
76 Ga0157370_10980734 3300013104 Bacteria 765
77 Ga0157369_10066606 3300013105 Bacteria 3874
78 Ga0157369_10193617 3300013105 Bacteria 2135
79 Ga0157369_11418798 3300013105 Bacteria 707
80 Ga0163162_10172797 3300013306 Bacteria 2285
81 Ga0163162_10752061 3300013306 Unclassified 1094
82 Ga0163162_11562185 3300013306 Bacteria 752
83 Ga0163162_11977279 3300013306 Bacteria 668
84 Ga0157375_10051937 3300013308 Bacteria 4028
85 Ga0163163_10410234 3300014325 Bacteria 1413
86 Ga0163163_10454738 3300014325 Unclassified 1341
87 Ga0163163_11024704 3300014325 Bacteria 889
88 Ga0163163_13050868 3300014325 Bacteria 522
89 Ga0157380_13516397 3300014326 Bacteria 502
90 Ga0157376_10455523 3300014969 Bacteria 1249
91 Ga0163161_10140640 3300017792 Bacteria 1828
92 Ga0206354_11514970 3300020081 Bacteria 1513
93 Ga0206353_11718801 3300020082 Bacteria 2985
94 Ga0213876_10004318 3300021384 Bacteria 7966
95 Ga0207656_10085787 3300025321 Bacteria 1422
96 Ga0207692_10043692 3300025898 Bacteria 2231
97 Ga0207699_10009065 3300025906 Bacteria 4939
98 Ga0207699_10759933 3300025906 Unclassified 711
99 Ga0207699_11222835 3300025906 Bacteria 556
100 Ga0207645_10107716 3300025907 Bacteria 1803
101 Ga0207645_10155277 3300025907 Bacteria 1495
102 Ga0207705_10288938 3300025909 Bacteria 1256
103 Ga0207707_10229201 3300025912 Bacteria 1616
104 Ga0207671_11447896 3300025914 Bacteria 531
105 Ga0207693_10066863 3300025915 Bacteria 2814
106 Ga0207663_10142919 3300025916 Bacteria 1669
107 Ga0207660_11382896 3300025917 Bacteria 570
108 Ga0207649_10101547 3300025920 Bacteria 1905
109 Ga0207649_10144010 3300025920 Bacteria 1634
110 Ga0207649_10319286 3300025920 Bacteria 1141
111 Ga0207649_11020038 3300025920 Unclassified 651
112 Ga0207652_10269600 3300025921 Bacteria 1535
113 Ga0207652_10747329 3300025921 Unclassified 871
114 Ga0207700_10163349 3300025928 Bacteria 1851
115 Ga0207700_11749772 3300025928 Bacteria 547
116 Ga0207664_10031251 3300025929 Bacteria 4072
117 Ga0207664_10862530 3300025929 Bacteria 814
118 Ga0207644_10446805 3300025931 Bacteria 1062
119 Ga0207644_11004587 3300025931 Bacteria 700
120 Ga0207690_10594939 3300025932 Bacteria 902
121 Ga0207690_11664055 3300025932 Bacteria 533
122 Ga0207706_10563937 3300025933 Bacteria 980
123 Ga0207686_10058001 3300025934 Bacteria 2439
124 Ga0207665_10133133 3300025939 Bacteria 1767
125 Ga0207665_10139679 3300025939 Bacteria 1726
126 Ga0207691_10137751 3300025940 Unclassified 2152
127 Ga0207691_10725176 3300025940 Bacteria 838
128 Ga0207711_10167997 3300025941 Bacteria 1989
129 Ga0207711_10292393 3300025941 Bacteria 1502
130 Ga0207661_10141161 3300025944 Bacteria 2073
131 Ga0207661_10287702 3300025944 Bacteria 1470
132 Ga0207679_10029458 3300025945 Bacteria 3822
133 Ga0207679_10205288 3300025945 Unclassified 1649
134 Ga0207679_11600649 3300025945 Bacteria 597
135 Ga0207651_10030587 3300025960 Bacteria 3431
136 Ga0207658_11305057 3300025986 Unclassified 664
137 Ga0207703_10584948 3300026035 Bacteria 1055
138 Ga0207678_10011727 3300026067 Bacteria 7692
139 Ga0207678_11621859 3300026067 Bacteria 569
