F346782

General Info

Members Datasets Scaffolds Average Seq Length
234 142 468 157

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100576705|Ga0070680_1005767051
Length 179
Sequence MAKDSGTPAKIKPKRYNPSMQKITPFLWFNGNAEEAVHFYVSIFKNSRIVSISRYGEAGPGPKGSVMSAIFELEGQTFYALNGGPQFTFTPAISLFVNCETQKEVDELWNKLIAGGGSGQRCGWLQDKYGLSWQIIPTVLGKMLQDKDPERSKRVMQAMLQMDKIDIQRLQQAYEMRQK

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
73 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
75 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0
Rhizoplane 1.71
Rhizosphere 94.87
Stem 0
Stem Tuber 0
Unclassified 11.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100576705 3300005336 Bacteria 965
2 Ga0068869_100306288 3300005334 Bacteria 1284
3 Ga0070674_100516281 3300005356 Bacteria 997
4 Ga0070703_10003181 3300005406 Bacteria 4690
5 Ga0070714_100000028 3300005435 Bacteria 139045
6 Ga0070714_100010062 3300005435 Bacteria 7463
7 Ga0070714_100768488 3300005435 Bacteria 932
8 Ga0070713_100362189 3300005436 Bacteria 1347
9 Ga0070713_101482869 3300005436 Bacteria 658
10 Ga0070710_10373646 3300005437 Bacteria 949
11 Ga0070711_100222067 3300005439 Bacteria 1469
12 Ga0070705_100027717 3300005440 Unclassified 3095
13 Ga0070705_100737418 3300005440 Bacteria 777
14 Ga0070694_100932919 3300005444 Unclassified 718
15 Ga0070708_100045828 3300005445 Bacteria 3855
16 Ga0070708_100118588 3300005445 Bacteria 2438
17 Ga0070708_100225666 3300005445 Bacteria 1757
18 Ga0070708_100270383 3300005445 Bacteria 1598
19 Ga0070708_100284242 3300005445 Bacteria 1557
20 Ga0070706_100011551 3300005467 Bacteria 8205
21 Ga0070706_100045515 3300005467 Bacteria 4053
22 Ga0070706_100180471 3300005467 Archaea 1971
23 Ga0070706_100198096 3300005467 Bacteria 1876
24 Ga0070707_100253293 3300005468 Bacteria 1713
25 Ga0070707_100446801 3300005468 Unclassified 1253
26 Ga0070707_100598516 3300005468 Bacteria 1065
27 Ga0070707_101040001 3300005468 Bacteria 784
28 Ga0070698_100008474 3300005471 Bacteria 11104
29 Ga0070698_100088821 3300005471 Bacteria 3075
30 Ga0070699_100058671 3300005518 Bacteria 3334
31 Ga0070699_100102105 3300005518 Bacteria 2514
32 Ga0070699_100109831 3300005518 Bacteria 2421
33 Ga0070699_100418611 3300005518 Bacteria 1212
34 Ga0070699_101177726 3300005518 Bacteria 703
35 Ga0070679_100080675 3300005530 Bacteria 3243
36 Ga0070697_100025045 3300005536 Bacteria 4756
37 Ga0070697_100060111 3300005536 Bacteria 3096
38 Ga0070697_100468720 3300005536 Bacteria 1099
39 Ga0070697_100647485 3300005536 Bacteria 930
40 Ga0070697_100688414 3300005536 Bacteria 902
41 Ga0070695_100002926 3300005545 Bacteria 9941
42 Ga0070695_100277049 3300005545 Unclassified 1231
43 Ga0070696_100002474 3300005546 Bacteria 12245
44 Ga0070696_100416788 3300005546 Bacteria 1053
45 Ga0070696_100529381 3300005546 Bacteria 941
46 Ga0070696_100611462 3300005546 Bacteria 880
47 Ga0070704_100154443 3300005549 Bacteria 1808
48 Ga0070704_100212247 3300005549 Bacteria 1569
49 Ga0068855_100003436 3300005563 Bacteria 19376
50 Ga0068864_100005163 3300005618 Bacteria 10697
51 Ga0068864_100559947 3300005618 Bacteria 1106
