F348425

General Info

Members Datasets Scaffolds Average Seq Length
235 122 230 250

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0075015|Ga0495638_0075015_423_1241
Length 272
Sequence MIAEQKPYCNLKKDPMTGYKLSTSSRMLFAFLFLASLCPRLQAQNSNTIFLSEGKIEFEKKLNVYAGMDNNDTWTELEKKSTSQFRITYFDMVFTRNKTLYKPGREIQENNRMEFFERPSQDNVVYSELDHATSISQKKVFEQLFLIQDSLRTIKWKITDENRTIAGFACRRANAIIMDSIYVVAFYTDEILTTGGPESFNGLPGMILGVALPHQHVSWFATKVQATAVSEGELAPPVKGKKVNNEALKKTLTELVKNWGKNGREYVVFTML

Samples

Sample ID Description Type Environment
1 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
2 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
3 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
4 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
5 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
119 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
120 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 0
Isolates 2.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.4
Nodule 0
Rhizoplane 0
Rhizosphere 87.23
Stem 0
Stem Tuber 0
Unclassified 9.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10043281 3300003316 Bacteria 6435
2 rootH1_10165352 3300003316 Bacteria 2473
3 rootH2_10004718 3300003320 Bacteria 23099
4 rootH2_10006598 3300003320 Bacteria 16131
5 rootH2_10065879 3300003320 Bacteria 12115
6 rootH2_10089470 3300003320 Bacteria 10701
7 rootH2_10101914 3300003320 Unclassified 2058
8 rootL2_10079865 3300003322 Bacteria 2169
9 rootH1_10001205 3300003323 Bacteria 3084
10 rootH1_10048184 3300003323 Bacteria 1822
11 rootH1_10262028 3300003323 Bacteria 3234
12 Ga0070658_10593618 3300005327 Unclassified 960
13 Ga0070683_100007488 3300005329 Bacteria 9226
14 Ga0070670_100079611 3300005331 Bacteria 2816
15 Ga0070670_100209782 3300005331 Bacteria 1693
16 Ga0068869_100017926 3300005334 Bacteria 4811
17 Ga0068869_100449772 3300005334 Bacteria 1068
18 Ga0070666_10000024 3300005335 Bacteria 161355
19 Ga0070666_10039341 3300005335 Bacteria 3151
20 Ga0070680_100037345 3300005336 Bacteria 3924
21 Ga0070682_100001149 3300005337 Bacteria 15103
22 Ga0068868_100032509 3300005338 Bacteria 4014
23 Ga0068868_100109279 3300005338 Bacteria 2245
24 Ga0068868_100180660 3300005338 Bacteria 1750
25 Ga0070660_100009572 3300005339 Bacteria 6824
26 Ga0070660_100109824 3300005339 Bacteria 2193
27 Ga0070675_100076317 3300005354 Bacteria 2787
28 Ga0070673_100208354 3300005364 Bacteria 1687
29 Ga0070688_100020505 3300005365 Bacteria 3845
30 Ga0070659_100253312 3300005366 Bacteria 1459
31 Ga0070667_100001618 3300005367 Bacteria 20179
32 Ga0070667_100046130 3300005367 Bacteria 3665
33 Ga0070667_100341407 3300005367 Unclassified 1354
34 Ga0070678_100061256 3300005456 Unclassified 2773
35 Ga0070681_10091709 3300005458 Bacteria 2988
36 Ga0070681_10789324 3300005458 Unclassified 866
37 Ga0070679_100063520 3300005530 Bacteria 3680
38 Ga0070684_100001898 3300005535 Bacteria 15313
39 Ga0068853_100056713 3300005539 Bacteria 3379
40 Ga0068853_100387184 3300005539 Bacteria 1306
41 Ga0068853_100437010 3300005539 Bacteria 1229
42 Ga0070672_100105382 3300005543 Bacteria 2292
43 Ga0070665_100000031 3300005548 Bacteria 333365
44 Ga0068855_100000108 3300005563 Bacteria 103059
45 Ga0068855_100038236 3300005563 Bacteria 5702
46 Ga0068855_100047527 3300005563 Bacteria 5069
47 Ga0068855_100048166 3300005563 Bacteria 5032
48 Ga0070664_100139172 3300005564 Bacteria 2136
49 Ga0068857_100019945 3300005577 Bacteria 5893