140 Ga0207641_10190913 3300026088 Unclassified 1883
141 Ga0207648_10011711 3300026089 Bacteria 8248
142 Ga0207648_10206201 3300026089 Unclassified 1745
143 Ga0207676_10206837 3300026095 Unclassified 1738
144 Ga0207674_10032708 3300026116 Bacteria 5453
145 Ga0207674_10049832 3300026116 Bacteria 4281
146 Ga0207675_100093755 3300026118 Bacteria 2824
147 Ga0207675_100166891 3300026118 Bacteria 2103
148 Ga0268266_10150742 3300028379 Bacteria 2096
149 Ga0268264_10352846 3300028381 Unclassified 1401
150 Ga0307511_10091677 3300030521 Bacteria 2055
151 Ga0373956_0292928 3300035119 Bacteria 775
152 Ga0373955_0309722 3300035172 Bacteria 953
153 Ga0373942_0333034 3300035207 Unclassified 533
154 Ga0373931_0801053 3300035691 Bacteria 628
155 Ga0373933_0105192 3300035724 Bacteria 1755
156 Ga0373947_0261554 3300035725 Bacteria 1147
157 Ga0373937_0323420 3300036401 Bacteria 1459
158 Ga0373937_1876956 3300036401 Bacteria 545
159 Ga0373925_0587520 3300037068 Bacteria 917
160 Ga0395900_0478079 3300037418 Bacteria 1199
161 Ga0395900_1651852 3300037418 Unclassified 552
162 Ga0436364_0684682 3300037853 Bacteria 643
163 Ga0436364_0698492 3300037853 Bacteria 2421
164 Ga0436365_1155520 3300039437 Bacteria 4727
165 Ga0451577_1766956 3300042876 Unclassified 543
166 Ga0453683_0752085 3300044673 Unclassified 640
167 Ga0466966_0526212 3300044684 Bacteria 711
168 Ga0466961_0433560 3300044693 Bacteria 796
169 Ga0466970_0557552 3300044765 Bacteria 662
170 Ga0466957_0009735 3300044842 Bacteria 5488
171 Ga0466959_0091099 3300045049 Bacteria 2189
172 Ga0466959_0572488 3300045049 Unclassified 761
173 Ga0466967_0240377 3300045976 Bacteria 1727
174 Ga0495653_0112390 3300046463 Bacteria 1955
175 Ga0495664_0951581 3300046477 Bacteria 501
176 Ga0495608_0356544 3300046511 Bacteria 899
177 Ga0495618_0126748 3300046514 Bacteria 1634
178 Ga0495652_0446271 3300046529 Bacteria 906
179 Ga0495667_0096324 3300046559 Bacteria 1915
180 Ga0495634_0366856 3300046642 Bacteria 860
181 Ga0495611_0451031 3300046648 Bacteria 586
182 Ga0495635_0104428 3300046663 Bacteria 1936
183 Ga0495657_0056507 3300046675 Bacteria 2613
184 Ga0495599_0584616 3300046678 Bacteria 651
185 Ga0495600_0051586 3300046809 Bacteria 2685
186 Ga0495636_0015449 3300047318 Bacteria 3044
187 Ga0495674_1256338 3300047319 Bacteria 557
188 Ga0495680_0242208 3300047322 Bacteria 1280
189 Ga0495681_0034538 3300047470 Bacteria 2519
190 Ga0495684_0124193 3300047471 Bacteria 1942
191 Ga0495593_0416309 3300047673 Bacteria 672
192 Ga0495602_0738752 3300048088 Unclassified 665
193 Ga0496100_0084653 3300048903 Bacteria 2150
194 Ga0496100_0110830 3300048903 Bacteria 1906
195 Ga0496100_0623854 3300048903 Bacteria 838
196 Ga0496101_0226498 3300048904 Bacteria 1452
197 Ga0496101_1217105 3300048904 Bacteria 590
198 Ga0496102_0068900 3300048905 Bacteria 3247
199 Ga0496104_0169775 3300048907 Bacteria 2092
200 Ga0496104_0830818 3300048907 Bacteria 830
201 Ga0496105_1244769 3300048908 Bacteria 546
202 Ga0496106_0031952 3300048909 Bacteria 3923
203 Ga0496108_0300747 3300048911 Bacteria 1398
