F344125

General Info

Members Datasets Scaffolds Average Seq Length
231 152 462 237

Family's Representative Sequence

Representative Sequence 3300025934|Ga0207686_10246080|Ga0207686_102460801
Length 259
Sequence LRGAEHRSPHNPVQEFNLYIRSMKSQIFRRSERGIKDIGWLKSNFYFSFSDYYNPVKSAFGTLVAFNDDFVEPGKGFGIHPHVNMEIISVLLQGKMNHIDTLGYKTVIEEGGVQIMSAGSGLKHEEYNIGEDEVNFLQIWIQPKLQDINPRYQQRSFPKEKRINELKTIISGEEGLEHCWINQNAKLSLGYFDTAQEVNYTFRSVNKCLFIFLIEGRIRVDGTDLDPRDAIGVWETDSVPVHCEAGCHFLVIETPINQK

Samples

Sample ID Description Type Environment
1 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
132 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
141 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
142 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
143 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
144 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
145 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
146 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
147 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
148 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
149 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
150 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
151 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
152 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.37
Metatranscriptomes 3.46
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 0
Rhizoplane 1.3
Rhizosphere 87.88
Stem 0
Stem Tuber 0
Unclassified 8.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207686_10246080 3300025934 Unclassified 1304
2 rootH1_10042967 3300003316 Bacteria 3883
3 rootH2_10026300 3300003320 Bacteria 12440
4 rootH2_10121457 3300003320 Unclassified 2574
5 rootL2_10169512 3300003322 Bacteria 1273
6 rootL2_10180681 3300003322 Unclassified 4087
7 rootH1_10018160 3300003323 Bacteria 5984
8 JGI25160J50197_1002387 3300003354 Bacteria 8759
9 Ga0070658_10106151 3300005327 Bacteria 2324
10 Ga0070658_10262639 3300005327 Bacteria 1466
11 Ga0070676_10005220 3300005328 Bacteria 6904
12 Ga0070683_100005156 3300005329 Bacteria 10867
13 Ga0070670_100185518 3300005331 Bacteria 1806
14 Ga0070666_10002813 3300005335 Bacteria 10507
15 Ga0070666_10010845 3300005335 Bacteria 5709
16 Ga0070666_10046053 3300005335 Bacteria 2925
17 Ga0070666_10173338 3300005335 Bacteria 1511
18 Ga0068868_100003238 3300005338 Bacteria 11326
19 Ga0068868_100061281 3300005338 Bacteria 2980
20 Ga0070660_100007576 3300005339 Bacteria 7564
21 Ga0070668_100248269 3300005347 Bacteria 1476
22 Ga0070675_100700743 3300005354 Bacteria 922
23 Ga0070673_100014191 3300005364 Bacteria 5538
24 Ga0070659_100036996 3300005366 Bacteria 3804
25 Ga0070667_100007884 3300005367 Bacteria 8836
26 Ga0070662_100011727 3300005457 Bacteria 5787
27 Ga0070662_100030168 3300005457 Bacteria 3791
28 Ga0070681_10291826 3300005458 Bacteria 1541
29 Ga0068867_100022102 3300005459 Bacteria 4545
30 Ga0070679_100017560 3300005530 Bacteria 6924
31 Ga0070684_100007607 3300005535 Bacteria 8443
32 Ga0068853_100011374 3300005539 Bacteria 7226
33 Ga0068853_100064667 3300005539 Bacteria 3173
34 Ga0070672_100021491 3300005543 Bacteria 4723
35 Ga0070665_100000052 3300005548 Bacteria 245694