50 Ga0068857_100119962 3300005577 Bacteria 2367
51 Ga0068856_100007143 3300005614 Bacteria 10890
52 Ga0068852_100007910 3300005616 Bacteria 7789
53 Ga0068852_100059717 3300005616 Bacteria 3308
54 Ga0068852_100147394 3300005616 Bacteria 2185
55 Ga0068852_100169150 3300005616 Unclassified 2047
56 Ga0068859_100000041 3300005617 Bacteria 162415
57 Ga0068859_100037556 3300005617 Bacteria 4861
58 Ga0068864_100000924 3300005618 Bacteria 24645
59 Ga0068851_10047071 3300005834 Bacteria 2183
60 Ga0068851_10134791 3300005834 Bacteria 1338
61 Ga0068863_100101076 3300005841 Bacteria 2741
62 Ga0068863_100221231 3300005841 Bacteria 1824
63 Ga0068860_100006922 3300005843 Bacteria 11364
64 Ga0068860_100008944 3300005843 Bacteria 9974
65 Ga0068860_100180941 3300005843 Bacteria 2037
66 Ga0081540_1005583 3300005983 Bacteria 9367
67 Ga0097621_100017594 3300006237 Bacteria 5432
68 Ga0068871_100048083 3300006358 Bacteria 3442
69 Ga0068871_100188896 3300006358 Bacteria 1774
70 Ga0097620_100000041 3300006931 Bacteria 162415
71 Ga0097620_100037556 3300006931 Bacteria 4861
72 Ga0105240_10001182 3300009093 Bacteria 45690
73 Ga0105240_10003346 3300009093 Bacteria 24963
74 Ga0105240_10006830 3300009093 Bacteria 16691
75 Ga0105240_10009243 3300009093 Bacteria 13982
76 Ga0105240_10009947 3300009093 Bacteria 13407
77 Ga0105240_10010022 3300009093 Bacteria 13349
78 Ga0105240_10023701 3300009093 Bacteria 8106
79 Ga0105240_10145739 3300009093 Bacteria 2826
80 Ga0105240_10187924 3300009093 Bacteria 2431
81 Ga0105247_10087375 3300009101 Bacteria 1974
82 Ga0105241_10000459 3300009174 Bacteria 30725
83 Ga0105241_10010667 3300009174 Bacteria 6740
84 Ga0105241_10066916 3300009174 Bacteria 2780
85 Ga0105242_10811915 3300009176 Bacteria 927
86 Ga0105237_10002744 3300009545 Bacteria 21460
87 Ga0105237_10009102 3300009545 Bacteria 10671
88 Ga0105237_10019418 3300009545 Bacteria 7018
89 Ga0105237_10022257 3300009545 Bacteria 6503
90 Ga0105237_10024349 3300009545 Bacteria 6195
91 Ga0105237_10109406 3300009545 Bacteria 2755
92 Ga0105237_10392522 3300009545 Bacteria 1392
93 Ga0105237_10436678 3300009545 Unclassified 1315
94 Ga0105238_10001407 3300009551 Bacteria 24111
95 Ga0105238_10069548 3300009551 Bacteria 3521
96 Ga0105238_10189863 3300009551 Bacteria 2031
97 Ga0105238_10607293 3300009551 Bacteria 1102
98 Ga0105249_10011443 3300009553 Bacteria 7794
99 Ga0105239_10000168 3300010375 Bacteria 94279
100 Ga0105239_10001793 3300010375 Bacteria 28180
101 Ga0105239_10014758 3300010375 Bacteria 8664
102 Ga0105239_10084136 3300010375 Bacteria 3504
103 Ga0105239_10439570 3300010375 Bacteria 1479
104 Ga0105246_10027769 3300011119 Bacteria 3712
105 Ga0105246_10191545 3300011119 Bacteria 1583
106 Ga0105246_10330052 3300011119 Bacteria 1243
107 Ga0157373_10123231 3300013100 Bacteria 1822
108 Ga0157373_10136318 3300013100 Bacteria 1726
109 Ga0157373_10156895 3300013100 Bacteria 1601
110 Ga0157371_10037861 3300013102 Bacteria 3451
111 Ga0157371_10292434 3300013102 Bacteria 1178
112 Ga0157370_10011877 3300013104 Bacteria 9084
113 Ga0157370_10177185 3300013104 Bacteria 1982
114 Ga0157370_10212916 3300013104 Bacteria 1791
115 Ga0157369_10111570 3300013105 Bacteria 2906
116 Ga0157369_10730775 3300013105 Unclassified 1019
117 Ga0157374_10000002 3300013296 Bacteria 1054226
118 Ga0157374_10038646 3300013296 Bacteria 4388
119 Ga0157374_10220049 3300013296 Bacteria 1863
120 Ga0157378_10025171 3300013297 Bacteria 5244