204 Ga0496108_0827356 3300048911 Bacteria 798
205 Ga0496108_0949859 3300048911 Bacteria 736
206 Ga0496109_1166940 3300048912 Unclassified 707
207 Ga0496109_1823532 3300048912 Bacteria 541
208 Ga0496110_0904356 3300048913 Bacteria 789
209 Ga0496112_0000878 3300048915 Bacteria 21568
210 Ga0496112_0273720 3300048915 Bacteria 1636
211 Ga0496112_0413083 3300048915 Bacteria 1289
212 Ga0496112_0430569 3300048915 Bacteria 1258
213 Ga0496113_0000180 3300048916 Bacteria 28274
214 Ga0496113_1041736 3300048916 Bacteria 643
215 Ga0496114_0089268 3300048917 Bacteria 2616
216 Ga0496122_0003077 3300048925 Bacteria 22455
217 Ga0496123_0003322 3300048926 Bacteria 18220
218 Ga0496124_0293023 3300048927 Bacteria 1180
219 Ga0496125_0443080 3300048928 Bacteria 746
220 Ga0496126_0002093 3300048929 Bacteria 27948
221 Ga0501032_0000422 3300049569 Bacteria 35080
222 Ga0501034_0019651 3300049571 Bacteria 6907
223 Ga0501036_0589902 3300049572 Bacteria 922
224 Ga0501037_0000265 3300049573 Bacteria 45219
225 Ga0501038_0024557 3300049574 Bacteria 5376
226 Ga0501039_0013483 3300049575 Bacteria 6250
227 Ga0501043_0000937 3300049579 Bacteria 25850
228 Ga0501067_0212053 3300049583 Bacteria 1079
229 Ga0501070_0000839 3300049586 Bacteria 27914
230 Ga0501077_0750368 3300049593 Bacteria 627
231 Ga0501044_0054244 3300049823 Bacteria 4122
232 nmdc:mga0qj67_13644_c1 3300050509 Bacteria 6130
233 Ga0500568_0019890 3300053139 Bacteria 2911
234 Ga0500616_0001879 3300053153 Bacteria 18907
235 2548693598 2547132424 Bacteria 8348532
236 2552108708 2551306166 Bacteria 9731570
237 2997607416 2997600082 Bacteria 9896405
238 8033685229 8033684223 Bacteria 6906479
239 Ga0070661_100163912
240 Ga0070658_10048257
241 Ga0070676_10387029
242 Ga0070683_100599165
243 Ga0070683_101815002
244 Ga0070680_101008819
245 Ga0070682_100355983
246 Ga0068868_101000814
247 Ga0070660_101549313
248 Ga0070661_101023518
249 Ga0070692_11233728
250 Ga0070668_100384911
251 Ga0070668_100486908
252 Ga0070669_101064655
253 Ga0070675_101781593
254 Ga0070674_100131285
255 Ga0070673_102386876
256 Ga0070659_100042017
257 Ga0070667_100350265
258 Ga0070709_10021576
259 Ga0070714_100125446
260 Ga0070713_100061783
261 Ga0070713_101814500
262 Ga0070710_10082827
263 Ga0070701_10681452
264 Ga0070711_100315954
265 Ga0070663_100606227
266 Ga0070662_101724172
267 Ga0070681_10213723
268 Ga0068867_100058583
269 Ga0070679_100255085
270 Ga0070684_100216245
271 Ga0070684_100259526
272 Ga0070672_100842687
273 Ga0070672_101082174
274 Ga0070664_100017885
275 Ga0070664_100357015
276 Ga0068857_100042611
277 Ga0068856_101213354
278 Ga0068856_101922452
279 Ga0070702_101347821
280 Ga0068852_101337394
281 Ga0068859_100306264
282 Ga0068864_100166584
283 Ga0068864_102295564
284 Ga0068861_100130950
285 Ga0068851_10129902
286 Ga0068851_10727840
287 Ga0068863_100120807
288 Ga0068858_101038565
289 Ga0081455_10002212
290 Ga0081455_10013054
291 Ga0070716_100009120
292 Ga0070716_100102436
293 Ga0070712_100164648
294 Ga0097621_100918331
295 Ga0068871_101692688
296 Ga0075430_100013986
297 Ga0075430_100090884