36 Ga0070665_100003758 3300005548 Bacteria 16072
37 Ga0068855_100003465 3300005563 Bacteria 19312
38 Ga0068855_100049159 3300005563 Bacteria 4975
39 Ga0070664_100011337 3300005564 Bacteria 7233
40 Ga0070664_100532537 3300005564 Bacteria 1085
41 Ga0068857_100002243 3300005577 Bacteria 15733
42 Ga0068854_100226698 3300005578 Bacteria 1481
43 Ga0068854_100620345 3300005578 Bacteria 925
44 Ga0068856_100039281 3300005614 Bacteria 4646
45 Ga0068856_100596557 3300005614 Unclassified 1126
46 Ga0068852_100043813 3300005616 Bacteria 3797
47 Ga0068852_100076765 3300005616 Bacteria 2951
48 Ga0068852_100158355 3300005616 Bacteria 2112
49 Ga0068864_100015606 3300005618 Bacteria 6318
50 Ga0068861_100640026 3300005719 Bacteria 981
51 Ga0068851_10004223 3300005834 Bacteria 6464
52 Ga0068863_100146038 3300005841 Bacteria 2262
53 Ga0068863_100687319 3300005841 Bacteria 1016
54 Ga0068858_100012923 3300005842 Bacteria 7872
55 Ga0068860_100000053 3300005843 Bacteria 207331
56 Ga0068860_100004932 3300005843 Bacteria 13601
57 Ga0068860_100120810 3300005843 Bacteria 2508
58 Ga0075366_10058940 3300006195 Bacteria 2281
59 Ga0097621_100051124 3300006237 Bacteria 3362
60 Ga0097621_100070760 3300006237 Bacteria 2881
61 Ga0097621_100207956 3300006237 Bacteria 1701
62 Ga0097621_100307305 3300006237 Bacteria 1402
63 Ga0068865_100023192 3300006881 Bacteria 4061
64 Ga0105240_10002005 3300009093 Bacteria 33578
65 Ga0105240_10012897 3300009093 Bacteria 11510
66 Ga0105240_10020613 3300009093 Bacteria 8788
67 Ga0105240_10143192 3300009093 Bacteria 2856
68 Ga0105240_10280281 3300009093 Bacteria 1915
69 Ga0111539_10411783 3300009094 Bacteria 1574
70 Ga0105247_10014926 3300009101 Bacteria 4655
71 Ga0105241_10000197 3300009174 Bacteria 45395
72 Ga0105241_10420363 3300009174 Bacteria 1176
73 Ga0105241_10517448 3300009174 Bacteria 1066
74 Ga0105242_10144459 3300009176 Bacteria 2068
75 Ga0105242_10221762 3300009176 Unclassified 1690
76 Ga0105237_10001923 3300009545 Bacteria 26509
77 Ga0105237_10002032 3300009545 Bacteria 25723
78 Ga0105237_10002804 3300009545 Bacteria 21167
79 Ga0105237_10903399 3300009545 Bacteria 890
80 Ga0105238_10003233 3300009551 Bacteria 16278
81 Ga0105238_10064373 3300009551 Bacteria 3666
82 Ga0105239_10005354 3300010375 Bacteria 15062
83 Ga0105239_10195595 3300010375 Unclassified 2264
84 Ga0105239_10433641 3300010375 Bacteria 1490
85 Ga0105239_10521075 3300010375 Unclassified 1352
86 Ga0105239_10672828 3300010375 Bacteria 1183
87 Ga0105246_10207297 3300011119 Bacteria 1528
88 Ga0157373_10003287 3300013100 Bacteria 12208
89 Ga0157371_10039037 3300013102 Bacteria 3396
90 Ga0157371_10175276 3300013102 Unclassified 1533
91 Ga0157370_10005157 3300013104 Bacteria 14730
92 Ga0157370_10125064 3300013104 Bacteria 2400
93 Ga0157369_10002663 3300013105 Bacteria 21313
94 Ga0157369_10015191 3300013105 Bacteria 8690
95 Ga0157374_10007573 3300013296 Bacteria 9266
96 Ga0157374_10020121 3300013296 Bacteria 5917
97 Ga0157374_10025745 3300013296 Bacteria 5286
98 Ga0157378_10037661 3300013297 Bacteria 4285
99 Ga0157378_10088874 3300013297 Bacteria 2804
100 Ga0157378_10269132 3300013297 Unclassified 1638
101 Ga0163162_10002155 3300013306 Bacteria 18467
102 Ga0163162_10003171 3300013306 Bacteria 15717
