F349979

General Info

Members Datasets Scaffolds Average Seq Length
237 142 474 187

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10162531|Ga0105241_101625314
Length 184
Sequence MSHREQYTPGPAGGAQVRKDGEKWTLILVRELRHSPEKVWQALTDPAHLREWAPFEADGSLGTAGTTVKLTTVGAPTPQVSETTVTRADAPKVLEYNDIRWELEAFGGGTRLTLWHNLDRRFISMGAAGWHICLDVLDRLLSGTAIGRIVGGEAMKFGWPQLNSEYAQQFGIEVPSWPPKAAQS

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.8
Rhizosphere 89.45
Stem 0
Stem Tuber 0
Unclassified 12.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10162531 3300009174 Bacteria 1837
2 Ga0070683_100000012 3300005329 Bacteria 274646
3 Ga0070683_100040961 3300005329 Bacteria 4260
4 Ga0070683_100086599 3300005329 Unclassified 2937
5 Ga0068869_100475919 3300005334 Unclassified 1039
6 Ga0070680_100078150 3300005336 Bacteria 2726
7 Ga0068868_100026632 3300005338 Bacteria 4409
8 Ga0070691_10046288 3300005341 Bacteria 2066
9 Ga0070671_100626573 3300005355 Unclassified 930
10 Ga0070673_100275431 3300005364 Unclassified 1474
11 Ga0070709_10315049 3300005434 Bacteria 1147
12 Ga0070714_100002908 3300005435 Bacteria 12665
13 Ga0070714_100150247 3300005435 Bacteria 2098
14 Ga0070714_100178359 3300005435 Bacteria 1932
15 Ga0070714_100239733 3300005435 Bacteria 1673
16 Ga0070713_100009861 3300005436 Bacteria 6869
17 Ga0070713_100063368 3300005436 Bacteria 3099
18 Ga0070713_100289802 3300005436 Bacteria 1504
19 Ga0070713_100479350 3300005436 Unclassified 1172
20 Ga0070713_100718924 3300005436 Unclassified 954
21 Ga0070711_100480144 3300005439 Bacteria 1022
22 Ga0070708_100104899 3300005445 Bacteria 2593
23 Ga0070708_100300825 3300005445 Bacteria 1511
24 Ga0070708_100786451 3300005445 Bacteria 895
25 Ga0070708_100833405 3300005445 Bacteria 867
26 Ga0070678_100520316 3300005456 Unclassified 1052
27 Ga0070662_100235367 3300005457 Bacteria 1467
28 Ga0070681_10001726 3300005458 Bacteria 19565
29 Ga0068867_100393377 3300005459 Unclassified 1167
30 Ga0070698_100066645 3300005471 Bacteria 3623
31 Ga0070699_100610871 3300005518 Bacteria 995
32 Ga0070679_100184446 3300005530 Bacteria 2058
33 Ga0070679_100515092 3300005530 Unclassified 1140
34 Ga0070684_100000013 3300005535 Bacteria 167281
35 Ga0070684_100043186 3300005535 Bacteria 3892
36 Ga0070684_100327742 3300005535 Bacteria 1407
37 Ga0068853_100013697 3300005539 Bacteria 6625
38 Ga0070695_100386337 3300005545 Bacteria 1058
39 Ga0070693_100065665 3300005547 Bacteria 2121
40 Ga0070693_100232669 3300005547 Bacteria 1213
41 Ga0068855_100002292 3300005563 Bacteria 23637
42 Ga0068855_100007679 3300005563 Bacteria 13030
43 Ga0068857_100013479 3300005577 Bacteria 7121
44 Ga0068854_100017859 3300005578 Bacteria 4755
45 Ga0068856_100001927 3300005614 Bacteria 21632
46 Ga0068856_100002900 3300005614 Bacteria 17553
47 Ga0068856_101465070 3300005614 Bacteria 697
48 Ga0068859_100850530 3300005617 Unclassified 998
49 Ga0068864_100036707 3300005618 Bacteria 4179
50 Ga0068863_100066780 3300005841 Bacteria 3402
51 Ga0068858_100004302 3300005842 Bacteria 13999
52 Ga0068858_100060728 3300005842 Unclassified 3494
53 Ga0070717_10008386 3300006028 Bacteria 7717
