F350139

General Info

Members Datasets Scaffolds Average Seq Length
237 143 474 324

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10003640|Ga0307413_100036402
Length 364
Sequence MPVERAGPDEAAAPLLRVDRFEGAAEEWDGFVRAQEGWTHFHLAGWRRVMSDALGHECIRLAARDETGALAGVLPLVRVRSALFGHYLVSMPFVNYGGPLGGAGAVRALASAAVRQADADGVKLLELRSRTELPLELPVSHRKVTVVLDIPDGGPEALFKTFPAKLRSQVRRPAKEGVTVRFGSDQVAPFYEVFARHMRDLGTPAQSRRLFESIAETFGESAWFGCAWKDGQPIACGAGFVWNGEFEMTWASALNAYRSISPNMGLYWGFMERAANEGLRLFNFGRCTPGGGTHRFKLQWGARDEQLWWYQHARGAGAADGVAGAEAHTPSPDQGAYSWGPRVWKRLPLPVATALGPRIVRFIP

Samples

Sample ID Description Type Environment
1 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.64
Nodule 0
Rhizoplane 0.42
Rhizosphere 94.51
Stem 0
Stem Tuber 0
Unclassified 22.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307413_10003640 3300031824 Bacteria 6540
2 rootL2_10064938 3300003322 Bacteria 1357
3 Ga0070676_10012269 3300005328 Bacteria 4673
4 Ga0070683_100000421 3300005329 Bacteria 29305
5 Ga0070683_100144099 3300005329 Unclassified 2257
6 Ga0070677_10029763 3300005333 Unclassified 2073
7 Ga0070666_10238656 3300005335 Bacteria 1285
8 Ga0070680_100030418 3300005336 Bacteria 4338
9 Ga0070691_10001309 3300005341 Bacteria 10575
10 Ga0070691_10010603 3300005341 Bacteria 4208
11 Ga0070691_10046707 3300005341 Bacteria 2057
12 Ga0070691_10059369 3300005341 Bacteria 1838
13 Ga0070661_100009212 3300005344 Bacteria 6824
14 Ga0070661_100266559 3300005344 Bacteria 1325
15 Ga0070669_100033428 3300005353 Bacteria 3719
16 Ga0070674_100042103 3300005356 Unclassified 3100
17 Ga0070659_100084376 3300005366 Unclassified 2540
18 Ga0070667_100035522 3300005367 Unclassified 4176
19 Ga0070703_10000212 3300005406 Bacteria 27813
20 Ga0070709_10004062 3300005434 Bacteria 7894
21 Ga0070714_100001976 3300005435 Bacteria 14974
22 Ga0070714_100019266 3300005435 Bacteria 5553
23 Ga0070713_100009315 3300005436 Bacteria 7020
24 Ga0070711_100000042 3300005439 Bacteria 84000
25 Ga0070705_100007158 3300005440 Bacteria 5490
26 Ga0070700_100213293 3300005441 Bacteria 1363
27 Ga0070694_100001724 3300005444 Bacteria 12885
28 Ga0070694_100009704 3300005444 Bacteria 5911
29 Ga0070694_100014580 3300005444 Unclassified 4920
30 Ga0070694_100053331 3300005444 Unclassified 2736
31 Ga0070694_100108614 3300005444 Unclassified 1973
32 Ga0070708_100003450 3300005445 Bacteria 12370
33 Ga0070708_100261104 3300005445 Unclassified 1628
34 Ga0070662_100004826 3300005457 Bacteria 8545
35 Ga0070681_10001461 3300005458 Bacteria 20844
36 Ga0068867_100004045 3300005459 Bacteria 10318
37 Ga0070706_100002439 3300005467 Bacteria 18745
38 Ga0070707_100030510 3300005468 Bacteria 5133
39 Ga0070707_100106633 3300005468 Bacteria 2718
40 Ga0070698_100066609 3300005471 Bacteria 3624
41 Ga0070699_100015002 3300005518 Bacteria 6659
42 Ga0070699_100022095 3300005518 Bacteria 5481