298 Ga0068865_100141970
299 Ga0097620_100306263
300 Ga0105245_10786949
301 Ga0105245_11030476
302 Ga0114129_10007534
303 Ga0114129_10928703
304 Ga0105242_10128644
305 Ga0105248_10058165
306 Ga0105248_10232995
307 Ga0105237_10442589
308 Ga0105237_11056152
309 Ga0105249_12300830
310 Ga0105246_10748994
311 Ga0157373_10090410
312 Ga0157371_10086546
313 Ga0157370_10272304
314 Ga0157370_10980734
315 Ga0157369_10066606
316 Ga0157369_10193617
317 Ga0157369_11418798
318 Ga0163162_10172797
319 Ga0163162_10752061
320 Ga0163162_11562185
321 Ga0163162_11977279
322 Ga0157375_10051937
323 Ga0163163_10410234
324 Ga0163163_10454738
325 Ga0163163_11024704
326 Ga0163163_13050868
327 Ga0157380_13516397
328 Ga0157376_10455523
329 Ga0163161_10140640
330 Ga0206354_11514970
331 Ga0206353_11718801
332 Ga0213876_10004318
333 Ga0207656_10085787
334 Ga0207692_10043692
335 Ga0207699_10009065
336 Ga0207699_10759933
337 Ga0207699_11222835
338 Ga0207645_10107716
339 Ga0207645_10155277
340 Ga0207705_10288938
341 Ga0207707_10229201
342 Ga0207671_11447896
343 Ga0207693_10066863
344 Ga0207663_10142919
345 Ga0207660_11382896
346 Ga0207649_10101547
347 Ga0207649_10144010
348 Ga0207649_10319286
349 Ga0207649_11020038
350 Ga0207652_10269600
351 Ga0207652_10747329
352 Ga0207700_10163349
353 Ga0207700_11749772
354 Ga0207664_10031251
355 Ga0207664_10862530
356 Ga0207644_10446805
357 Ga0207644_11004587
358 Ga0207690_10594939
359 Ga0207690_11664055
360 Ga0207706_10563937
361 Ga0207686_10058001
362 Ga0207665_10133133
363 Ga0207665_10139679
364 Ga0207691_10137751
365 Ga0207691_10725176
366 Ga0207711_10167997
367 Ga0207711_10292393
368 Ga0207661_10141161
369 Ga0207661_10287702
370 Ga0207679_10029458
371 Ga0207679_10205288
372 Ga0207679_11600649
373 Ga0207651_10030587
374 Ga0207658_11305057
375 Ga0207703_10584948
376 Ga0207678_10011727
377 Ga0207678_11621859
378 Ga0207641_10190913
379 Ga0207648_10011711
380 Ga0207648_10206201
381 Ga0207676_10206837
382 Ga0207674_10032708
383 Ga0207674_10049832
384 Ga0207675_100093755
385 Ga0207675_100166891
386 Ga0268266_10150742
387 Ga0268264_10352846
388 Ga0307511_10091677
389 Ga0373956_0292928
390 Ga0373955_0309722
391 Ga0373942_0333034
392 Ga0373931_0801053
393 Ga0373933_0105192
394 Ga0373947_0261554
395 Ga0373937_0323420
396 Ga0373937_1876956
397 Ga0373925_0587520
398 Ga0395900_0478079
399 Ga0395900_1651852
400 Ga0436364_0684682
401 Ga0436364_0698492
402 Ga0436365_1155520
403 Ga0451577_1766956
404 Ga0453683_0752085
405 Ga0466966_0526212
406 Ga0466961_0433560
407 Ga0466970_0557552
408 Ga0466957_0009735
409 Ga0466959_0091099
410 Ga0466959_0572488
411 Ga0466967_0240377
412 Ga0495653_0112390
413 Ga0495664_0951581
414 Ga0495608_0356544
415 Ga0495618_0126748
416 Ga0495652_0446271
417 Ga0495667_0096324
418 Ga0495634_0366856
419 Ga0495611_0451031
420 Ga0495635_0104428
421 Ga0495657_0056507
422 Ga0495599_0584616
423 Ga0495600_0051586
424 Ga0495636_0015449
425 Ga0495674_1256338
426 Ga0495680_0242208
427 Ga0495681_0034538
428 Ga0495684_0124193
429 Ga0495593_0416309
430 Ga0495602_0738752
431 Ga0496100_0084653