121 Ga0157378_10171849 3300013297 Bacteria 2033
122 Ga0157378_10545914 3300013297 Unclassified 1164
123 Ga0163162_10000218 3300013306 Bacteria 52447
124 Ga0157372_10000915 3300013307 Bacteria 32101
125 Ga0157372_10005802 3300013307 Bacteria 13150
126 Ga0157372_10051869 3300013307 Bacteria 4566
127 Ga0157372_10092937 3300013307 Unclassified 3432
128 Ga0157372_10123296 3300013307 Unclassified 2978
129 Ga0157375_10031802 3300013308 Bacteria 4996
130 Ga0157375_10079660 3300013308 Bacteria 3312
131 Ga0157377_10075038 3300014745 Bacteria 1963
132 Ga0157379_10448023 3300014968 Bacteria 1191
133 Ga0209436_101353 3300025208 Bacteria 8661
134 Ga0209130_1001576 3300025284 Bacteria 14360
135 Ga0207426_1000034 3300025302 Bacteria 454016
136 Ga0207656_10100442 3300025321 Bacteria 1326
137 Ga0207680_10000151 3300025903 Bacteria 33591
138 Ga0207680_10100336 3300025903 Bacteria 1859
139 Ga0207647_10041117 3300025904 Unclassified 2909
140 Ga0207647_10188659 3300025904 Bacteria 1195
141 Ga0207647_10326691 3300025904 Unclassified 870
142 Ga0207654_10002169 3300025911 Bacteria 10047
143 Ga0207654_10031511 3300025911 Bacteria 2921
144 Ga0207654_10047246 3300025911 Bacteria 2459
145 Ga0207707_10002253 3300025912 Bacteria 17450
146 Ga0207707_10037074 3300025912 Unclassified 4260
147 Ga0207695_10000060 3300025913 Bacteria 360217
148 Ga0207695_10000077 3300025913 Bacteria 307107
149 Ga0207695_10000199 3300025913 Bacteria 166179
150 Ga0207695_10008789 3300025913 Bacteria 12592
151 Ga0207695_10013481 3300025913 Bacteria 9747
152 Ga0207695_10021516 3300025913 Bacteria 7356
153 Ga0207695_10041896 3300025913 Bacteria 4896
154 Ga0207695_10043354 3300025913 Bacteria 4795
155 Ga0207695_10296324 3300025913 Unclassified 1509
156 Ga0207695_10441911 3300025913 Unclassified 1184
157 Ga0207671_10001263 3300025914 Bacteria 29797
158 Ga0207671_10003567 3300025914 Bacteria 15405
159 Ga0207671_10005892 3300025914 Bacteria 11119
160 Ga0207671_10031265 3300025914 Bacteria 3966
161 Ga0207671_10042121 3300025914 Bacteria 3380
162 Ga0207660_10221874 3300025917 Bacteria 1484
163 Ga0207652_10001419 3300025921 Bacteria 21273
164 Ga0207694_10002639 3300025924 Bacteria 14540
165 Ga0207694_10051626 3300025924 Bacteria 3187
166 Ga0207694_10310624 3300025924 Unclassified 1299
167 Ga0207691_10043008 3300025940 Bacteria 4164
168 Ga0207689_10008095 3300025942 Bacteria 9169
169 Ga0207689_10302416 3300025942 Bacteria 1326
170 Ga0207661_10052682 3300025944 Bacteria 3252
171 Ga0207679_10097871 3300025945 Bacteria 2286
172 Ga0207667_10000084 3300025949 Bacteria 152086
173 Ga0207667_10001931 3300025949 Bacteria 25993
174 Ga0207667_10032981 3300025949 Bacteria 5574
175 Ga0207667_10388988 3300025949 Bacteria 1420
176 Ga0207651_10089046 3300025960 Bacteria 2252
177 Ga0207640_10122697 3300025981 Unclassified 1865
178 Ga0207658_10002346 3300025986 Bacteria 13910
179 Ga0207677_10151879 3300026023 Bacteria 1788
180 Ga0207677_10580424 3300026023 Unclassified 981
181 Ga0207703_10011268 3300026035 Bacteria 6953
182 Ga0207639_10111458 3300026041 Bacteria 2230
183 Ga0207702_10098057 3300026078 Bacteria 2581
184 Ga0207702_10150924 3300026078 Bacteria 2113
185 Ga0207702_10629923 3300026078 Bacteria 1054
186 Ga0207641_10000167 3300026088 Bacteria 92790
187 Ga0207641_10058225 3300026088 Bacteria 3288
188 Ga0207674_10001616 3300026116 Bacteria 28994
189 Ga0207674_10044908 3300026116 Bacteria 4549
190 Ga0207674_10095018 3300026116 Bacteria 2967