54 Ga0070717_10036738 3300006028 Bacteria 3975
55 Ga0070717_10085652 3300006028 Bacteria 2652
56 Ga0070717_10261297 3300006028 Bacteria 1532
57 Ga0070717_10458920 3300006028 Bacteria 1149
58 Ga0070716_100515792 3300006173 Bacteria 885
59 Ga0070712_100024274 3300006175 Bacteria 4016
60 Ga0070712_100177164 3300006175 Bacteria 1658
61 Ga0097621_100000526 3300006237 Bacteria 26837
62 Ga0097621_100000716 3300006237 Bacteria 23229
63 Ga0097621_101006441 3300006237 Bacteria 780
64 Ga0068871_100000081 3300006358 Bacteria 53923
65 Ga0068871_100000606 3300006358 Bacteria 24637
66 Ga0075431_100320292 3300006847 Bacteria 1564
67 Ga0075433_10004003 3300006852 Bacteria 11403
68 Ga0075434_100034550 3300006871 Bacteria 4993
69 Ga0068865_100009215 3300006881 Bacteria 6112
70 Ga0075436_100182147 3300006914 Bacteria 1485
71 Ga0097620_100850509 3300006931 Unclassified 998
72 Ga0075435_100021797 3300007076 Bacteria 4935
73 Ga0105240_10008206 3300009093 Bacteria 14967
74 Ga0105240_10029937 3300009093 Bacteria 7084
75 Ga0105240_10228251 3300009093 Bacteria 2165
76 Ga0105240_10376103 3300009093 Bacteria 1605
77 Ga0111539_10243164 3300009094 Bacteria 2095
78 Ga0105245_10807347 3300009098 Unclassified 976
79 Ga0105241_10008473 3300009174 Bacteria 7562
80 Ga0105248_10006300 3300009177 Bacteria 13020
81 Ga0105237_10111272 3300009545 Bacteria 2730
82 Ga0105238_10001612 3300009551 Bacteria 22588
83 Ga0105238_10084758 3300009551 Bacteria 3158
84 Ga0105238_10286245 3300009551 Bacteria 1630
85 Ga0105238_10438102 3300009551 Unclassified 1303
86 Ga0105239_10004280 3300010375 Bacteria 17119
87 Ga0157370_10500983 3300013104 Unclassified 1115
88 Ga0157369_10000609 3300013105 Bacteria 46528
89 Ga0157369_10011043 3300013105 Bacteria 10276
90 Ga0157369_10013414 3300013105 Bacteria 9265
91 Ga0157369_10214890 3300013105 Bacteria 2014
92 Ga0157369_10784371 3300013105 Bacteria 979
93 Ga0157374_10001116 3300013296 Bacteria 23067
94 Ga0157374_10010777 3300013296 Bacteria 7880
95 Ga0157374_10524380 3300013296 Bacteria 1191
96 Ga0157378_10000055 3300013297 Bacteria 97875
97 Ga0157378_10005323 3300013297 Bacteria 11300
98 Ga0157378_10977213 3300013297 Bacteria 880
99 Ga0157372_10000778 3300013307 Bacteria 34511
100 Ga0157372_10000992 3300013307 Bacteria 31047
101 Ga0157372_10001764 3300013307 Bacteria 23462
102 Ga0157372_10002334 3300013307 Bacteria 20547
103 Ga0157372_11329025 3300013307 Bacteria 829
104 Ga0182008_10015698 3300014497 Bacteria 3949
105 Ga0157376_10009938 3300014969 Bacteria 6940
106 Ga0157376_10041657 3300014969 Bacteria 3761
107 Ga0182006_1059174 3300015261 Bacteria 1451
108 Ga0213874_10017894 3300021377 Bacteria 1908
109 Ga0213874_10086770 3300021377 Bacteria 1022
110 Ga0213876_10002497 3300021384 Bacteria 10796
111 Ga0213876_10181802 3300021384 Bacteria 1118
112 Ga0213875_10011456 3300021388 Bacteria 4410
113 Ga0213875_10105987 3300021388 Bacteria 1312
114 Ga0207692_10034412 3300025898 Bacteria 2453
115 Ga0207699_10484842 3300025906 Bacteria 891
116 Ga0207654_10087474 3300025911 Bacteria 1891
117 Ga0207654_10315431 3300025911 Bacteria 1067
118 Ga0207654_10392550 3300025911 Unclassified 963