432 Ga0496100_0110830
433 Ga0496100_0623854
434 Ga0496101_0226498
435 Ga0496101_1217105
436 Ga0496102_0068900
437 Ga0496104_0169775
438 Ga0496104_0830818
439 Ga0496105_1244769
440 Ga0496106_0031952
441 Ga0496108_0300747
442 Ga0496108_0827356
443 Ga0496108_0949859
444 Ga0496109_1166940
445 Ga0496109_1823532
446 Ga0496110_0904356
447 Ga0496112_0000878
448 Ga0496112_0273720
449 Ga0496112_0413083
450 Ga0496112_0430569
451 Ga0496113_0000180
452 Ga0496113_1041736
453 Ga0496114_0089268
454 Ga0496122_0003077
455 Ga0496123_0003322
456 Ga0496124_0293023
457 Ga0496125_0443080
458 Ga0496126_0002093
459 Ga0501032_0000422
460 Ga0501034_0019651
461 Ga0501036_0589902
462 Ga0501037_0000265
463 Ga0501038_0024557
464 Ga0501039_0013483
465 Ga0501043_0000937
466 Ga0501067_0212053
467 Ga0501070_0000839
468 Ga0501077_0750368
469 Ga0501044_0054244
470 nmdc:mga0qj67_13644_c1
471 Ga0500568_0019890
472 Ga0500616_0001879
473 2548693598
474 2552108708
475 2997607416
476 8033685229

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02805

Ada_Zn_binding

Metal binding domain of Ada

16

74

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zgw-assembly1.cif.gz_A nmr structure of e. coli ada protein in complex with dna 0.697 16 70
6m92-assembly1.cif.gz_B monophosphorylated pser33 b-catenin peptide, b-trcp/skp1, nrx-2663 ternary complex 0.6486 1 16
6wnx-assembly1.cif.gz_B fbxw11-skp1 in complex with a pser33/pser37 beta-catenin peptide 0.6164 1 16
8or0-assembly1.cif.gz_D cand1-cul1-rbx1-skp1-skp2-cks1-cdk2 0.6058 1 16
6byh-assembly3.cif.gz_G ubiquitin variant (ubv.fl11.1) bound to a human skp1-fbl11 fragment complex. 0.602 1 16
ID Description Score Start End Superfamily
1eyfA00 Alpha Beta;3-Layer(aba) Sandwich;DNA Methylphosphotriester Repair Domain;DNA Methylphosphotriester Repair Domain 0.7937 21 74 3.40.10.10
af_Q58228_144_200_3.40.10.10 Alpha Beta;3-Layer(aba) Sandwich;DNA Methylphosphotriester Repair Domain;DNA Methylphosphotriester Repair Domain 0.7714 15 70 3.40.10.10
af_Q59X09_15_372_2.40.160.210 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.7565 1 15 2.40.160.210
af_Q59SD2_1_74_3.40.10.10 Alpha Beta;3-Layer(aba) Sandwich;DNA Methylphosphotriester Repair Domain;DNA Methylphosphotriester Repair Domain 0.7163 6 73 3.40.10.10
af_Q58228_144_200_3.40.10.10 Alpha Beta;3-Layer(aba) Sandwich;DNA Methylphosphotriester Repair Domain;DNA Methylphosphotriester Repair Domain 0.7145 15 70 3.40.10.10
ID Description Score Start End GO Terms
AF-A0A1U9UWU9-F1-model_v4 Metal-binding protein 0.9951 1 85 GO:0003677
GO:0006281
GO:0006355
GO:0008168
GO:0008270
AF-A0A5M3WXM9-F1-model_v4 Ada DNA repair metal-binding domain-containing protein 0.9948 1 84 GO:0003677
GO:0006281
GO:0006355
GO:0008168
GO:0008270
AF-A0A535V3C1-F1-model_v4 Ada DNA repair metal-binding domain-containing protein 0.9941 1 83 GO:0003677
GO:0006281
GO:0006355
GO:0008168
GO:0008270
AF-A0A2V7SN21-F1-model_v4 Metal-binding protein 0.9927 1 82 GO:0003677
GO:0006281
GO:0006355
GO:0008168
GO:0008270
AF-A0A554TPT1-F1-model_v4 deleted 0.9921 4 80

Map