F342174

General Info

Members Datasets Scaffolds Average Seq Length
229 146 458 263

Family's Representative Sequence

Representative Sequence 3300034819|Ga0373958_0009120|Ga0373958_0009120_442_1305
Length 287
Sequence MDYGRVARDAPLIALSSAPDKEVFVADVNSHAPGTFSWPELATTDQKAGVAFYRGLFGWELNEQPMGPTEVYSMFQMRGRPVAAAYTMRPEEKQMGAPPHWNSYVTVTNVDESTKKAQALGAKVFAQPFDVMDAGRMAVLQDPTGAVFQVWQPNRSIGAMILNEPGALCWTELTTSDLRAAETFYTQLFGWSAKRSDPAAGMEYTEMSINGQPGVGMMPKPPQMPAHIPSYWMPYFWVEQVDASAAKATQLGGKLMVPPQDIPKVGRFAIVSDPQGAVFAIFTPAVR

Samples

Sample ID Description Type Environment
1 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
107 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
108 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
109 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
110 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.68
Rhizosphere 91.7
Stem 0
Stem Tuber 0
Unclassified 9.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373958_0009120 3300034819 Unclassified 1626
2 Ga0065712_10090037 3300005290 Bacteria 2433
3 Ga0065715_10112092 3300005293 Bacteria 2541
4 Ga0070676_10083810 3300005328 Bacteria 1940
5 Ga0070683_100445030 3300005329 Unclassified 1236
6 Ga0070690_100009771 3300005330 Bacteria 5565
7 Ga0070666_10072680 3300005335 Bacteria 2342
8 Ga0070689_100249787 3300005340 Bacteria 1463
9 Ga0070668_100241593 3300005347 Bacteria 1496
10 Ga0070675_100001330 3300005354 Bacteria 18075
11 Ga0070675_100488964 3300005354 Unclassified 1108
12 Ga0070674_100089310 3300005356 Bacteria 2220
13 Ga0070688_100144724 3300005365 Bacteria 1618
14 Ga0070701_10259157 3300005438 Bacteria 1053
15 Ga0070705_100113468 3300005440 Unclassified 1736
16 Ga0070694_100001305 3300005444 Bacteria 14495
17 Ga0070694_100136752 3300005444 Bacteria 1776
18 Ga0070708_100025727 3300005445 Bacteria 5033
19 Ga0068867_100037091 3300005459 Bacteria 3542
20 Ga0068867_100087647 3300005459 Bacteria 2357
21 Ga0070706_100000024 3300005467 Bacteria 158347
22 Ga0070707_100003357 3300005468 Bacteria 15114
23 Ga0070707_100099330 3300005468 Bacteria 2820
24 Ga0070698_100357863 3300005471 Bacteria 1391
25 Ga0070699_100106544 3300005518 Unclassified 2459
26 Ga0070699_100254024 3300005518 Unclassified 1571
27 Ga0070679_100019693 3300005530 Bacteria 6567
28 Ga0070697_100003878 3300005536 Bacteria 11482
29 Ga0070697_100132050 3300005536 Unclassified 2095
30 Ga0070697_100422311 3300005536 Bacteria 1159
31 Ga0070686_100003448 3300005544 Bacteria 8672
32 Ga0070686_100181689 3300005544 Bacteria 1495
33 Ga0070695_100043441 3300005545 Bacteria 2858
34 Ga0070695_100138477 3300005545 Bacteria 1685
35 Ga0070665_100048493 3300005548 Bacteria 4263
36 Ga0070665_100174545 3300005548 Unclassified 2150
37 Ga0070704_100053303 3300005549 Bacteria 2858
38 Ga0068855_100381287 3300005563 Bacteria 1548
39 Ga0068855_100442212 3300005563 Bacteria 1420
40 Ga0070664_100131412 3300005564 Unclassified 2199
41 Ga0070664_100154359 3300005564 Bacteria 2028
42 Ga0068854_100048457 3300005578 Bacteria 3032
43 Ga0068854_100175993 3300005578 Bacteria 1668
44 Ga0068852_100691847 3300005616 Bacteria 1029
45 Ga0068859_100260013 3300005617 Bacteria 1827
46 Ga0068859_100340213 3300005617 Bacteria 1595
47 Ga0068864_100020458 3300005618 Bacteria 5537