119 Ga0207707_10028641 3300025912 Bacteria 4868
120 Ga0207695_10093769 3300025913 Bacteria 3011
121 Ga0207695_10281251 3300025913 Bacteria 1557
122 Ga0207695_10289932 3300025913 Bacteria 1529
123 Ga0207671_10152870 3300025914 Bacteria 1784
124 Ga0207693_10010173 3300025915 Bacteria 7640
125 Ga0207693_10093729 3300025915 Bacteria 2354
126 Ga0207693_10710879 3300025915 Unclassified 778
127 Ga0207663_10467922 3300025916 Bacteria 975
128 Ga0207660_10060678 3300025917 Bacteria 2720
129 Ga0207657_10002947 3300025919 Bacteria 18257
130 Ga0207652_10060596 3300025921 Bacteria 3265
131 Ga0207652_10134553 3300025921 Bacteria 2207
132 Ga0207694_10002461 3300025924 Bacteria 15109
133 Ga0207694_10358106 3300025924 Unclassified 1209
134 Ga0207687_10891278 3300025927 Unclassified 761
135 Ga0207700_10069193 3300025928 Bacteria 2708
136 Ga0207700_10123551 3300025928 Bacteria 2102
137 Ga0207700_10171546 3300025928 Bacteria 1810
138 Ga0207700_10559200 3300025928 Unclassified 1016
139 Ga0207664_10095072 3300025929 Bacteria 2451
140 Ga0207664_10142099 3300025929 Bacteria 2032
141 Ga0207664_10269606 3300025929 Bacteria 1491
142 Ga0207664_10454348 3300025929 Bacteria 1144
143 Ga0207644_10294695 3300025931 Bacteria 1306
144 Ga0207690_10310229 3300025932 Bacteria 1237
145 Ga0207704_10139727 3300025938 Unclassified 1692
146 Ga0207665_10008803 3300025939 Bacteria 6635
147 Ga0207711_10050170 3300025941 Bacteria 3572
148 Ga0207689_10467547 3300025942 Unclassified 1055
149 Ga0207661_10000034 3300025944 Bacteria 154138
150 Ga0207661_10003485 3300025944 Bacteria 10928
151 Ga0207661_10073819 3300025944 Unclassified 2795
152 Ga0207679_10121313 3300025945 Bacteria 2082
153 Ga0207667_10002434 3300025949 Bacteria 23301
154 Ga0207667_10028330 3300025949 Bacteria 6084
155 Ga0207667_10121738 3300025949 Bacteria 2688
156 Ga0207667_10451716 3300025949 Bacteria 1306
157 Ga0207640_10096437 3300025981 Bacteria 2062
158 Ga0207640_10517526 3300025981 Unclassified 997
159 Ga0207677_10007668 3300026023 Bacteria 5990
160 Ga0207677_10481890 3300026023 Bacteria 1069
161 Ga0207703_10009381 3300026035 Bacteria 7691
162 Ga0207639_10020382 3300026041 Bacteria 4746
163 Ga0207702_10000594 3300026078 Bacteria 40060
164 Ga0207702_10004696 3300026078 Bacteria 12073
165 Ga0207641_10640324 3300026088 Unclassified 1043
166 Ga0207676_10045750 3300026095 Bacteria 3383
167 Ga0207674_10013637 3300026116 Bacteria 9001
168 Ga0265316_10169655 3300031344 Bacteria 1628
169 Ga0373926_0006911 3300035083 Bacteria 3772
170 Ga0373936_0082583 3300035113 Bacteria 1339
171 Ga0373955_0171661 3300035172 Bacteria 1284
172 Ga0373931_0016813 3300035691 Bacteria 3607
173 Ga0373935_0005446 3300035692 Bacteria 7499
174 Ga0373927_0506826 3300035695 Unclassified 797
175 Ga0373933_0407969 3300035724 Unclassified 887
176 Ga0373947_0008929 3300035725 Bacteria 5761
177 Ga0373947_0344927 3300035725 Bacteria 999
178 Ga0373947_0435472 3300035725 Bacteria 887
179 Ga0373937_0019376 3300036401 Bacteria 6090
180 Ga0373925_0044057 3300037068 Bacteria 3313
181 Ga0395900_0017762 3300037418 Bacteria 7261
182 Ga0395898_0027918 3300037466 Bacteria 5660
183 Ga0436364_0521311 3300037853 Bacteria 3712