103 Ga0163162_10014721 3300013306 Bacteria 7645
104 Ga0163162_10064797 3300013306 Bacteria 3699
105 Ga0163162_10350164 3300013306 Bacteria 1610
106 Ga0157372_10003673 3300013307 Bacteria 16500
107 Ga0157372_10081659 3300013307 Bacteria 3659
108 Ga0157372_10084043 3300013307 Bacteria 3607
109 Ga0157372_10090445 3300013307 Unclassified 3480
110 Ga0157372_10101934 3300013307 Bacteria 3278
111 Ga0157372_10369811 3300013307 Bacteria 1670
112 Ga0157372_10652846 3300013307 Bacteria 1225
113 Ga0157375_10020657 3300013308 Bacteria 6020
114 Ga0163163_10016635 3300014325 Bacteria 6838
115 Ga0157380_10626455 3300014326 Bacteria 1069
116 Ga0182008_10005884 3300014497 Bacteria 6929
117 Ga0157379_10010505 3300014968 Bacteria 8071
118 Ga0157376_10035390 3300014969 Bacteria 4039
119 Ga0157376_10091018 3300014969 Bacteria 2641
120 Ga0182007_10004566 3300015262 Bacteria 6257
121 Ga0163161_10014336 3300017792 Bacteria 5517
122 Ga0224712_10025343 3300022467 Bacteria 2084
123 Ga0209436_100536 3300025208 Bacteria 16457
124 Ga0209646_1003708 3300025246 Bacteria 2943
125 Ga0209130_1001680 3300025284 Bacteria 13477
126 Ga0207426_1000051 3300025302 Bacteria 391700
127 Ga0207426_1000052 3300025302 Bacteria 389825
128 Ga0207680_10032216 3300025903 Bacteria 2978
129 Ga0207647_10017649 3300025904 Bacteria 4849
130 Ga0207647_10305387 3300025904 Bacteria 906
131 Ga0207705_10359451 3300025909 Bacteria 1123
132 Ga0207654_10002209 3300025911 Bacteria 9978
133 Ga0207654_10222750 3300025911 Bacteria 1252
134 Ga0207654_10257555 3300025911 Bacteria 1172
135 Ga0207707_10242486 3300025912 Bacteria 1567
136 Ga0207695_10001662 3300025913 Bacteria 35831
137 Ga0207695_10019636 3300025913 Bacteria 7776
138 Ga0207671_10002703 3300025914 Bacteria 18595
139 Ga0207671_10011170 3300025914 Bacteria 7333
140 Ga0207671_10017778 3300025914 Bacteria 5472
141 Ga0207657_10000872 3300025919 Bacteria 31816
142 Ga0207649_10465670 3300025920 Bacteria 956
143 Ga0207652_10031916 3300025921 Bacteria 4424
144 Ga0207694_10105992 3300025924 Bacteria 2232
145 Ga0207694_10122285 3300025924 Bacteria 2079
146 Ga0207659_10032070 3300025926 Bacteria 3602
147 Ga0207706_10030035 3300025933 Bacteria 4850
148 Ga0207686_10066730 3300025934 Bacteria 2299
149 Ga0207691_10002896 3300025940 Bacteria 16734
150 Ga0207689_10078780 3300025942 Bacteria 2708
151 Ga0207667_10014403 3300025949 Bacteria 9019
152 Ga0207667_10069892 3300025949 Bacteria 3655
153 Ga0207667_10138513 3300025949 Bacteria 2506
154 Ga0207651_10034372 3300025960 Bacteria 3282
155 Ga0207677_10008788 3300026023 Bacteria 5659
156 Ga0207703_10079160 3300026035 Bacteria 2733
157 Ga0207639_10347373 3300026041 Bacteria 1324
158 Ga0207641_10021804 3300026088 Bacteria 5266
159 Ga0207641_10660811 3300026088 Bacteria 1027
160 Ga0207648_10041834 3300026089 Bacteria 4024
161 Ga0207676_10061392 3300026095 Bacteria 2976
162 Ga0207674_10008121 3300026116 Bacteria 12167
163 Ga0207674_10058017 3300026116 Bacteria 3923
164 Ga0207675_100617920 3300026118 Bacteria 1088
165 Ga0207698_10014627 3300026142 Bacteria 5224
166 Ga0207698_10022375 3300026142 Bacteria 4391
167 Ga0207698_10380422 3300026142 Bacteria 1343
168 Ga0268266_10000070 3300028379 Bacteria 235423