52 Ga0068861_100571644 3300005719 Bacteria 1033
53 Ga0068870_10560704 3300005840 Bacteria 770
54 Ga0081540_1015752 3300005983 Bacteria 4770
55 Ga0075363_100499192 3300006048 Bacteria 722
56 Ga0075364_10593141 3300006051 Bacteria 757
57 Ga0070716_100643223 3300006173 Bacteria 803
58 Ga0070712_101006916 3300006175 Unclassified 721
59 Ga0075366_10016641 3300006195 Bacteria 4228
60 Ga0075366_10024752 3300006195 Bacteria 3502
61 Ga0075370_10116961 3300006353 Bacteria 1550
62 Ga0075433_10824202 3300006852 Unclassified 810
63 Ga0075434_100003764 3300006871 Bacteria 13551
64 Ga0075434_100115405 3300006871 Bacteria 2698
65 Ga0075434_100306439 3300006871 Unclassified 1608
66 Ga0075434_100392630 3300006871 Bacteria 1408
67 Ga0075436_100003728 3300006914 Bacteria 10446
68 Ga0075436_100020586 3300006914 Bacteria 4528
69 Ga0075435_100082490 3300007076 Bacteria 2643
70 Ga0075435_100105245 3300007076 Bacteria 2342
71 Ga0075435_100682700 3300007076 Unclassified 892
72 Ga0099794_10003406 3300007265 Bacteria 6057
73 Ga0099794_10213373 3300007265 Bacteria 990
74 Ga0105240_11278413 3300009093 Unclassified 775
75 Ga0111539_11694346 3300009094 Unclassified 733
76 Ga0105237_10498942 3300009545 Bacteria 1224
77 Ga0105238_10480571 3300009551 Bacteria 1242
78 Ga0157373_11229788 3300013100 Unclassified 565
79 Ga0157370_10546912 3300013104 Bacteria 1061
80 Ga0157370_10677306 3300013104 Bacteria 942
81 Ga0157372_10003820 3300013307 Bacteria 16186
82 Ga0157380_10059314 3300014326 Bacteria 3053
83 Ga0207653_10003421 3300025885 Bacteria 5006
84 Ga0207653_10063484 3300025885 Bacteria 1250
85 Ga0207699_10271612 3300025906 Bacteria 1175
86 Ga0207643_10259433 3300025908 Bacteria 1073
87 Ga0207684_10033400 3300025910 Bacteria 4375
88 Ga0207684_10211640 3300025910 Bacteria 1672
89 Ga0207684_10690236 3300025910 Unclassified 868
90 Ga0207671_11352952 3300025914 Bacteria 553
91 Ga0207663_10180012 3300025916 Bacteria 1509
92 Ga0207652_10299880 3300025921 Bacteria 1450
93 Ga0207646_10012041 3300025922 Bacteria 8331
94 Ga0207646_10190724 3300025922 Bacteria 1851
95 Ga0207646_10204136 3300025922 Bacteria 1785
96 Ga0207700_10033904 3300025928 Bacteria 3658
97 Ga0207664_10000095 3300025929 Bacteria 81655
98 Ga0207664_10099075 3300025929 Bacteria 2404
99 Ga0207665_10186558 3300025939 Bacteria 1505
100 Ga0207676_10494706 3300026095 Bacteria 1160
101 Ga0209967_1005737 3300027364 Bacteria 1675
102 Ga0209996_1021023 3300027395 Bacteria 917
103 Ga0210000_1004765 3300027462 Bacteria 1962
104 Ga0209968_1007966 3300027526 Bacteria 1610
105 Ga0209999_1003279 3300027543 Bacteria 2888
106 Ga0209588_1004768 3300027671 Bacteria 3847
107 Ga0209588_1072798 3300027671 Bacteria 1110
108 Ga0209971_1061856 3300027682 Bacteria 906
109 Ga0209966_1088419 3300027695 Bacteria 692
110 Ga0265323_10225860 3300028653 Bacteria 585
111 Ga0265327_10023683 3300031251 Bacteria 3629
112 Ga0307413_10435909 3300031824 Bacteria 1036
113 Ga0307410_10259855 3300031852 Bacteria 1354
114 Ga0307406_10250376 3300031901 Bacteria 1334
115 Ga0307407_10706902 3300031903 Bacteria 760
