F343466

General Info

Members Datasets Scaffolds Average Seq Length
230 120 460 139

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0289423|Ga0501073_0289423_94_585
Length 163
Sequence VDAQFVRVGLKDVTTMALATLSGSGYSVKPLHEKLGYKPGSTIAFVALPDHLADLSASVDFGKVAKRGDWSRPLGPQTYDTIHAFTSSRAELAAGLAKLRKYLNADGMIWISWPKKSAHVPTDVTEDVVRAEALKRDLVDVKVAAVDDIWSGLKLVIPVHLRG

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
56 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
57 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
70 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
71 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
81 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
91 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
92 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
93 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
94 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
95 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
96 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
97 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
98 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
99 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
100 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
101 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
102 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
103 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
105 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
106 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
107 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
108 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
109 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
110 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
111 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
112 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
113 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
114 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
115 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
116 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
117 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
118 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
119 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
120 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.04
Metatranscriptomes 0
Isolates 6.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.04
Nodule 6.96
Rhizoplane 0
Rhizosphere 89.57
Stem 0
Stem Tuber 0
Unclassified 10.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0289423 3300049589 Bacteria 1130
2 Ga0070683_100038787 3300005329 Bacteria 4368
3 Ga0070690_100122615 3300005330 Bacteria 1746
4 Ga0068869_100704703 3300005334 Bacteria 861
5 Ga0070692_10156359 3300005345 Bacteria 1303
6 Ga0070668_100125654 3300005347 Unclassified 2054
7 Ga0070659_100448821 3300005366 Bacteria 1094
8 Ga0070703_10000174 3300005406 Bacteria 31425
9 Ga0070709_10009464 3300005434 Bacteria 5378
10 Ga0070709_10203737 3300005434 Bacteria 1402
11 Ga0070711_100000048 3300005439 Bacteria 74696
12 Ga0070705_100208033 3300005440 Bacteria 1346
13 Ga0070705_100362705 3300005440 Unclassified 1060
14 Ga0070694_100005698 3300005444 Bacteria 7552
15 Ga0070694_100073227 3300005444 Bacteria 2365
16 Ga0070694_100173657 3300005444 Bacteria 1589
17 Ga0070694_100608582 3300005444 Bacteria 881
18 Ga0070708_100005658 3300005445 Bacteria 9909