184 Ga0436364_0553380 3300037853 Unclassified 628
185 Ga0436364_0584970 3300037853 Unclassified 740
186 Ga0436364_0718729 3300037853 Bacteria 1663
187 Ga0436364_1426957 3300037853 Bacteria 5177
188 Ga0436365_0550717 3300039437 Bacteria 2416
189 Ga0436365_1813885 3300039437 Bacteria 10796
190 Ga0436363_0890369 3300039450 Unclassified 889
191 Ga0436363_0959752 3300039450 Bacteria 1899
192 Ga0436363_1610980 3300039450 Bacteria 1512
193 Ga0436362_0569629 3300039453 Bacteria 5327
194 Ga0466964_0180029 3300044706 Bacteria 1002
195 Ga0466967_0006787 3300045976 Bacteria 8157
196 Ga0466967_0007004 3300045976 Bacteria 8070
197 Ga0495651_0115189 3300046462 Bacteria 1982
198 Ga0495580_0001482 3300046472 Bacteria 20596
199 Ga0495580_0013338 3300046472 Bacteria 6278
200 Ga0495580_0033234 3300046472 Bacteria 3717
201 Ga0495580_0046543 3300046472 Bacteria 3077
202 Ga0495582_0004223 3300046473 Bacteria 8083
203 Ga0495584_0050845 3300046491 Bacteria 2087
204 Ga0495608_0239955 3300046511 Bacteria 1133
205 Ga0495608_0261181 3300046511 Bacteria 1078
206 Ga0495630_0145118 3300046517 Bacteria 1805
207 Ga0495630_0157450 3300046517 Bacteria 1729
208 Ga0495666_0062110 3300046526 Bacteria 1784
209 Ga0495642_0262276 3300046528 Bacteria 756
210 Ga0495665_0005513 3300046531 Bacteria 6818
211 Ga0495665_0240786 3300046531 Bacteria 932
212 Ga0495645_0512387 3300046543 Bacteria 748
213 Ga0495659_0015187 3300046664 Bacteria 2530
214 Ga0495623_0261079 3300046679 Bacteria 970
215 Ga0495581_0026943 3300047315 Bacteria 3333
216 Ga0495604_0340070 3300047317 Bacteria 999
217 Ga0495675_0023033 3300047444 Bacteria 3969
218 Ga0495602_0087891 3300048088 Bacteria 2589
219 Ga0495614_0202272 3300048089 Bacteria 899
220 Ga0496105_0157061 3300048908 Bacteria 1868
221 Ga0496108_0228208 3300048911 Bacteria 1619
222 Ga0496110_0191792 3300048913 Bacteria 1856
223 Ga0496111_0065995 3300048914 Bacteria 2628
224 Ga0496112_0005431 3300048915 Bacteria 11021
225 Ga0496112_0065350 3300048915 Bacteria 3590
226 Ga0496112_0262612 3300048915 Bacteria 1676
227 Ga0496112_0432404 3300048915 Bacteria 1254
228 Ga0496113_0395487 3300048916 Bacteria 1109
229 nmdc:mga0qj67_8623_c1 3300050509 Bacteria 7565
230 nmdc:mga06r32_280273_c1 3300050510 Bacteria 1654
231 nmdc:mga0n895_12675_c1 3300050512 Bacteria 7569
232 nmdc:mga0n895_278083_c1 3300050512 Bacteria 1698
233 nmdc:mga0rr50_266741_c1 3300050513 Bacteria 1426
234 nmdc:mga0rr50_3523_c1 3300050513 Bacteria 9028
235 nmdc:mga08x19_201130_c1 3300050514 Bacteria 1366
236 nmdc:mga08x19_42197_c1 3300050514 Bacteria 2907
237 nmdc:mga0a205_7904_c1 3300050515 Bacteria 9658
238 Ga0105241_10162531
239 Ga0070683_100000012
240 Ga0070683_100040961
241 Ga0070683_100086599
242 Ga0068869_100475919
243 Ga0070680_100078150
244 Ga0068868_100026632
245 Ga0070691_10046288
246 Ga0070671_100626573
247 Ga0070673_100275431
248 Ga0070709_10315049
249 Ga0070714_100002908
250 Ga0070714_100150247
251 Ga0070714_100178359
252 Ga0070714_100239733
253 Ga0070713_100009861
254 Ga0070713_100063368
255 Ga0070713_100289802
256 Ga0070713_100479350
257 Ga0070713_100718924
258 Ga0070711_100480144
259 Ga0070708_100104899