116 Ga0307412_10810807 3300031911 Bacteria 813
117 Ga0373934_0004260 3300035086 Bacteria 5282
118 Ga0373923_0364273 3300035111 Bacteria 692
119 Ga0373953_0140912 3300035117 Bacteria 1031
120 Ga0373954_0027223 3300035118 Bacteria 2623
121 Ga0373956_0010386 3300035119 Bacteria 3816
122 Ga0373957_0003979 3300035120 Bacteria 4444
123 Ga0373943_0045865 3300035170 Bacteria 2132
124 Ga0373946_0148586 3300035171 Bacteria 1092
125 Ga0373955_0002853 3300035172 Bacteria 7589
126 Ga0373961_0104191 3300035241 Bacteria 922
127 Ga0373924_0256425 3300035410 Bacteria 775
128 Ga0373927_0027160 3300035695 Bacteria 3739
129 Ga0373933_0005266 3300035724 Bacteria 7050
130 Ga0373933_0055407 3300035724 Unclassified 2378
131 Ga0373947_0192353 3300035725 Bacteria 1332
132 Ga0373937_0000944 3300036401 Bacteria 24720
133 Ga0373937_0023061 3300036401 Bacteria 5601
134 Ga0373937_0061514 3300036401 Unclassified 3451
135 Ga0373937_0074383 3300036401 Unclassified 3135
136 Ga0316584_0275849 3300036712 Unclassified 1223
137 Ga0451577_0124028 3300042876 Bacteria 2315
138 Ga0451576_0641870 3300045051 Bacteria 1115
139 Ga0495592_0113455 3300046454 Bacteria 1915
140 Ga0495629_0099440 3300046459 Bacteria 2030
141 Ga0495651_0255043 3300046462 Bacteria 1196
142 Ga0495653_0249893 3300046463 Bacteria 1177
143 Ga0495580_0000255 3300046472 Bacteria 42406
144 Ga0495580_0017569 3300046472 Bacteria 5345
145 Ga0495580_0019963 3300046472 Bacteria 4967
146 Ga0495580_0048901 3300046472 Bacteria 2992
147 Ga0495580_0261604 3300046472 Bacteria 1183
148 Ga0495582_0101376 3300046473 Bacteria 1612
149 Ga0495582_0132100 3300046473 Bacteria 1411
150 Ga0495582_0529329 3300046473 Bacteria 681
151 Ga0495639_0021221 3300046475 Bacteria 2842
152 Ga0495662_0645852 3300046476 Bacteria 517
153 Ga0495664_0009803 3300046477 Bacteria 5369
154 Ga0495664_0226433 3300046477 Unclassified 1132
155 Ga0495594_0213489 3300046499 Bacteria 1100
156 Ga0495594_0413026 3300046499 Bacteria 768
157 Ga0495608_0036363 3300046511 Unclassified 3316
158 Ga0495608_0609933 3300046511 Bacteria 654
159 Ga0495618_0165449 3300046514 Bacteria 1408
160 Ga0495618_0201002 3300046514 Bacteria 1261
161 Ga0495628_0120091 3300046516 Bacteria 2017
162 Ga0495630_0047453 3300046517 Bacteria 3213
163 Ga0495630_0049787 3300046517 Bacteria 3135
164 Ga0495630_1209678 3300046517 Bacteria 571
165 Ga0495630_1273123 3300046517 Bacteria 555
166 Ga0495666_0036919 3300046526 Bacteria 2378
167 Ga0495652_0026063 3300046529 Bacteria 5167
168 Ga0495652_0119284 3300046529 Unclassified 2107
169 Ga0495665_0157144 3300046531 Bacteria 1186
170 Ga0495640_0045465 3300046533 Bacteria 3046
171 Ga0495586_0002463 3300046535 Bacteria 10039
172 Ga0495586_0014899 3300046535 Bacteria 4132
173 Ga0495586_0034843 3300046535 Bacteria 2704
174 Ga0495587_0009238 3300046536 Bacteria 6326
175 Ga0495587_0070253 3300046536 Bacteria 2038
176 Ga0495645_0000922 3300046543 Bacteria 20006
177 Ga0495645_0049516 3300046543 Bacteria 3059
178 Ga0495667_0002386 3300046559 Bacteria 12559
179 Ga0495667_0047628 3300046559 Unclassified 2832
180 Ga0495667_0129070 3300046559 Bacteria 1631