43 Ga0070699_100065877 3300005518 Unclassified 3144
44 Ga0070679_100003638 3300005530 Bacteria 14101
45 Ga0070679_100014534 3300005530 Bacteria 7562
46 Ga0070679_100381902 3300005530 Bacteria 1355
47 Ga0070684_100002362 3300005535 Bacteria 13916
48 Ga0070684_100054656 3300005535 Bacteria 3479
49 Ga0070697_100000716 3300005536 Bacteria 24733
50 Ga0070697_100006135 3300005536 Bacteria 9298
51 Ga0070697_100021834 3300005536 Bacteria 5075
52 Ga0070697_100029584 3300005536 Bacteria 4393
53 Ga0070697_100056585 3300005536 Unclassified 3190
54 Ga0070697_100157345 3300005536 Bacteria 1919
55 Ga0070697_100184356 3300005536 Unclassified 1770
56 Ga0070686_100129521 3300005544 Bacteria 1743
57 Ga0070695_100000925 3300005545 Bacteria 15825
58 Ga0070695_100008207 3300005545 Bacteria 6192
59 Ga0070695_100010201 3300005545 Bacteria 5604
60 Ga0070695_100012647 3300005545 Bacteria 5067
61 Ga0070695_100034654 3300005545 Unclassified 3166
62 Ga0070695_100156098 3300005545 Unclassified 1597
63 Ga0070696_100006365 3300005546 Bacteria 7898
64 Ga0070696_100006904 3300005546 Bacteria 7578
65 Ga0070696_100012949 3300005546 Bacteria 5601
66 Ga0070696_100015651 3300005546 Bacteria 5096
67 Ga0070696_100017717 3300005546 Unclassified 4810
68 Ga0070696_100022901 3300005546 Unclassified 4248
69 Ga0070696_100140671 3300005546 Bacteria 1764
70 Ga0070696_100148742 3300005546 Bacteria 1717
71 Ga0070693_100005454 3300005547 Bacteria 6115
72 Ga0070704_100003727 3300005549 Bacteria 8775
73 Ga0070704_100010193 3300005549 Bacteria 5715
74 Ga0070704_100040609 3300005549 Bacteria 3204
75 Ga0068855_100185289 3300005563 Unclassified 2351
76 Ga0070664_100058096 3300005564 Unclassified 3290
77 Ga0068856_100129695 3300005614 Unclassified 2526
78 Ga0068852_100211571 3300005616 Unclassified 1840
79 Ga0068866_10000817 3300005718 Bacteria 13843
80 Ga0068861_100043322 3300005719 Bacteria 3378
81 Ga0068858_100097080 3300005842 Unclassified 2747
82 Ga0068860_100019095 3300005843 Bacteria 6655
83 Ga0068860_100128184 3300005843 Bacteria 2433
84 Ga0075368_10013872 3300006042 Bacteria 2965
85 Ga0075364_10022548 3300006051 Bacteria 3977
86 Ga0070712_100314948 3300006175 Bacteria 1271
87 Ga0075367_10016345 3300006178 Bacteria 4052
88 Ga0075366_10023458 3300006195 Bacteria 3594
89 Ga0097621_100045931 3300006237 Bacteria 3531
90 Ga0075370_10006242 3300006353 Bacteria 5980
91 Ga0075428_100034931 3300006844 Bacteria 5542
92 Ga0075428_100118737 3300006844 Bacteria 2880
93 Ga0075433_10000392 3300006852 Bacteria 27791
94 Ga0075433_10014223 3300006852 Bacteria 6497
95 Ga0075433_10030365 3300006852 Unclassified 4610
96 Ga0075433_10076897 3300006852 Unclassified 2940
97 Ga0075433_10134183 3300006852 Bacteria 2200
98 Ga0075434_100001577 3300006871 Bacteria 19314
99 Ga0075434_100011065 3300006871 Bacteria 8489
100 Ga0075434_100166215 3300006871 Unclassified 2226