19 Ga0070708_100177314 3300005445 Bacteria 1992
20 Ga0070708_100467008 3300005445 Bacteria 1191
21 Ga0070706_100003284 3300005467 Bacteria 15994
22 Ga0070706_100394630 3300005467 Bacteria 1288
23 Ga0070707_100068719 3300005468 Bacteria 3410
24 Ga0070707_100144395 3300005468 Bacteria 2316
25 Ga0070707_101068934 3300005468 Bacteria 773
26 Ga0070707_101172008 3300005468 Unclassified 734
27 Ga0070707_101810428 3300005468 Bacteria 578
28 Ga0070698_100159456 3300005471 Bacteria 2200
29 Ga0070698_101749725 3300005471 Unclassified 574
30 Ga0070699_100012545 3300005518 Bacteria 7311
31 Ga0070699_100192550 3300005518 Unclassified 1812
32 Ga0070699_100445717 3300005518 Bacteria 1173
33 Ga0070699_100845379 3300005518 Unclassified 838
34 Ga0070679_101030565 3300005530 Bacteria 767
35 Ga0070697_100153314 3300005536 Bacteria 1943
36 Ga0070697_101341914 3300005536 Unclassified 638
37 Ga0070686_100091535 3300005544 Bacteria 2035
38 Ga0070695_100033433 3300005545 Bacteria 3217
39 Ga0070695_100051387 3300005545 Bacteria 2645
40 Ga0070695_100092858 3300005545 Bacteria 2018
41 Ga0070695_100807123 3300005545 Bacteria 752
42 Ga0070696_100003914 3300005546 Bacteria 9951
43 Ga0070696_100034565 3300005546 Bacteria 3478
44 Ga0070696_100067000 3300005546 Bacteria 2519
45 Ga0070696_101328896 3300005546 Bacteria 611
46 Ga0070665_100394072 3300005548 Bacteria 1392
47 Ga0070665_100646433 3300005548 Bacteria 1071
48 Ga0070704_100002154 3300005549 Bacteria 10965
49 Ga0070704_100085516 3300005549 Bacteria 2334
50 Ga0070704_100221772 3300005549 Unclassified 1538
51 Ga0070704_100952319 3300005549 Bacteria 774
52 Ga0070702_100043594 3300005615 Bacteria 2529
53 Ga0081455_10033751 3300005937 Bacteria 4594
54 Ga0075428_100315477 3300006844 Bacteria 1680
55 Ga0075430_101119170 3300006846 Bacteria 648
56 Ga0075431_100063851 3300006847 Bacteria 3800
57 Ga0075433_10165302 3300006852 Bacteria 1969
58 Ga0075433_10216296 3300006852 Bacteria 1703
59 Ga0075433_10647584 3300006852 Bacteria 926
60 Ga0075433_11043588 3300006852 Unclassified 711
61 Ga0075434_100006401 3300006871 Bacteria 10790
62 Ga0075434_100058397 3300006871 Unclassified 3834
63 Ga0075434_100339736 3300006871 Bacteria 1522
64 Ga0075436_100011057 3300006914 Bacteria 6192
65 Ga0075436_100096573 3300006914 Bacteria 2056
66 Ga0075436_100100274 3300006914 Bacteria 2016
67 Ga0075436_100390299 3300006914 Bacteria 1007
68 Ga0075436_100722773 3300006914 Unclassified 738
69 Ga0075436_100816831 3300006914 Unclassified 695
70 Ga0075435_100010877 3300007076 Bacteria 6666
71 Ga0075435_100737959 3300007076 Bacteria 856
72 Ga0075435_100751286 3300007076 Unclassified 848
73 Ga0099794_10015721 3300007265 Unclassified 3345
74 Ga0099794_10040087 3300007265 Bacteria 2225
75 Ga0099794_10077483 3300007265 Bacteria 1635
76 Ga0105240_10709094 3300009093 Bacteria 1098
77 Ga0111539_11065797 3300009094 Bacteria 939
78 Ga0114129_10105666 3300009147 Bacteria 3891
79 Ga0114129_10617492 3300009147 Bacteria 1403
80 Ga0105242_10590517 3300009176 Bacteria 1071
81 Ga0157378_10121819 3300013297 Bacteria 2405
82 Ga0163162_11226493 3300013306 Bacteria 851
83 Ga0163161_10161430 3300017792 Bacteria 1709
84 Ga0207653_10000017 3300025885 Bacteria 142553
85 Ga0207653_10032788 3300025885 Bacteria 1682
86 Ga0207699_10003854 3300025906 Bacteria 7162
87 Ga0207684_10018948 3300025910 Bacteria 5887
88 Ga0207684_10023965 3300025910 Bacteria 5208
89 Ga0207684_10101329 3300025910 Bacteria 2461