191 Ga0207683_10056017 3300026121 Unclassified 3457
192 Ga0207698_10045119 3300026142 Bacteria 3318
193 Ga0207698_10238174 3300026142 Unclassified 1656
194 Ga0207698_10250332 3300026142 Bacteria 1621
195 Ga0268266_10000088 3300028379 Bacteria 199029
196 Ga0268264_10000484 3300028381 Bacteria 52947
197 Ga0268264_10006048 3300028381 Bacteria 10229
198 Ga0268264_10020049 3300028381 Bacteria 5464
199 Ga0268264_10149733 3300028381 Bacteria 2091
200 Ga0307517_10031595 3300028786 Bacteria 6156
201 Ga0307515_10000677 3300028794 Bacteria 78511
202 Ga0307511_10000114 3300030521 Bacteria 72895
203 Ga0265327_10000107 3300031251 Bacteria 183770
204 Ga0307509_10210574 3300031507 Bacteria 1769
205 Ga0307516_10002136 3300031730 Bacteria 26781
206 Ga0307516_10270889 3300031730 Bacteria 1384
207 Ga0307510_10000074 3300033180 Bacteria 75194
208 Ga0466972_0000022 3300044658 Bacteria 193802
209 Ga0466972_0037051 3300044658 Bacteria 2384
210 Ga0466972_0049484 3300044658 Bacteria 2030
211 Ga0466961_0041052 3300044693 Bacteria 2966
212 Ga0466968_0203654 3300044735 Bacteria 928
213 Ga0466970_0002273 3300044765 Bacteria 9284
214 Ga0466959_0015406 3300045049 Bacteria 5568
215 Ga0466959_0072625 3300045049 Bacteria 2490
216 Ga0466958_0120701 3300045836 Bacteria 1641
217 Ga0495638_0075015 3300046460 Bacteria 2062
218 Ga0495641_0208140 3300046461 Bacteria 877
219 Ga0495606_0033022 3300046507 Bacteria 3576
220 Ga0495648_0000294 3300046524 Bacteria 55789
221 Ga0495611_0000274 3300046648 Bacteria 35206
222 Ga0495649_0015265 3300046694 Bacteria 4373
223 Ga0495687_000010 3300047443 Bacteria 413735
224 Ga0495686_0000102 3300047472 Bacteria 177525
225 Ga0496123_0238434 3300048926 Unclassified 905
226 Ga0500583_0078062 3300053092 Bacteria 1595
227 Ga0500642_0159238 3300053130 Bacteria 1058
228 Ga0500568_0003491 3300053139 Bacteria 8736
229 Ga0500616_0018023 3300053153 Bacteria 3996
230 Ga0500622_0007900 3300053156 Bacteria 5989

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10031802 Ga0157375_100318023 186
2 3300005331 Ga0070670_100209782 Ga0070670_1002097822 207
3 3300013296 Ga0157374_10220049 Ga0157374_102200492 207
4 3300005338 Ga0068868_100032509 Ga0068868_1000325092 209
5 3300006358 Ga0068871_100188896 Ga0068871_1001888962 209
6 3300003320 rootH2_10065879 rootH2_1006587910 218
7 3300044658 Ga0466972_0049484 Ga0466972_0049484_408_1118 221
8 3300005841 Ga0068863_100101076 Ga0068863_1001010762 222
9 3300011119 Ga0105246_10330052 Ga0105246_103300522 222
10 3300026088 Ga0207641_10058225 Ga0207641_100582252 222
11 3300013296 Ga0157374_10000002 Ga0157374_10000002654 229
12 3300045049 Ga0466959_0072625 Ga0466959_0072625_1533_2285 233
13 3300005329 Ga0070683_100007488 Ga0070683_1000074885 234
14 3300005535 Ga0070684_100001898 Ga0070684_10000189810 234
15 3300005563 Ga0068855_100000108 Ga0068855_10000010843 234
16 3300005616 Ga0068852_100169150 Ga0068852_1001691502 234
17 3300009093 Ga0105240_10006830 Ga0105240_1000683014 234
18 3300013104 Ga0157370_10212916 Ga0157370_102129162 234
19 3300025913 Ga0207695_10000060 Ga0207695_10000060147 234
20 3300025944 Ga0207661_10052682 Ga0207661_100526822 234
21 3300025949 Ga0207667_10000084 Ga0207667_10000084100 234
22 3300013104 Ga0157370_10177185 Ga0157370_101771851 235
23 3300013105 Ga0157369_10111570 Ga0157369_101115702 235
24 3300003316 rootH1_10165352 rootH1_101653522 236
25 3300003320 rootH2_10101914 rootH2_101019142 236
26 3300003323 rootH1_10048184 rootH1_100481842 236