101 Ga0068865_100003801 3300006881 Bacteria 9063
102 Ga0075436_100007025 3300006914 Bacteria 7709
103 Ga0075436_100008627 3300006914 Bacteria 6968
104 Ga0075436_100062075 3300006914 Unclassified 2583
105 Ga0075436_100089385 3300006914 Bacteria 2140
106 Ga0075435_100004902 3300007076 Archaea 9272
107 Ga0075435_100087406 3300007076 Unclassified 2568
108 Ga0105240_10002758 3300009093 Bacteria 27746
109 Ga0105240_10081979 3300009093 Unclassified 3962
110 Ga0105240_10224922 3300009093 Bacteria 2184
111 Ga0105245_10052868 3300009098 Unclassified 3644
112 Ga0114129_10062942 3300009147 Bacteria 5182
113 Ga0114129_10309057 3300009147 Bacteria 2105
114 Ga0105243_10060051 3300009148 Unclassified 3037
115 Ga0105241_10000068 3300009174 Bacteria 79007
116 Ga0105241_10034553 3300009174 Unclassified 3799
117 Ga0105241_10054615 3300009174 Unclassified 3058
118 Ga0105242_10082859 3300009176 Unclassified 2685
119 Ga0105248_10054102 3300009177 Bacteria 4501
120 Ga0105249_10052563 3300009553 Bacteria 3721
121 Ga0105239_10026338 3300010375 Bacteria 6400
122 Ga0157373_10010026 3300013100 Bacteria 6982
123 Ga0157371_10017536 3300013102 Bacteria 5317
124 Ga0157371_10142903 3300013102 Unclassified 1704
125 Ga0157370_10002408 3300013104 Bacteria 22551
126 Ga0157370_10016576 3300013104 Bacteria 7454
127 Ga0157370_10058847 3300013104 Bacteria 3652
128 Ga0157378_10007373 3300013297 Bacteria 9610
129 Ga0163162_10234880 3300013306 Unclassified 1964
130 Ga0157372_10005569 3300013307 Bacteria 13387
131 Ga0157372_10009131 3300013307 Bacteria 10531
132 Ga0157372_10036311 3300013307 Bacteria 5431
133 Ga0157372_10061135 3300013307 Unclassified 4217
134 Ga0157375_10051038 3300013308 Unclassified 4060
135 Ga0157380_10150049 3300014326 Bacteria 2014
136 Ga0157379_10008430 3300014968 Bacteria 8961
137 Ga0163161_10035525 3300017792 Bacteria 3568
138 Ga0207653_10000103 3300025885 Bacteria 60144
139 Ga0207680_10170078 3300025903 Bacteria 1467
140 Ga0207645_10002271 3300025907 Bacteria 15259
141 Ga0207705_10104387 3300025909 Unclassified 2088
142 Ga0207684_10041395 3300025910 Bacteria 3907
143 Ga0207654_10000300 3300025911 Bacteria 30072
144 Ga0207654_10018286 3300025911 Unclassified 3675
145 Ga0207654_10041842 3300025911 Unclassified 2590
146 Ga0207707_10007019 3300025912 Bacteria 9821
147 Ga0207707_10012336 3300025912 Bacteria 7426
148 Ga0207707_10020904 3300025912 Bacteria 5717
149 Ga0207695_10037427 3300025913 Bacteria 5235
150 Ga0207663_10000029 3300025916 Bacteria 99755
151 Ga0207663_10105619 3300025916 Bacteria 1901
152 Ga0207660_10013959 3300025917 Bacteria 5272
153 Ga0207660_10037915 3300025917 Bacteria 3362
154 Ga0207657_10024026 3300025919 Bacteria 5659
155 Ga0207657_10152290 3300025919 Bacteria 1883
156 Ga0207649_10143515 3300025920 Unclassified 1636
157 Ga0207652_10004222 3300025921 Bacteria 11719
158 Ga0207652_10020408 3300025921 Bacteria 5455