181 Ga0495634_0032098 3300046642 Bacteria 3613
182 Ga0495634_0089481 3300046642 Bacteria 2001
183 Ga0495657_0147830 3300046675 Bacteria 1461
184 Ga0495599_0028472 3300046678 Bacteria 3502
185 Ga0495599_0038851 3300046678 Bacteria 2991
186 Ga0495623_0001707 3300046679 Bacteria 14774
187 Ga0495623_0350606 3300046679 Bacteria 804
188 Ga0495646_0311077 3300046680 Bacteria 831
189 Ga0495647_0001813 3300046681 Bacteria 6610
190 Ga0495647_0100056 3300046681 Bacteria 1200
191 Ga0495658_0008066 3300046683 Bacteria 5215
192 Ga0495658_0087109 3300046683 Bacteria 1844
193 Ga0495613_0073449 3300046689 Bacteria 2492
194 Ga0495613_0111374 3300046689 Unclassified 1972
195 Ga0495613_0364999 3300046689 Bacteria 990
196 Ga0495613_1033995 3300046689 Bacteria 526
197 Ga0495600_0016309 3300046809 Bacteria 4713
198 Ga0495581_0013591 3300047315 Bacteria 4722
199 Ga0495604_0030450 3300047317 Bacteria 4286
200 Ga0495674_0017958 3300047319 Bacteria 6586
201 Ga0495674_0191353 3300047319 Bacteria 1700
202 Ga0495676_0043833 3300047321 Bacteria 3657
203 Ga0495676_0300413 3300047321 Bacteria 1083
204 Ga0495680_0050034 3300047322 Bacteria 3269
205 Ga0495680_0233598 3300047322 Bacteria 1308
206 Ga0495675_0006776 3300047444 Bacteria 7028
207 Ga0495675_0022609 3300047444 Bacteria 4009
208 Ga0495684_0020769 3300047471 Bacteria 5059
209 Ga0495684_0161006 3300047471 Bacteria 1674
210 Ga0495684_0251413 3300047471 Bacteria 1286
211 Ga0495593_0213811 3300047673 Bacteria 968
212 Ga0495602_0155925 3300048088 Unclassified 1788
213 Ga0495614_0470490 3300048089 Bacteria 596
214 Ga0496104_0374238 3300048907 Bacteria 1337
215 Ga0496104_1152343 3300048907 Unclassified 679
216 Ga0496112_0072125 3300048915 Bacteria 3413
217 Ga0496113_0138622 3300048916 Bacteria 1913
218 nmdc:mga06z11_166756_c1 3300050494 Bacteria 1262
219 nmdc:mga07m45_350725_c1 3300050496 Bacteria 857
220 nmdc:mga08y16_1032915_c1 3300050511 Bacteria 800
221 nmdc:mga0n895_1001598_c1 3300050512 Unclassified 817
222 nmdc:mga0n895_102992_c1 3300050512 Bacteria 2866
223 nmdc:mga0n895_139944_c1 3300050512 Unclassified 2448
224 nmdc:mga0n895_32169_c1 3300050512 Bacteria 5033
225 nmdc:mga0rr50_1119737_c1 3300050513 Unclassified 670
226 nmdc:mga0rr50_288866_c1 3300050513 Bacteria 1370
227 nmdc:mga0rr50_75759_c1 3300050513 Bacteria 2580
228 nmdc:mga08x19_43718_c1 3300050514 Bacteria 2858
229 nmdc:mga08x19_4683_c1 3300050514 Bacteria 8112
230 nmdc:mga0a205_1100250_c1 3300050515 Unclassified 642
231 nmdc:mga0a205_230877_c1 3300050515 Bacteria 1733
232 nmdc:mga0a205_619384_c1 3300050515 Bacteria 935
233 Ga0500645_006243 3300053730 Bacteria 4276
234 Ga0501084_0413484 3300054114 Unclassified 1140
235 Ga0070680_100576705
236 Ga0068869_100306288
237 Ga0070674_100516281
238 Ga0070703_10003181
239 Ga0070714_100000028
240 Ga0070714_100010062
241 Ga0070714_100768488
242 Ga0070713_100362189
243 Ga0070713_101482869
244 Ga0070710_10373646
245 Ga0070711_100222067
246 Ga0070705_100027717
247 Ga0070705_100737418
248 Ga0070694_100932919
249 Ga0070708_100045828
250 Ga0070708_100118588
251 Ga0070708_100225666
252 Ga0070708_100270383