260 Ga0070708_100300825
261 Ga0070708_100786451
262 Ga0070708_100833405
263 Ga0070678_100520316
264 Ga0070662_100235367
265 Ga0070681_10001726
266 Ga0068867_100393377
267 Ga0070698_100066645
268 Ga0070699_100610871
269 Ga0070679_100184446
270 Ga0070679_100515092
271 Ga0070684_100000013
272 Ga0070684_100043186
273 Ga0070684_100327742
274 Ga0068853_100013697
275 Ga0070695_100386337
276 Ga0070693_100065665
277 Ga0070693_100232669
278 Ga0068855_100002292
279 Ga0068855_100007679
280 Ga0068857_100013479
281 Ga0068854_100017859
282 Ga0068856_100001927
283 Ga0068856_100002900
284 Ga0068856_101465070
285 Ga0068859_100850530
286 Ga0068864_100036707
287 Ga0068863_100066780
288 Ga0068858_100004302
289 Ga0068858_100060728
290 Ga0070717_10008386
291 Ga0070717_10036738
292 Ga0070717_10085652
293 Ga0070717_10261297
294 Ga0070717_10458920
295 Ga0070716_100515792
296 Ga0070712_100024274
297 Ga0070712_100177164
298 Ga0097621_100000526
299 Ga0097621_100000716
300 Ga0097621_101006441
301 Ga0068871_100000081
302 Ga0068871_100000606
303 Ga0075431_100320292
304 Ga0075433_10004003
305 Ga0075434_100034550
306 Ga0068865_100009215
307 Ga0075436_100182147
308 Ga0097620_100850509
309 Ga0075435_100021797
310 Ga0105240_10008206
311 Ga0105240_10029937
312 Ga0105240_10228251
313 Ga0105240_10376103
314 Ga0111539_10243164
315 Ga0105245_10807347
316 Ga0105241_10008473
317 Ga0105248_10006300
318 Ga0105237_10111272
319 Ga0105238_10001612
320 Ga0105238_10084758
321 Ga0105238_10286245
322 Ga0105238_10438102
323 Ga0105239_10004280
324 Ga0157370_10500983
325 Ga0157369_10000609
326 Ga0157369_10011043
327 Ga0157369_10013414
328 Ga0157369_10214890
329 Ga0157369_10784371
330 Ga0157374_10001116
331 Ga0157374_10010777
332 Ga0157374_10524380
333 Ga0157378_10000055
334 Ga0157378_10005323
335 Ga0157378_10977213
336 Ga0157372_10000778
337 Ga0157372_10000992
338 Ga0157372_10001764
339 Ga0157372_10002334
340 Ga0157372_11329025
341 Ga0182008_10015698
342 Ga0157376_10009938
343 Ga0157376_10041657
344 Ga0182006_1059174
345 Ga0213874_10017894
346 Ga0213874_10086770
347 Ga0213876_10002497
348 Ga0213876_10181802
349 Ga0213875_10011456
350 Ga0213875_10105987
351 Ga0207692_10034412
352 Ga0207699_10484842
353 Ga0207654_10087474
354 Ga0207654_10315431
355 Ga0207654_10392550
356 Ga0207707_10028641
357 Ga0207695_10093769
358 Ga0207695_10281251
359 Ga0207695_10289932
360 Ga0207671_10152870
361 Ga0207693_10010173
362 Ga0207693_10093729
363 Ga0207693_10710879
364 Ga0207663_10467922
365 Ga0207660_10060678
366 Ga0207657_10002947
367 Ga0207652_10060596
368 Ga0207652_10134553
369 Ga0207694_10002461
370 Ga0207694_10358106
371 Ga0207687_10891278
372 Ga0207700_10069193
373 Ga0207700_10123551
374 Ga0207700_10171546
375 Ga0207700_10559200
376 Ga0207664_10095072
377 Ga0207664_10142099
378 Ga0207664_10269606
379 Ga0207664_10454348
380 Ga0207644_10294695
381 Ga0207690_10310229
382 Ga0207704_10139727
383 Ga0207665_10008803
384 Ga0207711_10050170
385 Ga0207689_10467547
386 Ga0207661_10000034
387 Ga0207661_10003485
388 Ga0207661_10073819
389 Ga0207679_10121313
390 Ga0207667_10002434
391 Ga0207667_10028330
392 Ga0207667_10121738
393 Ga0207667_10451716