159 Ga0207652_10261235 3300025921 Bacteria 1562
160 Ga0207646_10028078 3300025922 Bacteria 5126
161 Ga0207646_10089415 3300025922 Bacteria 2756
162 Ga0207646_10281004 3300025922 Bacteria 1504
163 Ga0207681_10056760 3300025923 Bacteria 2672
164 Ga0207694_10025796 3300025924 Unclassified 4468
165 Ga0207687_10094473 3300025927 Bacteria 2188
166 Ga0207700_10139280 3300025928 Bacteria 1992
167 Ga0207644_10034845 3300025931 Unclassified 3524
168 Ga0207706_10003182 3300025933 Bacteria 15771
169 Ga0207686_10003662 3300025934 Bacteria 8233
170 Ga0207709_10003868 3300025935 Bacteria 8768
171 Ga0207669_10002858 3300025937 Bacteria 7405
172 Ga0207704_10020930 3300025938 Unclassified 3472
173 Ga0207711_10004515 3300025941 Bacteria 11855
174 Ga0207689_10004649 3300025942 Bacteria 12416
175 Ga0207661_10002422 3300025944 Bacteria 12856
176 Ga0207661_10026802 3300025944 Unclassified 4396
177 Ga0207679_10074432 3300025945 Unclassified 2573
178 Ga0207667_10035565 3300025949 Bacteria 5343
179 Ga0207640_10108864 3300025981 Bacteria 1959
180 Ga0207703_10024462 3300026035 Bacteria 4751
181 Ga0207639_10270469 3300026041 Unclassified 1490
182 Ga0207678_10003416 3300026067 Bacteria 14295
183 Ga0207708_10122647 3300026075 Bacteria 2026
184 Ga0207648_10008653 3300026089 Bacteria 9824
185 Ga0207675_100025289 3300026118 Bacteria 5526
186 Ga0207675_100043245 3300026118 Bacteria 4207
187 Ga0207698_10030528 3300026142 Bacteria 3877
188 Ga0209813_10032052 3300027866 Bacteria 1555
189 Ga0265334_10022969 3300028573 Bacteria 2540
190 Ga0316576_10004498 3300031727 Bacteria 8378
191 Ga0316576_10005684 3300031727 Bacteria 7666
192 Ga0316576_10006684 3300031727 Bacteria 7204
193 Ga0316576_10099974 3300031727 Unclassified 2167
194 Ga0316576_10105012 3300031727 Bacteria 2114
195 Ga0316577_10163152 3300031733 Unclassified 1257
196 Ga0307407_10038283 3300031903 Bacteria 2657
197 Ga0307409_100025948 3300031995 Bacteria 4122
198 Ga0307411_10243876 3300032005 Bacteria 1408
199 Ga0316583_10028437 3300032133 Bacteria 1994
200 Ga0316584_0001656 3300036712 Bacteria 13613
201 Ga0316584_0046161 3300036712 Bacteria 3253
202 Ga0316584_0067800 3300036712 Bacteria 2674
203 Ga0451577_0000001 3300042876 Bacteria 2461803
204 Ga0453683_0041320 3300044673 Bacteria 2896
205 Ga0453683_0047800 3300044673 Bacteria 2683
206 Ga0466961_0305084 3300044693 Unclassified 972
207 Ga0451576_0010136 3300045051 Bacteria 10847
208 Ga0451576_0042594 3300045051 Bacteria 4792
209 Ga0451576_0056798 3300045051 Bacteria 4093
210 Ga0451576_0235402 3300045051 Bacteria 1912
211 Ga0496106_0109829 3300048909 Unclassified 2146
212 Ga0501075_0047567 3300049591 Bacteria 3223
213 Ga0501075_0132633 3300049591 Unclassified 1898
214 Ga0501076_0082930 3300049592 Bacteria 2574
215 Ga0501077_0048130 3300049593 Bacteria 2708
216 Ga0501080_0271922 3300049742 Unclassified 1542