169 Ga0268264_10000098 3300028381 Bacteria 229055
170 Ga0268264_10006718 3300028381 Bacteria 9669
171 Ga0268264_10012030 3300028381 Bacteria 7124
172 Ga0268264_10269719 3300028381 Bacteria 1589
173 Ga0268264_11053535 3300028381 Bacteria 821
174 Ga0307511_10000046 3300030521 Bacteria 100284
175 Ga0265327_10000146 3300031251 Bacteria 154436
176 Ga0307408_100000283 3300031548 Bacteria 50603
177 Ga0307408_100002395 3300031548 Bacteria 13219
178 Ga0307516_10054653 3300031730 Bacteria 3901
179 Ga0307412_10000519 3300031911 Bacteria 23013
180 Ga0373955_0063710 3300035172 Bacteria 2042
181 Ga0395899_0229686 3300037312 Bacteria 1282
182 Ga0395900_0364522 3300037418 Bacteria 1416
183 Ga0395905_0241502 3300037471 Bacteria 1688
184 Ga0436363_1084191 3300039450 Bacteria 942
185 Ga0439433_0044914 3300041999 Bacteria 1033
186 Ga0439449_0034139 3300042007 Bacteria 1894
187 Ga0439457_002577 3300042014 Bacteria 5133
188 Ga0439462_0034281 3300042015 Bacteria 1347
189 Ga0439434_0106606 3300042435 Bacteria 906
190 Ga0466972_0000069 3300044658 Bacteria 100746
191 Ga0466972_0000919 3300044658 Bacteria 14175
192 Ga0466970_0003390 3300044765 Bacteria 7759
193 Ga0466957_0001781 3300044842 Bacteria 11334
194 Ga0466957_0011956 3300044842 Bacteria 5018
195 Ga0466959_0010949 3300045049 Bacteria 6508
196 Ga0495580_0043647 3300046472 Bacteria 3191
197 Ga0495664_0216491 3300046477 Unclassified 1160
198 Ga0495618_0447110 3300046514 Unclassified 785
199 Ga0495648_0002512 3300046524 Bacteria 16839
200 Ga0495587_0195106 3300046536 Unclassified 1146
201 Ga0495645_0096408 3300046543 Unclassified 2108
202 Ga0495625_0326343 3300046660 Bacteria 976
203 Ga0495625_0334127 3300046660 Bacteria 962
204 Ga0495672_0070569 3300047320 Unclassified 1979
205 Ga0495687_000006 3300047443 Bacteria 571936
206 Ga0495684_0179920 3300047471 Unclassified 1568
207 Ga0496105_0527615 3300048908 Bacteria 924
208 Ga0496105_0566476 3300048908 Bacteria 885
209 Ga0496115_0148841 3300048918 Unclassified 1932
210 Ga0496120_0237968 3300048923 Bacteria 861
211 Ga0501306_005421 3300049127 Bacteria 1462
212 Ga0501310_005416 3300049130 Bacteria 1309
213 Ga0501305_036125 3300049161 Bacteria 789
214 Ga0501307_006333 3300049162 Bacteria 1275
215 Ga0501312_008324 3300049528 Bacteria 1345
216 Ga0501315_006406 3300049531 Bacteria 1308
217 Ga0501316_003880 3300049532 Bacteria 1477
218 Ga0501047_0009388 3300049581 Bacteria 9239
219 Ga0501202_001249 3300049652 Bacteria 4020
220 Ga0501257_035901 3300049686 Bacteria 1206
221 Ga0501225_0001791 3300049705 Bacteria 6722
222 Ga0500583_0005775 3300053092 Bacteria 4186
223 Ga0500642_0016588 3300053130 Unclassified 2803
224 Ga0500568_0027337 3300053139 Unclassified 2386
225 Ga0500622_0011595 3300053156 Bacteria 4795
226 Ga0500637_0035535 3300053178 Bacteria 2794
227 2819682342 2818991460 Bacteria 7595395
228 2884795355 2884791551 Bacteria 8511252
229 2929179099 2929177148 Bacteria 7883697
230 2945981499 2945977869 Bacteria 7777518
231 2946019094 2946013367 Bacteria 7766675
232 Ga0207686_10246080
233 rootH1_10042967
234 rootH2_10026300
235 rootH2_10121457
236 rootL2_10169512
237 rootL2_10180681
238 rootH1_10018160
239 JGI25160J50197_1002387
240 Ga0070658_10106151
241 Ga0070658_10262639