48 Ga0068864_100051839 3300005618 Bacteria 3536
49 Ga0068864_100288588 3300005618 Bacteria 1533
50 Ga0068861_100174289 3300005719 Bacteria 1785
51 Ga0068861_100675428 3300005719 Bacteria 957
52 Ga0068863_100036717 3300005841 Bacteria 4667
53 Ga0068863_100206527 3300005841 Bacteria 1890
54 Ga0068858_100002405 3300005842 Bacteria 18924
55 Ga0068858_100021811 3300005842 Bacteria 5982
56 Ga0068860_100090299 3300005843 Bacteria 2918
57 Ga0068860_100566971 3300005843 Bacteria 1138
58 Ga0075431_100119844 3300006847 Bacteria 2715
59 Ga0075433_10006622 3300006852 Bacteria 9169
60 Ga0075433_10107991 3300006852 Bacteria 2468
61 Ga0075434_100000686 3300006871 Bacteria 26383
62 Ga0075434_100013328 3300006871 Bacteria 7819
63 Ga0075434_100095247 3300006871 Bacteria 2983
64 Ga0075434_100190705 3300006871 Unclassified 2070
65 Ga0075434_100215742 3300006871 Bacteria 1939
66 Ga0075434_100304641 3300006871 Unclassified 1614
67 Ga0068865_100043478 3300006881 Unclassified 3070
68 Ga0068865_100324072 3300006881 Bacteria 1240
69 Ga0075436_100000864 3300006914 Bacteria 20151
70 Ga0075436_100033403 3300006914 Bacteria 3546
71 Ga0075436_100039480 3300006914 Bacteria 3258
72 Ga0075436_100063978 3300006914 Bacteria 2542
73 Ga0075436_100104462 3300006914 Bacteria 1975
74 Ga0075436_100228888 3300006914 Bacteria 1320
75 Ga0075436_100346483 3300006914 Bacteria 1070
76 Ga0097620_100260013 3300006931 Bacteria 1827
77 Ga0097620_100340190 3300006931 Bacteria 1595
78 Ga0075435_100000745 3300007076 Bacteria 20151
79 Ga0075435_100000921 3300007076 Bacteria 18545
80 Ga0075435_100024116 3300007076 Bacteria 4715
81 Ga0075435_100031721 3300007076 Bacteria 4166
82 Ga0075435_100151912 3300007076 Unclassified 1947
83 Ga0075435_100418127 3300007076 Bacteria 1154
84 Ga0099794_10000025 3300007265 Bacteria 60175
85 Ga0099794_10058261 3300007265 Bacteria 1872
86 Ga0105245_10014005 3300009098 Bacteria 6985
87 Ga0105245_10086046 3300009098 Bacteria 2882
88 Ga0114129_10025748 3300009147 Bacteria 8333
89 Ga0105241_10088432 3300009174 Unclassified 2439
90 Ga0105242_10007695 3300009176 Bacteria 8291
91 Ga0105242_10041357 3300009176 Bacteria 3717
92 Ga0105242_10103595 3300009176 Bacteria 2414
93 Ga0105242_10132595 3300009176 Bacteria 2153
94 Ga0105248_10039848 3300009177 Bacteria 5265
95 Ga0105248_10098729 3300009177 Bacteria 3290
96 Ga0105249_10170678 3300009553 Bacteria 2109
97 Ga0099796_10122537 3300010159 Bacteria 1000
98 Ga0157378_10505229 3300013297 Bacteria 1208
99 Ga0163162_10212854 3300013306 Bacteria 2063
100 Ga0157375_10211680 3300013308 Bacteria 2096
101 Ga0157375_10348902 3300013308 Bacteria 1646
102 Ga0163163_10176416 3300014325 Bacteria 2184
103 Ga0163163_10834704 3300014325 Bacteria 985
104 Ga0157380_10005158 3300014326 Bacteria 9132
105 Ga0157380_10180758 3300014326 Bacteria 1853
106 Ga0157377_10064088 3300014745 Bacteria 2107
107 Ga0157379_10046467 3300014968 Bacteria 3873
108 Ga0157379_10057821 3300014968 Bacteria 3466
109 Ga0157376_10028019 3300014969 Bacteria 4473
110 Ga0157376_10036881 3300014969 Bacteria 3963
111 Ga0157376_10566745 3300014969 Bacteria 1126
112 Ga0182007_10106139 3300015262 Bacteria 932
113 Ga0213874_10004075 3300021377 Bacteria 3301