217 Ga0501081_0029599 3300049743 Bacteria 3702
218 nmdc:mga00v17_42148_c1 3300050491 Bacteria 2744
219 nmdc:mga0k408_9325_c2 3300050493 Bacteria 4097
220 nmdc:mga06z11_22848_c1 3300050494 Bacteria 2928
221 nmdc:mga04h51_62080_c1 3300050495 Unclassified 1284
222 nmdc:mga07m45_13262_c1 3300050496 Bacteria 4369
223 nmdc:mga05p37_120231_c1 3300050507 Bacteria 3227
224 nmdc:mga05p37_352322_c1 3300050507 Bacteria 1733
225 nmdc:mga05p37_417612_c1 3300050507 Bacteria 1562
226 nmdc:mga0n895_13722_c1 3300050512 Bacteria 7326
227 nmdc:mga0n895_326932_c1 3300050512 Bacteria 1554
228 nmdc:mga0n895_527_c1 3300050512 Bacteria 26121
229 nmdc:mga0n895_7187_c1 3300050512 Bacteria 9529
230 nmdc:mga0rr50_83759_c1 3300050513 Bacteria 2467
231 nmdc:mga08x19_22347_c1 3300050514 Bacteria 3917
232 nmdc:mga08x19_7094_c1 3300050514 Bacteria 6651
233 nmdc:mga08x19_93748_c1 3300050514 Bacteria 1984
234 nmdc:mga0a205_106081_c1 3300050515 Bacteria 2708
235 nmdc:mga0a205_10990_c1 3300050515 Archaea 6763
236 nmdc:mga0a205_243334_c1 3300050515 Bacteria 1680
237 nmdc:mga0a205_70_c1 3300050515 Bacteria 55862
238 Ga0307413_10003640
239 rootL2_10064938
240 Ga0070676_10012269
241 Ga0070683_100000421
242 Ga0070683_100144099
243 Ga0070677_10029763
244 Ga0070666_10238656
245 Ga0070680_100030418
246 Ga0070691_10001309
247 Ga0070691_10010603
248 Ga0070691_10046707
249 Ga0070691_10059369
250 Ga0070661_100009212
251 Ga0070661_100266559
252 Ga0070669_100033428
253 Ga0070674_100042103
254 Ga0070659_100084376
255 Ga0070667_100035522
256 Ga0070703_10000212
257 Ga0070709_10004062
258 Ga0070714_100001976
259 Ga0070714_100019266
260 Ga0070713_100009315
261 Ga0070711_100000042
262 Ga0070705_100007158
263 Ga0070700_100213293
264 Ga0070694_100001724
265 Ga0070694_100009704
266 Ga0070694_100014580
267 Ga0070694_100053331
268 Ga0070694_100108614
269 Ga0070708_100003450
270 Ga0070708_100261104
271 Ga0070662_100004826
272 Ga0070681_10001461
273 Ga0068867_100004045
274 Ga0070706_100002439
275 Ga0070707_100030510
276 Ga0070707_100106633
277 Ga0070698_100066609
278 Ga0070699_100015002
279 Ga0070699_100022095
280 Ga0070699_100065877
281 Ga0070679_100003638
282 Ga0070679_100014534
283 Ga0070679_100381902
284 Ga0070684_100002362
285 Ga0070684_100054656
286 Ga0070697_100000716
287 Ga0070697_100006135
288 Ga0070697_100021834
289 Ga0070697_100029584
290 Ga0070697_100056585
291 Ga0070697_100157345
292 Ga0070697_100184356
293 Ga0070686_100129521
294 Ga0070695_100000925
295 Ga0070695_100008207
296 Ga0070695_100010201
297 Ga0070695_100012647
298 Ga0070695_100034654
299 Ga0070695_100156098
300 Ga0070696_100006365
301 Ga0070696_100006904
302 Ga0070696_100012949
303 Ga0070696_100015651
304 Ga0070696_100017717
305 Ga0070696_100022901
306 Ga0070696_100140671
307 Ga0070696_100148742
308 Ga0070693_100005454
309 Ga0070704_100003727
310 Ga0070704_100010193