242 Ga0070676_10005220
243 Ga0070683_100005156
244 Ga0070670_100185518
245 Ga0070666_10002813
246 Ga0070666_10010845
247 Ga0070666_10046053
248 Ga0070666_10173338
249 Ga0068868_100003238
250 Ga0068868_100061281
251 Ga0070660_100007576
252 Ga0070668_100248269
253 Ga0070675_100700743
254 Ga0070673_100014191
255 Ga0070659_100036996
256 Ga0070667_100007884
257 Ga0070662_100011727
258 Ga0070662_100030168
259 Ga0070681_10291826
260 Ga0068867_100022102
261 Ga0070679_100017560
262 Ga0070684_100007607
263 Ga0068853_100011374
264 Ga0068853_100064667
265 Ga0070672_100021491
266 Ga0070665_100000052
267 Ga0070665_100003758
268 Ga0068855_100003465
269 Ga0068855_100049159
270 Ga0070664_100011337
271 Ga0070664_100532537
272 Ga0068857_100002243
273 Ga0068854_100226698
274 Ga0068854_100620345
275 Ga0068856_100039281
276 Ga0068856_100596557
277 Ga0068852_100043813
278 Ga0068852_100076765
279 Ga0068852_100158355
280 Ga0068864_100015606
281 Ga0068861_100640026
282 Ga0068851_10004223
283 Ga0068863_100146038
284 Ga0068863_100687319
285 Ga0068858_100012923
286 Ga0068860_100000053
287 Ga0068860_100004932
288 Ga0068860_100120810
289 Ga0075366_10058940
290 Ga0097621_100051124
291 Ga0097621_100070760
292 Ga0097621_100207956
293 Ga0097621_100307305
294 Ga0068865_100023192
295 Ga0105240_10002005
296 Ga0105240_10012897
297 Ga0105240_10020613
298 Ga0105240_10143192
299 Ga0105240_10280281
300 Ga0111539_10411783
301 Ga0105247_10014926
302 Ga0105241_10000197
303 Ga0105241_10420363
304 Ga0105241_10517448
305 Ga0105242_10144459
306 Ga0105242_10221762
307 Ga0105237_10001923
308 Ga0105237_10002032
309 Ga0105237_10002804
310 Ga0105237_10903399
311 Ga0105238_10003233
312 Ga0105238_10064373
313 Ga0105239_10005354
314 Ga0105239_10195595
315 Ga0105239_10433641
316 Ga0105239_10521075
317 Ga0105239_10672828
318 Ga0105246_10207297
319 Ga0157373_10003287
320 Ga0157371_10039037
321 Ga0157371_10175276
322 Ga0157370_10005157
323 Ga0157370_10125064
324 Ga0157369_10002663
325 Ga0157369_10015191
326 Ga0157374_10007573
327 Ga0157374_10020121
328 Ga0157374_10025745
329 Ga0157378_10037661
330 Ga0157378_10088874
331 Ga0157378_10269132
332 Ga0163162_10002155
333 Ga0163162_10003171
334 Ga0163162_10014721
335 Ga0163162_10064797
336 Ga0163162_10350164
337 Ga0157372_10003673
338 Ga0157372_10081659
339 Ga0157372_10084043
340 Ga0157372_10090445
341 Ga0157372_10101934
342 Ga0157372_10369811
343 Ga0157372_10652846
344 Ga0157375_10020657
345 Ga0163163_10016635
346 Ga0157380_10626455
347 Ga0182008_10005884
348 Ga0157379_10010505
349 Ga0157376_10035390
350 Ga0157376_10091018
351 Ga0182007_10004566
352 Ga0163161_10014336
353 Ga0224712_10025343
354 Ga0209436_100536
355 Ga0209646_1003708
356 Ga0209130_1001680
357 Ga0207426_1000051
358 Ga0207426_1000052
359 Ga0207680_10032216
360 Ga0207647_10017649
361 Ga0207647_10305387
362 Ga0207705_10359451
363 Ga0207654_10002209
364 Ga0207654_10222750
365 Ga0207654_10257555
366 Ga0207707_10242486
367 Ga0207695_10001662
368 Ga0207695_10019636
369 Ga0207671_10002703
370 Ga0207671_10011170
371 Ga0207671_10017778
372 Ga0207657_10000872
373 Ga0207649_10465670
374 Ga0207652_10031916
375 Ga0207694_10105992
376 Ga0207694_10122285
377 Ga0207659_10032070
378 Ga0207706_10030035
379 Ga0207686_10066730