90 Ga0207663_10000152 3300025916 Bacteria 31941
91 Ga0207660_10010142 3300025917 Bacteria 6102
92 Ga0207646_10103491 3300025922 Bacteria 2553
93 Ga0207646_10255889 3300025922 Bacteria 1582
94 Ga0207646_10768407 3300025922 Bacteria 859
95 Ga0207646_11258106 3300025922 Bacteria 647
96 Ga0207665_10017043 3300025939 Unclassified 4772
97 Ga0207689_10902857 3300025942 Bacteria 745
98 Ga0207661_10073552 3300025944 Bacteria 2799
99 Ga0207668_10078044 3300025972 Unclassified 2390
100 Ga0209588_1001314 3300027671 Bacteria 6467
101 Ga0209588_1088038 3300027671 Bacteria 1001
102 Ga0268266_10048265 3300028379 Bacteria 3649
103 Ga0265318_10036657 3300028577 Bacteria 1880
104 Ga0265330_10110632 3300031235 Bacteria 1174
105 Ga0265332_10085381 3300031238 Bacteria 1338
106 Ga0265332_10099570 3300031238 Bacteria 1227
107 Ga0265328_10157467 3300031239 Bacteria 855
108 Ga0265325_10043333 3300031241 Bacteria 2348
109 Ga0265325_10050170 3300031241 Bacteria 2150
110 Ga0265325_10114910 3300031241 Bacteria 1303
111 Ga0265329_10095379 3300031242 Bacteria 945
112 Ga0265340_10001914 3300031247 Bacteria 11883
113 Ga0265340_10002161 3300031247 Bacteria 11278
114 Ga0265340_10009088 3300031247 Bacteria 5343
115 Ga0265340_10031423 3300031247 Bacteria 2655
116 Ga0265339_10005670 3300031249 Bacteria 8284
117 Ga0265339_10039961 3300031249 Bacteria 2609
118 Ga0265339_10045061 3300031249 Bacteria 2429
119 Ga0265339_10176320 3300031249 Bacteria 1067
120 Ga0265316_10004581 3300031344 Bacteria 13719
121 Ga0265316_10026524 3300031344 Bacteria 4817
122 Ga0265316_10097893 3300031344 Bacteria 2232
123 Ga0265313_10002093 3300031595 Bacteria 17809
124 Ga0265313_10011259 3300031595 Bacteria 5573
125 Ga0265313_10041084 3300031595 Bacteria 2281
126 Ga0265313_10084578 3300031595 Bacteria 1435
127 Ga0265314_10014189 3300031711 Bacteria 6390
128 Ga0265314_10314152 3300031711 Bacteria 874
129 Ga0265342_10014042 3300031712 Bacteria 5331
130 Ga0265342_10045781 3300031712 Bacteria 2631
131 Ga0265342_10090766 3300031712 Bacteria 1751
132 Ga0373946_0469306 3300035171 Bacteria 643
133 Ga0453683_0043143 3300044673 Bacteria 2831
134 Ga0453683_0049116 3300044673 Bacteria 2645
135 Ga0453683_0675090 3300044673 Unclassified 676
136 Ga0451576_0009224 3300045051 Bacteria 11465
137 Ga0451576_0209912 3300045051 Bacteria 2033
138 Ga0451576_0462911 3300045051 Unclassified 1332
139 Ga0451576_0862928 3300045051 Unclassified 950
140 Ga0495677_0114941 3300047445 Bacteria 1024
141 Ga0496121_0211788 3300048924 Bacteria 1372
142 Ga0501033_0561076 3300049570 Bacteria 786
143 Ga0501034_0193096 3300049571 Bacteria 1997
144 Ga0501034_0274485 3300049571 Bacteria 1626
145 Ga0501034_1221197 3300049571 Unclassified 630
146 Ga0501036_0188313 3300049572 Bacteria 1737
147 Ga0501037_0030169 3300049573 Bacteria 4007
148 Ga0501037_0426859 3300049573 Bacteria 907
149 Ga0501037_0642301 3300049573 Bacteria 710
150 Ga0501038_0502078 3300049574 Bacteria 927
151 Ga0501038_0529653 3300049574 Bacteria 898
152 Ga0501038_1180698 3300049574 Bacteria 556
153 Ga0501039_1203189 3300049575 Bacteria 586
154 Ga0501042_0297985 3300049578 Bacteria 1165
155 Ga0501046_0276250 3300049580 Bacteria 1231
156 Ga0501046_0960910 3300049580 Bacteria 594
157 Ga0501047_0067088 3300049581 Bacteria 3458
158 Ga0501047_0328711 3300049581 Bacteria 1367
159 Ga0501047_1155749 3300049581 Bacteria 587
160 Ga0501047_1182716 3300049581 Bacteria 578
161 Ga0501067_0001651 3300049583 Bacteria 12259