114 Ga0213876_10010225 3300021384 Bacteria 5039
115 Ga0213875_10012629 3300021388 Bacteria 4162
116 Ga0207710_10069987 3300025900 Bacteria 1607
117 Ga0207680_10052949 3300025903 Bacteria 2434
118 Ga0207680_10057435 3300025903 Bacteria 2354
119 Ga0207684_10000004 3300025910 Bacteria 755956
120 Ga0207654_10138100 3300025911 Bacteria 1551
121 Ga0207695_10121735 3300025913 Bacteria 2576
122 Ga0207662_10130957 3300025918 Bacteria 1581
123 Ga0207652_10060886 3300025921 Bacteria 3258
124 Ga0207646_10048603 3300025922 Unclassified 3802
125 Ga0207646_10108593 3300025922 Bacteria 2490
126 Ga0207681_10247451 3300025923 Unclassified 1390
127 Ga0207694_10357079 3300025924 Bacteria 1210
128 Ga0207659_10000270 3300025926 Bacteria 31679
129 Ga0207644_10014460 3300025931 Bacteria 5278
130 Ga0207686_10117331 3300025934 Bacteria 1806
131 Ga0207709_10028877 3300025935 Bacteria 3210
132 Ga0207669_10010036 3300025937 Bacteria 4542
133 Ga0207665_10031525 3300025939 Bacteria 3507
134 Ga0207711_10034767 3300025941 Bacteria 4268
135 Ga0207711_10037911 3300025941 Bacteria 4097
136 Ga0207711_10068217 3300025941 Bacteria 3080
137 Ga0207711_10401497 3300025941 Bacteria 1274
138 Ga0207661_10482081 3300025944 Bacteria 1132
139 Ga0207667_10207423 3300025949 Bacteria 2009
140 Ga0207640_10036391 3300025981 Bacteria 3090
141 Ga0207677_10016728 3300026023 Bacteria 4352
142 Ga0207703_10015455 3300026035 Bacteria 5950
143 Ga0207703_10370922 3300026035 Bacteria 1322
144 Ga0207641_10017767 3300026088 Bacteria 5828
145 Ga0207648_10081077 3300026089 Bacteria 2830
146 Ga0207648_10088025 3300026089 Bacteria 2711
147 Ga0207676_10030014 3300026095 Bacteria 4076
148 Ga0207676_10067856 3300026095 Bacteria 2850
149 Ga0207676_10109711 3300026095 Bacteria 2306
150 Ga0207676_10703705 3300026095 Unclassified 979
151 Ga0207675_100035133 3300026118 Bacteria 4675
152 Ga0207675_100264751 3300026118 Bacteria 1667
153 Ga0207675_100525593 3300026118 Bacteria 1180
154 Ga0207698_10347478 3300026142 Bacteria 1400
155 Ga0209588_1000014 3300027671 Bacteria 133062
156 Ga0207428_10016133 3300027907 Bacteria 6433
157 Ga0268266_10006716 3300028379 Bacteria 10490
158 Ga0268266_10033785 3300028379 Unclassified 4348
159 Ga0268266_10123558 3300028379 Bacteria 2306
160 Ga0268265_10138109 3300028380 Unclassified 2036
161 Ga0268264_10225157 3300028381 Bacteria 1729
162 Ga0265338_10000134 3300028800 Bacteria 135896
163 Ga0265760_10064377 3300031090 Bacteria 1118
164 Ga0265325_10004924 3300031241 Bacteria 8327
165 Ga0265339_10006229 3300031249 Bacteria 7855
166 Ga0265316_10058190 3300031344 Bacteria 3012
167 Ga0265313_10002481 3300031595 Bacteria 15903
168 Ga0265314_10138125 3300031711 Bacteria 1511
169 Ga0307412_10506753 3300031911 Bacteria 1006
170 Ga0307416_100885198 3300032002 Bacteria 992
171 Ga0373959_0001833 3300034820 Bacteria 3388
172 Ga0373938_0002905 3300034957 Bacteria 2768
173 Ga0373949_0001151 3300035090 Bacteria 7930
174 Ga0373952_0000604 3300035092 Bacteria 6357
175 Ga0373932_0002997 3300035112 Bacteria 4142
176 Ga0373927_0005639 3300035695 Bacteria 8603
177 Ga0373937_0083448 3300036401 Bacteria 2956
178 Ga0373937_0347713 3300036401 Bacteria 1404
179 Ga0436364_0609207 3300037853 Bacteria 9376
180 Ga0436365_0023379 3300039437 Bacteria 19275