253 Ga0070708_100284242
254 Ga0070706_100011551
255 Ga0070706_100045515
256 Ga0070706_100180471
257 Ga0070706_100198096
258 Ga0070707_100253293
259 Ga0070707_100446801
260 Ga0070707_100598516
261 Ga0070707_101040001
262 Ga0070698_100008474
263 Ga0070698_100088821
264 Ga0070699_100058671
265 Ga0070699_100102105
266 Ga0070699_100109831
267 Ga0070699_100418611
268 Ga0070699_101177726
269 Ga0070679_100080675
270 Ga0070697_100025045
271 Ga0070697_100060111
272 Ga0070697_100468720
273 Ga0070697_100647485
274 Ga0070697_100688414
275 Ga0070695_100002926
276 Ga0070695_100277049
277 Ga0070696_100002474
278 Ga0070696_100416788
279 Ga0070696_100529381
280 Ga0070696_100611462
281 Ga0070704_100154443
282 Ga0070704_100212247
283 Ga0068855_100003436
284 Ga0068864_100005163
285 Ga0068864_100559947
286 Ga0068861_100571644
287 Ga0068870_10560704
288 Ga0081540_1015752
289 Ga0075363_100499192
290 Ga0075364_10593141
291 Ga0070716_100643223
292 Ga0070712_101006916
293 Ga0075366_10016641
294 Ga0075366_10024752
295 Ga0075370_10116961
296 Ga0075433_10824202
297 Ga0075434_100003764
298 Ga0075434_100115405
299 Ga0075434_100306439
300 Ga0075434_100392630
301 Ga0075436_100003728
302 Ga0075436_100020586
303 Ga0075435_100082490
304 Ga0075435_100105245
305 Ga0075435_100682700
306 Ga0099794_10003406
307 Ga0099794_10213373
308 Ga0105240_11278413
309 Ga0111539_11694346
310 Ga0105237_10498942
311 Ga0105238_10480571
312 Ga0157373_11229788
313 Ga0157370_10546912
314 Ga0157370_10677306
315 Ga0157372_10003820
316 Ga0157380_10059314
317 Ga0207653_10003421
318 Ga0207653_10063484
319 Ga0207699_10271612
320 Ga0207643_10259433
321 Ga0207684_10033400
322 Ga0207684_10211640
323 Ga0207684_10690236
324 Ga0207671_11352952
325 Ga0207663_10180012
326 Ga0207652_10299880
327 Ga0207646_10012041
328 Ga0207646_10190724
329 Ga0207646_10204136
330 Ga0207700_10033904
331 Ga0207664_10000095
332 Ga0207664_10099075
333 Ga0207665_10186558
334 Ga0207676_10494706
335 Ga0209967_1005737
336 Ga0209996_1021023
337 Ga0210000_1004765
338 Ga0209968_1007966
339 Ga0209999_1003279
340 Ga0209588_1004768
341 Ga0209588_1072798
342 Ga0209971_1061856
343 Ga0209966_1088419
344 Ga0265323_10225860
345 Ga0265327_10023683
346 Ga0307413_10435909
347 Ga0307410_10259855
348 Ga0307406_10250376
349 Ga0307407_10706902
350 Ga0307412_10810807
351 Ga0373934_0004260
352 Ga0373923_0364273
353 Ga0373953_0140912
354 Ga0373954_0027223
355 Ga0373956_0010386
356 Ga0373957_0003979
357 Ga0373943_0045865
358 Ga0373946_0148586
359 Ga0373955_0002853
360 Ga0373961_0104191
361 Ga0373924_0256425
362 Ga0373927_0027160
363 Ga0373933_0005266
364 Ga0373933_0055407
365 Ga0373947_0192353
366 Ga0373937_0000944
367 Ga0373937_0023061
368 Ga0373937_0061514
369 Ga0373937_0074383
370 Ga0316584_0275849
371 Ga0451577_0124028
372 Ga0451576_0641870
373 Ga0495592_0113455
374 Ga0495629_0099440
375 Ga0495651_0255043
376 Ga0495653_0249893
377 Ga0495580_0000255
378 Ga0495580_0017569
379 Ga0495580_0019963
380 Ga0495580_0048901
381 Ga0495580_0261604
382 Ga0495582_0101376
383 Ga0495582_0132100
384 Ga0495582_0529329
385 Ga0495639_0021221
386 Ga0495662_0645852