162 Ga0501067_0017619 3300049583 Bacteria 3953
163 Ga0501067_0300882 3300049583 Bacteria 893
164 Ga0501068_0612797 3300049584 Bacteria 710
165 Ga0501070_0080723 3300049586 Bacteria 2691
166 Ga0501070_0313616 3300049586 Bacteria 1276
167 Ga0501070_0800248 3300049586 Bacteria 740
168 Ga0501071_0602354 3300049587 Bacteria 845
169 Ga0501073_0060452 3300049589 Bacteria 2644
170 Ga0501073_0467947 3300049589 Bacteria 871
171 Ga0501074_0014571 3300049590 Bacteria 5721
172 Ga0501076_0179111 3300049592 Bacteria 1728
173 Ga0501076_0182733 3300049592 Bacteria 1710
174 Ga0501077_0126888 3300049593 Bacteria 1617
175 Ga0501080_0040740 3300049742 Bacteria 4331
176 Ga0501080_0074345 3300049742 Bacteria 3161
177 Ga0501080_0761569 3300049742 Bacteria 851
178 Ga0501083_0001924 3300049744 Bacteria 14282
179 Ga0501083_0228668 3300049744 Bacteria 1211
180 Ga0501083_0410807 3300049744 Bacteria 881
181 Ga0501044_0121835 3300049823 Bacteria 2608
182 Ga0501044_0134624 3300049823 Bacteria 2463
183 nmdc:mga05p37_621385_c1 3300050507 Bacteria 1216
184 nmdc:mga0qj67_304041_c1 3300050509 Bacteria 1292
185 nmdc:mga06r32_1056835_c1 3300050510 Bacteria 762
186 nmdc:mga0n895_126842_c1 3300050512 Bacteria 2576
187 nmdc:mga0n895_1737510_c1 3300050512 Bacteria 586
188 nmdc:mga0n895_176414_c1 3300050512 Bacteria 2168
189 nmdc:mga0n895_83415_c1 3300050512 Bacteria 3188
190 nmdc:mga0rr50_1468759_c1 3300050513 Unclassified 577
191 nmdc:mga0rr50_267931_c1 3300050513 Bacteria 1423
192 nmdc:mga0rr50_276615_c1 3300050513 Bacteria 1400
193 nmdc:mga0rr50_986573_c1 3300050513 Unclassified 718
194 nmdc:mga08x19_11123_c1 3300050514 Bacteria 5418
195 nmdc:mga08x19_1282137_c1 3300050514 Unclassified 519
196 nmdc:mga08x19_329178_c1 3300050514 Unclassified 1064
197 nmdc:mga08x19_47352_c1 3300050514 Bacteria 2752
198 nmdc:mga08x19_63264_c1 3300050514 Bacteria 2400
199 nmdc:mga0a205_368855_c1 3300050515 Bacteria 1302
200 nmdc:mga0a205_531513_c1 3300050515 Unclassified 1032
201 Ga0500643_000011 3300053087 Bacteria 385630
202 Ga0500643_028127 3300053087 Bacteria 1741
203 Ga0500644_0011085 3300053088 Bacteria 2455
204 Ga0500646_0214914 3300053090 Bacteria 665
205 Ga0500650_0120172 3300053098 Bacteria 1225
206 Ga0500559_0294610 3300053136 Bacteria 762
207 Ga0500622_0005002 3300053156 Bacteria 8072
208 Ga0501084_0208097 3300054114 Bacteria 1650
209 Ga0501084_0636563 3300054114 Bacteria 900
210 Ga0501084_0944091 3300054114 Bacteria 725
211 Ga0501082_0116824 3300060353 Bacteria 2310
212 Ga0501082_0174948 3300060353 Bacteria 1866
213 Ga0501082_0278392 3300060353 Bacteria 1456
214 Ga0501082_0583255 3300060353 Bacteria 978
215 2847690266 2847686936 Bacteria 6278406
216 2871449031 2871444079 Bacteria 6423508
217 2874104905 2874102143 Bacteria 6342645
218 2878794842 2878788777 Bacteria 6567085
219 2922164717 2922158528 Bacteria 6573167
220 2924726965 2924726620 Bacteria 6271473
221 2937839225 2937836603 Bacteria 6811263
222 2937895254 2937891427 Bacteria 6357007
223 2958120439 2958115193 Bacteria 6923548
224 2968102462 2968097103 Bacteria 6107094
225 2977859305 2977858184 Bacteria 6215359
226 2979781862 2979779861 Bacteria 6219781
227 2996348064 2996341866 Bacteria 6643098
228 8004448224 8004445564 Bacteria 6322258
229 8004635789 8004633249 Bacteria 6723080
230 8004706403 8004703790 Bacteria 8006957
231 Ga0501073_0289423
232 Ga0070683_100038787
233 Ga0070690_100122615
234 Ga0068869_100704703
235 Ga0070692_10156359
236 Ga0070668_100125654