27 3300026116 Ga0207674_10044908 Ga0207674_100449082 236
28 3300025924 Ga0207694_10051626 Ga0207694_100516262 237
29 3300005367 Ga0070667_100001618 Ga0070667_10000161816 238
30 3300005548 Ga0070665_100000031 Ga0070665_100000031129 238
31 3300005617 Ga0068859_100037556 Ga0068859_1000375562 238
32 3300005843 Ga0068860_100006922 Ga0068860_1000069223 238
33 3300006931 Ga0097620_100037556 Ga0097620_1000375562 238
34 3300013297 Ga0157378_10025171 Ga0157378_100251712 238
35 3300013307 Ga0157372_10123296 Ga0157372_101232962 238
36 3300025986 Ga0207658_10002346 Ga0207658_100023462 238
37 3300028379 Ga0268266_10000088 Ga0268266_1000008822 238
38 3300028381 Ga0268264_10020049 Ga0268264_100200492 238
39 iso_pu_bacteria 2884791551 2884794736 238
40 3300013306 Ga0163162_10000218 Ga0163162_1000021822 240
41 3300028381 Ga0268264_10000484 Ga0268264_1000048442 240
42 3300044693 Ga0466961_0041052 Ga0466961_0041052_1418_2155 240
43 3300045049 Ga0466959_0015406 Ga0466959_0015406_1311_2048 240
44 3300045836 Ga0466958_0120701 Ga0466958_0120701_884_1621 240
45 3300046524 Ga0495648_0000294 Ga0495648_0000294_38244_38993 241
46 3300053092 Ga0500583_0078062 Ga0500583_0078062_154_903 241
47 3300053130 Ga0500642_0159238 Ga0500642_0159238_284_1033 241
48 3300053156 Ga0500622_0007900 Ga0500622_0007900_1994_2743 241
49 3300005336 Ga0070680_100037345 Ga0070680_1000373452 243
50 3300005337 Ga0070682_100001149 Ga0070682_1000011493 243
51 3300005530 Ga0070679_100063520 Ga0070679_1000635201 243
52 3300005563 Ga0068855_100047527 Ga0068855_1000475273 243
53 3300009093 Ga0105240_10003346 Ga0105240_100033462 243
54 3300009174 Ga0105241_10010667 Ga0105241_100106673 243
55 3300009545 Ga0105237_10109406 Ga0105237_101094062 243
56 3300013105 Ga0157369_10730775 Ga0157369_107307752 243
57 3300025911 Ga0207654_10031511 Ga0207654_100315112 243
58 3300025912 Ga0207707_10002253 Ga0207707_100022539 243
59 3300025913 Ga0207695_10021516 Ga0207695_100215166 243
60 3300025921 Ga0207652_10001419 Ga0207652_100014192 243
61 3300025949 Ga0207667_10388988 Ga0207667_103889882 243
62 3300005539 Ga0068853_100056713 Ga0068853_1000567132 244
63 3300009093 Ga0105240_10009947 Ga0105240_100099475 244
64 3300009093 Ga0105240_10023701 Ga0105240_100237013 244
65 3300009545 Ga0105237_10002744 Ga0105237_100027448 244
66 3300009545 Ga0105237_10436678 Ga0105237_104366782 244
67 3300009551 Ga0105238_10189863 Ga0105238_101898631 244
68 3300010375 Ga0105239_10001793 Ga0105239_1000179310 244
69 3300010375 Ga0105239_10084136 Ga0105239_100841362 244
70 3300025208 Ga0209436_101353 Ga0209436_1013537 244
71 3300025284 Ga0209130_1001576 Ga0209130_10015763 244
72 3300025302 Ga0207426_1000034 Ga0207426_1000034341 244
73 3300025913 Ga0207695_10000199 Ga0207695_100001995 244
74 3300025913 Ga0207695_10008789 Ga0207695_100087898 244
75 3300025914 Ga0207671_10003567 Ga0207671_100035677 244
76 3300025924 Ga0207694_10310624 Ga0207694_103106242 244
77 3300026142 Ga0207698_10238174 Ga0207698_102381742 244
78 3300031507 Ga0307509_10210574 Ga0307509_102105742 244
79 3300046648 Ga0495611_0000274 Ga0495611_0000274_1534_2286 244
80 3300048926 Ga0496123_0238434 Ga0496123_0238434_97_855 244
81 3300005456 Ga0070678_100061256 Ga0070678_1000612562 245
82 3300009093 Ga0105240_10010022 Ga0105240_100100225 245
83 3300009545 Ga0105237_10392522 Ga0105237_103925222 245
84 3300025913 Ga0207695_10000077 Ga0207695_100000775 245
85 3300026121 Ga0207683_10056017 Ga0207683_100560172 245