387 Ga0495664_0009803
388 Ga0495664_0226433
389 Ga0495594_0213489
390 Ga0495594_0413026
391 Ga0495608_0036363
392 Ga0495608_0609933
393 Ga0495618_0165449
394 Ga0495618_0201002
395 Ga0495628_0120091
396 Ga0495630_0047453
397 Ga0495630_0049787
398 Ga0495630_1209678
399 Ga0495630_1273123
400 Ga0495666_0036919
401 Ga0495652_0026063
402 Ga0495652_0119284
403 Ga0495665_0157144
404 Ga0495640_0045465
405 Ga0495586_0002463
406 Ga0495586_0014899
407 Ga0495586_0034843
408 Ga0495587_0009238
409 Ga0495587_0070253
410 Ga0495645_0000922
411 Ga0495645_0049516
412 Ga0495667_0002386
413 Ga0495667_0047628
414 Ga0495667_0129070
415 Ga0495634_0032098
416 Ga0495634_0089481
417 Ga0495657_0147830
418 Ga0495599_0028472
419 Ga0495599_0038851
420 Ga0495623_0001707
421 Ga0495623_0350606
422 Ga0495646_0311077
423 Ga0495647_0001813
424 Ga0495647_0100056
425 Ga0495658_0008066
426 Ga0495658_0087109
427 Ga0495613_0073449
428 Ga0495613_0111374
429 Ga0495613_0364999
430 Ga0495613_1033995
431 Ga0495600_0016309
432 Ga0495581_0013591
433 Ga0495604_0030450
434 Ga0495674_0017958
435 Ga0495674_0191353
436 Ga0495676_0043833
437 Ga0495676_0300413
438 Ga0495680_0050034
439 Ga0495680_0233598
440 Ga0495675_0006776
441 Ga0495675_0022609
442 Ga0495684_0020769
443 Ga0495684_0161006
444 Ga0495684_0251413
445 Ga0495593_0213811
446 Ga0495602_0155925
447 Ga0495614_0470490
448 Ga0496104_0374238
449 Ga0496104_1152343
450 Ga0496112_0072125
451 Ga0496113_0138622
452 nmdc:mga06z11_166756_c1
453 nmdc:mga07m45_350725_c1
454 nmdc:mga08y16_1032915_c1
455 nmdc:mga0n895_1001598_c1
456 nmdc:mga0n895_102992_c1
457 nmdc:mga0n895_139944_c1
458 nmdc:mga0n895_32169_c1
459 nmdc:mga0rr50_1119737_c1
460 nmdc:mga0rr50_288866_c1
461 nmdc:mga0rr50_75759_c1
462 nmdc:mga08x19_43718_c1
463 nmdc:mga08x19_4683_c1
464 nmdc:mga0a205_1100250_c1
465 nmdc:mga0a205_230877_c1
466 nmdc:mga0a205_619384_c1
467 Ga0500645_006243
468 Ga0501084_0413484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

21

136

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9302 2 154
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9291 2 154
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9231 2 154
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9182 2 154
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.917 2 154
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9245 2 154 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9122 2 154 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8601 69 117 3.30.720.110
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8576 7 70 3.30.720.100
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8335 7 70 3.30.720.100
ID Description Score Start End GO Terms
AF-A0A537CIB8-F1-model_v4 VOC family protein 1.005 82 156
AF-A0A1H7K5H5-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 1.001 87 154 GO:0008168
GO:0032259
AF-A0A4V1SQP6-F1-model_v4 VOC family protein 0.9971 100 155
AF-I7ZHF7-F1-model_v4 Putative 3-demethylubiquinone-93-methyltransferase protein 0.9918 100 156 GO:0008168
GO:0032259
AF-A0A7Y2AEA9-F1-model_v4 VOC family protein 0.9914 85 158

Map