237 Ga0070659_100448821
238 Ga0070703_10000174
239 Ga0070709_10009464
240 Ga0070709_10203737
241 Ga0070711_100000048
242 Ga0070705_100208033
243 Ga0070705_100362705
244 Ga0070694_100005698
245 Ga0070694_100073227
246 Ga0070694_100173657
247 Ga0070694_100608582
248 Ga0070708_100005658
249 Ga0070708_100177314
250 Ga0070708_100467008
251 Ga0070706_100003284
252 Ga0070706_100394630
253 Ga0070707_100068719
254 Ga0070707_100144395
255 Ga0070707_101068934
256 Ga0070707_101172008
257 Ga0070707_101810428
258 Ga0070698_100159456
259 Ga0070698_101749725
260 Ga0070699_100012545
261 Ga0070699_100192550
262 Ga0070699_100445717
263 Ga0070699_100845379
264 Ga0070679_101030565
265 Ga0070697_100153314
266 Ga0070697_101341914
267 Ga0070686_100091535
268 Ga0070695_100033433
269 Ga0070695_100051387
270 Ga0070695_100092858
271 Ga0070695_100807123
272 Ga0070696_100003914
273 Ga0070696_100034565
274 Ga0070696_100067000
275 Ga0070696_101328896
276 Ga0070665_100394072
277 Ga0070665_100646433
278 Ga0070704_100002154
279 Ga0070704_100085516
280 Ga0070704_100221772
281 Ga0070704_100952319
282 Ga0070702_100043594
283 Ga0081455_10033751
284 Ga0075428_100315477
285 Ga0075430_101119170
286 Ga0075431_100063851
287 Ga0075433_10165302
288 Ga0075433_10216296
289 Ga0075433_10647584
290 Ga0075433_11043588
291 Ga0075434_100006401
292 Ga0075434_100058397
293 Ga0075434_100339736
294 Ga0075436_100011057
295 Ga0075436_100096573
296 Ga0075436_100100274
297 Ga0075436_100390299
298 Ga0075436_100722773
299 Ga0075436_100816831
300 Ga0075435_100010877
301 Ga0075435_100737959
302 Ga0075435_100751286
303 Ga0099794_10015721
304 Ga0099794_10040087
305 Ga0099794_10077483
306 Ga0105240_10709094
307 Ga0111539_11065797
308 Ga0114129_10105666
309 Ga0114129_10617492
310 Ga0105242_10590517
311 Ga0157378_10121819
312 Ga0163162_11226493
313 Ga0163161_10161430
314 Ga0207653_10000017
315 Ga0207653_10032788
316 Ga0207699_10003854
317 Ga0207684_10018948
318 Ga0207684_10023965
319 Ga0207684_10101329
320 Ga0207663_10000152
321 Ga0207660_10010142
322 Ga0207646_10103491
323 Ga0207646_10255889
324 Ga0207646_10768407
325 Ga0207646_11258106
326 Ga0207665_10017043
327 Ga0207689_10902857
328 Ga0207661_10073552
329 Ga0207668_10078044
330 Ga0209588_1001314
331 Ga0209588_1088038
332 Ga0268266_10048265
333 Ga0265318_10036657
334 Ga0265330_10110632
335 Ga0265332_10085381
336 Ga0265332_10099570
337 Ga0265328_10157467
338 Ga0265325_10043333
339 Ga0265325_10050170
340 Ga0265325_10114910
341 Ga0265329_10095379
342 Ga0265340_10001914
343 Ga0265340_10002161
344 Ga0265340_10009088
345 Ga0265340_10031423
346 Ga0265339_10005670
347 Ga0265339_10039961
348 Ga0265339_10045061
349 Ga0265339_10176320
350 Ga0265316_10004581
351 Ga0265316_10026524
352 Ga0265316_10097893
353 Ga0265313_10002093
354 Ga0265313_10011259
355 Ga0265313_10041084
356 Ga0265313_10084578
357 Ga0265314_10014189
358 Ga0265314_10314152
359 Ga0265342_10014042
360 Ga0265342_10045781
361 Ga0265342_10090766
362 Ga0373946_0469306
363 Ga0453683_0043143
364 Ga0453683_0049116
365 Ga0453683_0675090
366 Ga0451576_0009224
367 Ga0451576_0209912
368 Ga0451576_0462911
369 Ga0451576_0862928
370 Ga0495677_0114941
371 Ga0496121_0211788
372 Ga0501033_0561076
373 Ga0501034_0193096
374 Ga0501034_0274485
375 Ga0501034_1221197
376 Ga0501036_0188313
377 Ga0501037_0030169
378 Ga0501037_0426859
379 Ga0501037_0642301
380 Ga0501038_0502078
381 Ga0501038_0529653
382 Ga0501038_1180698
383 Ga0501039_1203189
384 Ga0501042_0297985