86 3300028786 Ga0307517_10031595 Ga0307517_100315954 245
87 3300030521 Ga0307511_10000114 Ga0307511_1000011445 245
88 3300031251 Ga0265327_10000107 Ga0265327_1000010736 245
89 3300031730 Ga0307516_10002136 Ga0307516_100021363 245
90 3300033180 Ga0307510_10000074 Ga0307510_1000007442 245
91 3300044658 Ga0466972_0000022 Ga0466972_0000022_19663_20421 245
92 3300044765 Ga0466970_0002273 Ga0466970_0002273_1540_2298 245
93 3300046461 Ga0495641_0208140 Ga0495641_0208140_62_802 245
94 3300046507 Ga0495606_0033022 Ga0495606_0033022_1437_2186 245
95 3300053153 Ga0500616_0018023 Ga0500616_0018023_1626_2429 245
96 3300003320 rootH2_10004718 rootH2_1000471813 246
97 3300003320 rootH2_10006598 rootH2_100065989 246
98 3300005327 Ga0070658_10593618 Ga0070658_105936181 246
99 3300005338 Ga0068868_100109279 Ga0068868_1001092792 246
100 3300005339 Ga0070660_100009572 Ga0070660_1000095724 246
101 3300005354 Ga0070675_100076317 Ga0070675_1000763172 246
102 3300005366 Ga0070659_100253312 Ga0070659_1002533121 246
103 3300005367 Ga0070667_100341407 Ga0070667_1003414072 246
104 3300005458 Ga0070681_10789324 Ga0070681_107893241 246
105 3300005539 Ga0068853_100387184 Ga0068853_1003871842 246
106 3300005563 Ga0068855_100048166 Ga0068855_1000481662 246
107 3300005564 Ga0070664_100139172 Ga0070664_1001391722 246
108 3300005614 Ga0068856_100007143 Ga0068856_1000071436 246
109 3300005616 Ga0068852_100147394 Ga0068852_1001473942 246
110 3300005834 Ga0068851_10047071 Ga0068851_100470712 246
111 3300005983 Ga0081540_1005583 Ga0081540_10055834 246
112 3300009545 Ga0105237_10024349 Ga0105237_100243493 246
113 3300010375 Ga0105239_10000168 Ga0105239_1000016829 246
114 3300013100 Ga0157373_10156895 Ga0157373_101568951 246
115 3300013102 Ga0157371_10037861 Ga0157371_100378611 246
116 3300013296 Ga0157374_10038646 Ga0157374_100386462 246
117 3300013297 Ga0157378_10171849 Ga0157378_101718492 246
118 3300013307 Ga0157372_10005802 Ga0157372_100058022 246
119 3300014745 Ga0157377_10075038 Ga0157377_100750382 246
120 3300025904 Ga0207647_10188659 Ga0207647_101886592 246
121 3300025904 Ga0207647_10326691 Ga0207647_103266911 246
122 3300025914 Ga0207671_10042121 Ga0207671_100421212 246
123 3300025917 Ga0207660_10221874 Ga0207660_102218741 246
124 3300025945 Ga0207679_10097871 Ga0207679_100978712 246
125 3300025949 Ga0207667_10032981 Ga0207667_100329813 246
126 3300025981 Ga0207640_10122697 Ga0207640_101226972 246
127 3300026023 Ga0207677_10580424 Ga0207677_105804241 246
128 3300026041 Ga0207639_10111458 Ga0207639_101114582 246
129 3300026078 Ga0207702_10098057 Ga0207702_100980572 246
130 3300026078 Ga0207702_10150924 Ga0207702_101509242 246
131 3300026142 Ga0207698_10250332 Ga0207698_102503322 246
132 3300044735 Ga0466968_0203654 Ga0466968_0203654_61_825 246
133 3300046694 Ga0495649_0015265 Ga0495649_0015265_1869_2633 246
134 iso_pu_bacteria 2818991460 2819681886 246
135 3300003316 rootH1_10043281 rootH1_100432813 247
136 3300003320 rootH2_10089470 rootH2_100894705 247
137 3300003322 rootL2_10079865 rootL2_100798652 247
138 3300003323 rootH1_10001205 rootH1_100012053 247
139 3300003323 rootH1_10262028 rootH1_102620282 247
140 3300005331 Ga0070670_100079611 Ga0070670_1000796111 247
141 3300005334 Ga0068869_100017926 Ga0068869_1000179264 247
142 3300005334 Ga0068869_100449772 Ga0068869_1004497722 247
143 3300005335 Ga0070666_10000024 Ga0070666_1000002416 247
144 3300005335 Ga0070666_10039341 Ga0070666_100393412 247