394 Ga0207640_10096437
395 Ga0207640_10517526
396 Ga0207677_10007668
397 Ga0207677_10481890
398 Ga0207703_10009381
399 Ga0207639_10020382
400 Ga0207702_10000594
401 Ga0207702_10004696
402 Ga0207641_10640324
403 Ga0207676_10045750
404 Ga0207674_10013637
405 Ga0265316_10169655
406 Ga0373926_0006911
407 Ga0373936_0082583
408 Ga0373955_0171661
409 Ga0373931_0016813
410 Ga0373935_0005446
411 Ga0373927_0506826
412 Ga0373933_0407969
413 Ga0373947_0008929
414 Ga0373947_0344927
415 Ga0373947_0435472
416 Ga0373937_0019376
417 Ga0373925_0044057
418 Ga0395900_0017762
419 Ga0395898_0027918
420 Ga0436364_0521311
421 Ga0436364_0553380
422 Ga0436364_0584970
423 Ga0436364_0718729
424 Ga0436364_1426957
425 Ga0436365_0550717
426 Ga0436365_1813885
427 Ga0436363_0890369
428 Ga0436363_0959752
429 Ga0436363_1610980
430 Ga0436362_0569629
431 Ga0466964_0180029
432 Ga0466967_0006787
433 Ga0466967_0007004
434 Ga0495651_0115189
435 Ga0495580_0001482
436 Ga0495580_0013338
437 Ga0495580_0033234
438 Ga0495580_0046543
439 Ga0495582_0004223
440 Ga0495584_0050845
441 Ga0495608_0239955
442 Ga0495608_0261181
443 Ga0495630_0145118
444 Ga0495630_0157450
445 Ga0495666_0062110
446 Ga0495642_0262276
447 Ga0495665_0005513
448 Ga0495665_0240786
449 Ga0495645_0512387
450 Ga0495659_0015187
451 Ga0495623_0261079
452 Ga0495581_0026943
453 Ga0495604_0340070
454 Ga0495675_0023033
455 Ga0495602_0087891
456 Ga0495614_0202272
457 Ga0496105_0157061
458 Ga0496108_0228208
459 Ga0496110_0191792
460 Ga0496111_0065995
461 Ga0496112_0005431
462 Ga0496112_0065350
463 Ga0496112_0262612
464 Ga0496112_0432404
465 Ga0496113_0395487
466 nmdc:mga0qj67_8623_c1
467 nmdc:mga06r32_280273_c1
468 nmdc:mga0n895_12675_c1
469 nmdc:mga0n895_278083_c1
470 nmdc:mga0rr50_266741_c1
471 nmdc:mga0rr50_3523_c1
472 nmdc:mga08x19_201130_c1
473 nmdc:mga08x19_42197_c1
474 nmdc:mga0a205_7904_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

23

154

0.81

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

33

142

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8532 23 139
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8259 23 136
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8012 23 152
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.799 23 147
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.7877 18 142
ID Description Score Start End Superfamily
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8259 23 136 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8234 20 139 3.30.530.20
3eliA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8143 23 137 3.30.530.20
af_P9WL87_17_165_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7851 23 138 3.30.530.20
af_Q55DB6_248_379_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7823 21 139 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2V9F432-F1-model_v4 PPM-type phosphatase domain-containing protein 0.9687 2 171 GO:0016791
AF-A0A3N5H1A8-F1-model_v4 SRPBCC family protein 0.9569 2 168
AF-A0A2V9XQP2-F1-model_v4 Polyketide cyclase 0.9535 1 172
AF-A0A7R8GC65-F1-model_v4 deleted 0.9534 2 169
AF-A0A2V9X4B0-F1-model_v4 Polyketide cyclase 0.9514 52 172

Map