385 Ga0501046_0276250
386 Ga0501046_0960910
387 Ga0501047_0067088
388 Ga0501047_0328711
389 Ga0501047_1155749
390 Ga0501047_1182716
391 Ga0501067_0001651
392 Ga0501067_0017619
393 Ga0501067_0300882
394 Ga0501068_0612797
395 Ga0501070_0080723
396 Ga0501070_0313616
397 Ga0501070_0800248
398 Ga0501071_0602354
399 Ga0501073_0060452
400 Ga0501073_0467947
401 Ga0501074_0014571
402 Ga0501076_0179111
403 Ga0501076_0182733
404 Ga0501077_0126888
405 Ga0501080_0040740
406 Ga0501080_0074345
407 Ga0501080_0761569
408 Ga0501083_0001924
409 Ga0501083_0228668
410 Ga0501083_0410807
411 Ga0501044_0121835
412 Ga0501044_0134624
413 nmdc:mga05p37_621385_c1
414 nmdc:mga0qj67_304041_c1
415 nmdc:mga06r32_1056835_c1
416 nmdc:mga0n895_126842_c1
417 nmdc:mga0n895_1737510_c1
418 nmdc:mga0n895_176414_c1
419 nmdc:mga0n895_83415_c1
420 nmdc:mga0rr50_1468759_c1
421 nmdc:mga0rr50_267931_c1
422 nmdc:mga0rr50_276615_c1
423 nmdc:mga0rr50_986573_c1
424 nmdc:mga08x19_11123_c1
425 nmdc:mga08x19_1282137_c1
426 nmdc:mga08x19_329178_c1
427 nmdc:mga08x19_47352_c1
428 nmdc:mga08x19_63264_c1
429 nmdc:mga0a205_368855_c1
430 nmdc:mga0a205_531513_c1
431 Ga0500643_000011
432 Ga0500643_028127
433 Ga0500644_0011085
434 Ga0500646_0214914
435 Ga0500650_0120172
436 Ga0500559_0294610
437 Ga0500622_0005002
438 Ga0501084_0208097
439 Ga0501084_0636563
440 Ga0501084_0944091
441 Ga0501082_0116824
442 Ga0501082_0174948
443 Ga0501082_0278392
444 Ga0501082_0583255
445 2847690266
446 2871449031
447 2874104905
448 2878794842
449 2922164717
450 2924726965
451 2937839225
452 2937895254
453 2958120439
454 2968102462
455 2977859305
456 2979781862
457 2996348064
458 8004448224
459 8004635789
460 8004706403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e2z-assembly1.cif.gz_A x-ray structure of the h225n mutant of tcab9, a c-3'-methyltransferase, in complex with s-adenosyl-l-homocysteine and sugar product 0.7825 64 150
4e31-assembly1.cif.gz_A x-ray structure of the y76f mutant of tcab9, a c-3'-methyltransferase, in complex with s-adenosyl-l-homocysteine and sugar product 0.7818 64 150
4e32-assembly1.cif.gz_A x-ray structure of the c-3'-methyltransferase tcab9 in complex with s-adenosyl-l-homocysteine and dtdp-sugar substrate 0.7691 64 152
4e2x-assembly1.cif.gz_A x-ray structure of the y222f mutant of tcab9, a c-3'-methyltransferase, in complex with s-adenosyl-l-homocysteine and dtdp 0.7645 64 152
3i5u-assembly1.cif.gz_A crystal structure of an o-methyltransferase (ncsb1) from neocarzinostatin biosynthesis in complex with s-adenosylmethionine (sam) and 2-hydroxy-5-methyl naphthoic acid (mna) 0.7524 54 148
ID Description Score Start End Superfamily
af_B4FY91_102_330_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7521 64 148 3.40.50.150
af_P9WLG9_29_152_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7443 27 148 3.40.50.150
af_A4HZL8_94_342_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7434 63 148 3.40.50.150
2ip2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7349 54 148 3.40.50.150
af_P9WLG9_29_152_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7284 27 148 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7C4U9S6-F1-model_v4 DUF3052 family protein 0.9647 62 152
AF-A0A7W6IE48-F1-model_v4 DUF3052 family protein 0.9614 63 150
AF-A0A521D117-F1-model_v4 DUF3052 domain-containing protein 0.9563 76 152
AF-M6F2I0-F1-model_v4 PF11253 family protein 0.9562 69 148
AF-A0A529UWV1-F1-model_v4 deleted 0.9512 71 152

Map