145 3300005338 Ga0068868_100180660 Ga0068868_1001806601 247
146 3300005339 Ga0070660_100109824 Ga0070660_1001098242 247
147 3300005364 Ga0070673_100208354 Ga0070673_1002083541 247
148 3300005365 Ga0070688_100020505 Ga0070688_1000205052 247
149 3300005367 Ga0070667_100046130 Ga0070667_1000461301 247
150 3300005458 Ga0070681_10091709 Ga0070681_100917092 247
151 3300005539 Ga0068853_100437010 Ga0068853_1004370102 247
152 3300005543 Ga0070672_100105382 Ga0070672_1001053822 247
153 3300005563 Ga0068855_100038236 Ga0068855_1000382363 247
154 3300005577 Ga0068857_100019945 Ga0068857_1000199455 247
155 3300005577 Ga0068857_100119962 Ga0068857_1001199623 247
156 3300005616 Ga0068852_100007910 Ga0068852_1000079102 247
157 3300005616 Ga0068852_100059717 Ga0068852_1000597172 247
158 3300005617 Ga0068859_100000041 Ga0068859_1000000412 247
159 3300005618 Ga0068864_100000924 Ga0068864_10000092419 247
160 3300005834 Ga0068851_10134791 Ga0068851_101347912 247
161 3300005841 Ga0068863_100221231 Ga0068863_1002212312 247
162 3300005843 Ga0068860_100008944 Ga0068860_1000089442 247
163 3300005843 Ga0068860_100180941 Ga0068860_1001809412 247
164 3300006237 Ga0097621_100017594 Ga0097621_1000175943 247
165 3300006358 Ga0068871_100048083 Ga0068871_1000480832 247
166 3300006931 Ga0097620_100000041 Ga0097620_100000041163 247
167 3300009093 Ga0105240_10001182 Ga0105240_1000118225 247
168 3300009093 Ga0105240_10009243 Ga0105240_100092434 247
169 3300009093 Ga0105240_10145739 Ga0105240_101457392 247
170 3300009093 Ga0105240_10187924 Ga0105240_101879242 247
171 3300009101 Ga0105247_10087375 Ga0105247_100873752 247
172 3300009174 Ga0105241_10000459 Ga0105241_100004598 247
173 3300009174 Ga0105241_10066916 Ga0105241_100669162 247
174 3300009176 Ga0105242_10811915 Ga0105242_108119151 247
175 3300009545 Ga0105237_10009102 Ga0105237_100091024 247
176 3300009545 Ga0105237_10019418 Ga0105237_100194183 247
177 3300009545 Ga0105237_10022257 Ga0105237_100222573 247
178 3300009551 Ga0105238_10001407 Ga0105238_1000140715 247
179 3300009551 Ga0105238_10069548 Ga0105238_100695482 247
180 3300009551 Ga0105238_10607293 Ga0105238_106072931 247
181 3300009553 Ga0105249_10011443 Ga0105249_100114433 247
182 3300010375 Ga0105239_10014758 Ga0105239_100147584 247
183 3300010375 Ga0105239_10439570 Ga0105239_104395702 247
184 3300011119 Ga0105246_10027769 Ga0105246_100277692 247
185 3300011119 Ga0105246_10191545 Ga0105246_101915452 247
186 3300013100 Ga0157373_10123231 Ga0157373_101232311 247
187 3300013100 Ga0157373_10136318 Ga0157373_101363182 247
188 3300013102 Ga0157371_10292434 Ga0157371_102924341 247
189 3300013104 Ga0157370_10011877 Ga0157370_100118774 247
190 3300013297 Ga0157378_10545914 Ga0157378_105459141 247
191 3300013307 Ga0157372_10000915 Ga0157372_100009158 247
192 3300013307 Ga0157372_10051869 Ga0157372_100518692 247
193 3300013307 Ga0157372_10092937 Ga0157372_100929372 247
194 3300013308 Ga0157375_10079660 Ga0157375_100796602 247
195 3300014968 Ga0157379_10448023 Ga0157379_104480232 247
196 3300025321 Ga0207656_10100442 Ga0207656_101004422 247
197 3300025903 Ga0207680_10000151 Ga0207680_100001518 247
198 3300025903 Ga0207680_10100336 Ga0207680_101003362 247
199 3300025904 Ga0207647_10041117 Ga0207647_100411172 247
200 3300025911 Ga0207654_10002169 Ga0207654_100021695 247
201 3300025911 Ga0207654_10047246 Ga0207654_100472462 247
202 3300025912 Ga0207707_10037074 Ga0207707_100370742 247