311 Ga0070704_100040609
312 Ga0068855_100185289
313 Ga0070664_100058096
314 Ga0068856_100129695
315 Ga0068852_100211571
316 Ga0068866_10000817
317 Ga0068861_100043322
318 Ga0068858_100097080
319 Ga0068860_100019095
320 Ga0068860_100128184
321 Ga0075368_10013872
322 Ga0075364_10022548
323 Ga0070712_100314948
324 Ga0075367_10016345
325 Ga0075366_10023458
326 Ga0097621_100045931
327 Ga0075370_10006242
328 Ga0075428_100034931
329 Ga0075428_100118737
330 Ga0075433_10000392
331 Ga0075433_10014223
332 Ga0075433_10030365
333 Ga0075433_10076897
334 Ga0075433_10134183
335 Ga0075434_100001577
336 Ga0075434_100011065
337 Ga0075434_100166215
338 Ga0068865_100003801
339 Ga0075436_100007025
340 Ga0075436_100008627
341 Ga0075436_100062075
342 Ga0075436_100089385
343 Ga0075435_100004902
344 Ga0075435_100087406
345 Ga0105240_10002758
346 Ga0105240_10081979
347 Ga0105240_10224922
348 Ga0105245_10052868
349 Ga0114129_10062942
350 Ga0114129_10309057
351 Ga0105243_10060051
352 Ga0105241_10000068
353 Ga0105241_10034553
354 Ga0105241_10054615
355 Ga0105242_10082859
356 Ga0105248_10054102
357 Ga0105249_10052563
358 Ga0105239_10026338
359 Ga0157373_10010026
360 Ga0157371_10017536
361 Ga0157371_10142903
362 Ga0157370_10002408
363 Ga0157370_10016576
364 Ga0157370_10058847
365 Ga0157378_10007373
366 Ga0163162_10234880
367 Ga0157372_10005569
368 Ga0157372_10009131
369 Ga0157372_10036311
370 Ga0157372_10061135
371 Ga0157375_10051038
372 Ga0157380_10150049
373 Ga0157379_10008430
374 Ga0163161_10035525
375 Ga0207653_10000103
376 Ga0207680_10170078
377 Ga0207645_10002271
378 Ga0207705_10104387
379 Ga0207684_10041395
380 Ga0207654_10000300
381 Ga0207654_10018286
382 Ga0207654_10041842
383 Ga0207707_10007019
384 Ga0207707_10012336
385 Ga0207707_10020904
386 Ga0207695_10037427
387 Ga0207663_10000029
388 Ga0207663_10105619
389 Ga0207660_10013959
390 Ga0207660_10037915
391 Ga0207657_10024026
392 Ga0207657_10152290
393 Ga0207649_10143515
394 Ga0207652_10004222
395 Ga0207652_10020408
396 Ga0207652_10261235
397 Ga0207646_10028078
398 Ga0207646_10089415
399 Ga0207646_10281004
400 Ga0207681_10056760
401 Ga0207694_10025796
402 Ga0207687_10094473
403 Ga0207700_10139280
404 Ga0207644_10034845
405 Ga0207706_10003182
406 Ga0207686_10003662
407 Ga0207709_10003868
408 Ga0207669_10002858
409 Ga0207704_10020930
410 Ga0207711_10004515
411 Ga0207689_10004649
412 Ga0207661_10002422
413 Ga0207661_10026802
414 Ga0207679_10074432
415 Ga0207667_10035565
416 Ga0207640_10108864
417 Ga0207703_10024462
418 Ga0207639_10270469
419 Ga0207678_10003416
420 Ga0207708_10122647
421 Ga0207648_10008653
422 Ga0207675_100025289
423 Ga0207675_100043245
424 Ga0207698_10030528
425 Ga0209813_10032052
426 Ga0265334_10022969
427 Ga0316576_10004498
428 Ga0316576_10005684
429 Ga0316576_10006684
430 Ga0316576_10099974
431 Ga0316576_10105012
432 Ga0316577_10163152