380 Ga0207691_10002896
381 Ga0207689_10078780
382 Ga0207667_10014403
383 Ga0207667_10069892
384 Ga0207667_10138513
385 Ga0207651_10034372
386 Ga0207677_10008788
387 Ga0207703_10079160
388 Ga0207639_10347373
389 Ga0207641_10021804
390 Ga0207641_10660811
391 Ga0207648_10041834
392 Ga0207676_10061392
393 Ga0207674_10008121
394 Ga0207674_10058017
395 Ga0207675_100617920
396 Ga0207698_10014627
397 Ga0207698_10022375
398 Ga0207698_10380422
399 Ga0268266_10000070
400 Ga0268264_10000098
401 Ga0268264_10006718
402 Ga0268264_10012030
403 Ga0268264_10269719
404 Ga0268264_11053535
405 Ga0307511_10000046
406 Ga0265327_10000146
407 Ga0307408_100000283
408 Ga0307408_100002395
409 Ga0307516_10054653
410 Ga0307412_10000519
411 Ga0373955_0063710
412 Ga0395899_0229686
413 Ga0395900_0364522
414 Ga0395905_0241502
415 Ga0436363_1084191
416 Ga0439433_0044914
417 Ga0439449_0034139
418 Ga0439457_002577
419 Ga0439462_0034281
420 Ga0439434_0106606
421 Ga0466972_0000069
422 Ga0466972_0000919
423 Ga0466970_0003390
424 Ga0466957_0001781
425 Ga0466957_0011956
426 Ga0466959_0010949
427 Ga0495580_0043647
428 Ga0495664_0216491
429 Ga0495618_0447110
430 Ga0495648_0002512
431 Ga0495587_0195106
432 Ga0495645_0096408
433 Ga0495625_0326343
434 Ga0495625_0334127
435 Ga0495672_0070569
436 Ga0495687_000006
437 Ga0495684_0179920
438 Ga0496105_0527615
439 Ga0496105_0566476
440 Ga0496115_0148841
441 Ga0496120_0237968
442 Ga0501306_005421
443 Ga0501310_005416
444 Ga0501305_036125
445 Ga0501307_006333
446 Ga0501312_008324
447 Ga0501315_006406
448 Ga0501316_003880
449 Ga0501047_0009388
450 Ga0501202_001249
451 Ga0501257_035901
452 Ga0501225_0001791
453 Ga0500583_0005775
454 Ga0500642_0016588
455 Ga0500568_0027337
456 Ga0500622_0011595
457 Ga0500637_0035535
458 2819682342
459 2884795355
460 2929179099
461 2945981499
462 2946019094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02678

Pirin

Pirin

28

141

0.94

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

168

254

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9182 2 233
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9068 2 233
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.8966 2 237
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.893 2 237
4ohz-assembly1.cif.gz_A bound to ssrna tetranucleotide gaaa, adp, and mg2+ 0.835 165 229
ID Description Score Start End Superfamily
af_P46852_133_231_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8981 144 233 2.60.120.10
af_I1N5B5_339_414_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8776 162 232 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8712 12 135 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8685 14 131 2.60.120.10
1tq5A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8684 144 237 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7C9BEP0-F1-model_v4 Pirin family protein 0.9395 1 236 GO:0046872
AF-A0A7V5PFX0-F1-model_v4 Quercetin 2,3-dioxygenase 0.9382 163 236
AF-A0A7C9BEP0-F1-model_v4 Pirin family protein 0.9357 1 236 GO:0046872
AF-A0A317MDC0-F1-model_v4 Pirin N-terminal domain-containing protein 0.927 2 234 GO:0046872
AF-A0A3D4KAY1-F1-model_v4 Quercetin 2,3-dioxygenase 0.9265 2 232 GO:0046872
GO:0051213

Map