203 3300025913 Ga0207695_10013481 Ga0207695_100134813 247
204 3300025913 Ga0207695_10041896 Ga0207695_100418962 247
205 3300025913 Ga0207695_10043354 Ga0207695_100433542 247
206 3300025913 Ga0207695_10296324 Ga0207695_102963242 247
207 3300025913 Ga0207695_10441911 Ga0207695_104419112 247
208 3300025914 Ga0207671_10001263 Ga0207671_100012634 247
209 3300025914 Ga0207671_10005892 Ga0207671_100058926 247
210 3300025914 Ga0207671_10031265 Ga0207671_100312652 247
211 3300025924 Ga0207694_10002639 Ga0207694_100026393 247
212 3300025940 Ga0207691_10043008 Ga0207691_100430082 247
213 3300025942 Ga0207689_10008095 Ga0207689_100080952 247
214 3300025942 Ga0207689_10302416 Ga0207689_103024162 247
215 3300025949 Ga0207667_10001931 Ga0207667_1000193122 247
216 3300025960 Ga0207651_10089046 Ga0207651_100890462 247
217 3300026023 Ga0207677_10151879 Ga0207677_101518792 247
218 3300026035 Ga0207703_10011268 Ga0207703_100112681 247
219 3300026078 Ga0207702_10629923 Ga0207702_106299232 247
220 3300026088 Ga0207641_10000167 Ga0207641_100001672 247
221 3300026116 Ga0207674_10001616 Ga0207674_100016164 247
222 3300026116 Ga0207674_10095018 Ga0207674_100950184 247
223 3300026142 Ga0207698_10045119 Ga0207698_100451192 247
224 3300028381 Ga0268264_10006048 Ga0268264_100060483 247
225 3300028381 Ga0268264_10149733 Ga0268264_101497332 247
226 3300028794 Ga0307515_10000677 Ga0307515_1000067737 247
227 3300031730 Ga0307516_10270889 Ga0307516_102708892 247
228 3300044658 Ga0466972_0037051 Ga0466972_0037051_1241_1984 247
229 3300046460 Ga0495638_0075015 Ga0495638_0075015_423_1241 247
230 3300047443 Ga0495687_000010 Ga0495687_000010_294836_295582 247
231 3300047472 Ga0495686_0000102 Ga0495686_0000102_70616_71383 247
232 3300053139 Ga0500568_0003491 Ga0500568_0003491_6843_7592 247
233 iso_pu_bacteria 2929177148 2929179601 247
234 iso_pu_bacteria 2945977869 2945982019 247
235 iso_pu_bacteria 2946013367 2946018584 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09697

Porph_ging

Protein of unknown function (Porph_ging)

175

209

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zgn-assembly1.cif.gz_B plant/insect n-glycan active pngase 0.7482 26 226
7zgn-assembly1.cif.gz_A plant/insect n-glycan active pngase 0.735 26 226
4r4x-assembly1.cif.gz_A structure of pngf-ii in c2 space group 0.7103 27 225
4r4z-assembly1.cif.gz_A structure of pngf-ii in p21 space group 0.6993 27 225
4r4z-assembly4.cif.gz_D structure of pngf-ii in p21 space group 0.6864 27 225
ID Description Score Start End Superfamily
af_F8Y416_51_178_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.665 71 127 3.80.10.10
af_A0A1D8PDU5_148_320_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.6283 127 163 3.30.1520.10
af_P21841_89_193_3.30.390.150 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1; 0.5909 98 122 3.30.390.150
af_O02111_53_175_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.5704 72 127 3.80.10.10
2yzyA00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.5568 27 220 2.50.20.10
ID Description Score Start End GO Terms
AF-G8TGM3-F1-model_v4 GLPGLI family protein 0.9476 17 247
AF-A0A142L7G8-F1-model_v4 GLPGLI family protein 0.9442 23 247
AF-A0A4Q3TAB1-F1-model_v4 deleted 0.9422 86 247
AF-A0A317ILP3-F1-model_v4 GLPGLI family protein 0.9414 16 247
AF-A0A1M3IG29-F1-model_v4 GLPGLI family protein 0.9403 15 247

Feature Viewer

pLDDT pTM Quality
87 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map