433 Ga0307407_10038283
434 Ga0307409_100025948
435 Ga0307411_10243876
436 Ga0316583_10028437
437 Ga0316584_0001656
438 Ga0316584_0046161
439 Ga0316584_0067800
440 Ga0451577_0000001
441 Ga0453683_0041320
442 Ga0453683_0047800
443 Ga0466961_0305084
444 Ga0451576_0010136
445 Ga0451576_0042594
446 Ga0451576_0056798
447 Ga0451576_0235402
448 Ga0496106_0109829
449 Ga0501075_0047567
450 Ga0501075_0132633
451 Ga0501076_0082930
452 Ga0501077_0048130
453 Ga0501080_0271922
454 Ga0501081_0029599
455 nmdc:mga00v17_42148_c1
456 nmdc:mga0k408_9325_c2
457 nmdc:mga06z11_22848_c1
458 nmdc:mga04h51_62080_c1
459 nmdc:mga07m45_13262_c1
460 nmdc:mga05p37_120231_c1
461 nmdc:mga05p37_352322_c1
462 nmdc:mga05p37_417612_c1
463 nmdc:mga0n895_13722_c1
464 nmdc:mga0n895_326932_c1
465 nmdc:mga0n895_527_c1
466 nmdc:mga0n895_7187_c1
467 nmdc:mga0rr50_83759_c1
468 nmdc:mga08x19_22347_c1
469 nmdc:mga08x19_7094_c1
470 nmdc:mga08x19_93748_c1
471 nmdc:mga0a205_106081_c1
472 nmdc:mga0a205_10990_c1
473 nmdc:mga0a205_243334_c1
474 nmdc:mga0a205_70_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13480

Acetyltransf_6

Acetyltransferase (GNAT) domain

161

298

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2aj6-assembly1.cif.gz_A crystal structure of a putative gnat family acetyltransferase (mw0638) from staphylococcus aureus subsp. aureus at 1.63 a resolution 0.8257 194 267
1xe4-assembly1.cif.gz_A crystal structure of weissella viridescens femx (k36m) mutant 0.7829 13 298
5u08-assembly1.cif.gz_A crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with sisomicin 0.7783 163 265
1xix-assembly1.cif.gz_A crystal structure of weissella viridescens femx form ii 0.7777 13 298
5f47-assembly1.cif.gz_B crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with trehalose 0.7756 163 265
ID Description Score Start End Superfamily
af_Q6ES10_187_273_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8923 218 264 3.40.630.30
af_Q2FYR1_179_367_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8885 151 274 3.40.630.30
1p4nA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8826 133 285 3.40.630.30
af_Q2FZ34_165_379_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8391 139 276 3.40.630.30
1p4nA02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8172 133 285 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1Q8AV02-F1-model_v4 BioF2-like acetyltransferase domain-containing protein 0.9684 38 340 GO:0008360
GO:0009252
GO:0016755
GO:0071555
AF-A0A1W9M7D9-F1-model_v4 Methicillin resistance protein 0.9599 4 339
AF-A0A679HUS3-F1-model_v4 FemAB-related protein, PEP-CTERM system-associated 0.9573 1 340
AF-A0A679HUS3-F1-model_v4 FemAB-related protein, PEP-CTERM system-associated 0.9545 1 340
AF-A0A1Q8AV02-F1-model_v4 BioF2-like acetyltransferase domain-containing protein 0.9531 38 340 GO:0008360
GO:0009252
GO:0016755
GO:0071555

Map