181 Ga0436363_0658252 3300039450 Bacteria 6277
182 Ga0436362_0822691 3300039453 Bacteria 2451
183 Ga0451576_0029536 3300045051 Bacteria 5865
184 Ga0495580_0043989 3300046472 Bacteria 3177
185 Ga0495640_0084711 3300046533 Bacteria 2102
186 Ga0495587_0096717 3300046536 Bacteria 1703
187 Ga0495645_0027324 3300046543 Bacteria 4145
188 Ga0495634_0202595 3300046642 Bacteria 1232
189 Ga0495635_0287850 3300046663 Unclassified 1103
190 Ga0495658_0069749 3300046683 Bacteria 2038
191 Ga0495658_0121793 3300046683 Unclassified 1578
192 Ga0495674_0038400 3300047319 Bacteria 4298
193 Ga0495674_0457386 3300047319 Unclassified 1025
194 Ga0495672_0097781 3300047320 Bacteria 1598
195 Ga0495676_0256596 3300047321 Bacteria 1191
196 Ga0496101_0185347 3300048904 Bacteria 1604
197 Ga0496104_0011641 3300048907 Bacteria 7885
198 Ga0496105_0132294 3300048908 Bacteria 2056
199 Ga0496107_0179731 3300048910 Bacteria 1571
200 Ga0496107_0388364 3300048910 Bacteria 1038
201 Ga0496108_0035152 3300048911 Bacteria 4164
202 Ga0496109_0427990 3300048912 Bacteria 1250
203 Ga0496112_0013884 3300048915 Bacteria 7450
204 Ga0496113_0009454 3300048916 Bacteria 6396
205 Ga0496114_0021088 3300048917 Bacteria 5296
206 Ga0496114_0074575 3300048917 Bacteria 2856
207 Ga0496114_0288533 3300048917 Bacteria 1447
208 Ga0496115_0066427 3300048918 Bacteria 2915
209 Ga0501070_0551255 3300049586 Bacteria 923
210 nmdc:mga05p37_12872_c1 3300050507 Bacteria 10004
211 nmdc:mga05p37_516436_c1 3300050507 Bacteria 1367
212 nmdc:mga06r32_352544_c1 3300050510 Bacteria 1456
213 nmdc:mga08y16_16243_c1 3300050511 Bacteria 7828
214 nmdc:mga0n895_145883_c1 3300050512 Bacteria 2396
215 nmdc:mga0n895_39617_c1 3300050512 Bacteria 4573
216 nmdc:mga0n895_487_c1 3300050512 Bacteria 26823
217 nmdc:mga0rr50_211_c1 3300050513 Bacteria 31348
218 nmdc:mga0rr50_334591_c1 3300050513 Bacteria 1271
219 nmdc:mga0rr50_5507_c1 3300050513 Bacteria 7562
220 nmdc:mga0rr50_8970_c1 3300050513 Bacteria 6255
221 nmdc:mga08x19_35415_c1 3300050514 Bacteria 3158
222 nmdc:mga08x19_4108_c1 3300050514 Bacteria 8637
223 nmdc:mga08x19_60101_c1 3300050514 Bacteria 2461
224 nmdc:mga08x19_702_c1 3300050514 Bacteria 21420
225 nmdc:mga08x19_8845_c1 3300050514 Bacteria 6007
226 nmdc:mga0a205_159488_c1 3300050515 Bacteria 2153
227 nmdc:mga0a205_544981_c1 3300050515 Bacteria 1015
228 nmdc:mga0a205_8278_c1 3300050515 Bacteria 9454
229 Ga0495619_0061953 3300053085 Bacteria 2490
230 Ga0373958_0009120
231 Ga0065712_10090037
232 Ga0065715_10112092
233 Ga0070676_10083810
234 Ga0070683_100445030
235 Ga0070690_100009771
236 Ga0070666_10072680
237 Ga0070689_100249787
238 Ga0070668_100241593
239 Ga0070675_100001330
240 Ga0070675_100488964
241 Ga0070674_100089310
242 Ga0070688_100144724
243 Ga0070701_10259157
244 Ga0070705_100113468
245 Ga0070694_100001305
246 Ga0070694_100136752
247 Ga0070708_100025727
248 Ga0068867_100037091
249 Ga0068867_100087647
250 Ga0070706_100000024
251 Ga0070707_100003357
252 Ga0070707_100099330
253 Ga0070698_100357863
254 Ga0070699_100106544
255 Ga0070699_100254024
256 Ga0070679_100019693
257 Ga0070697_100003878
258 Ga0070697_100132050
259 Ga0070697_100422311
260 Ga0070686_100003448
261 Ga0070686_100181689
262 Ga0070695_100043441
263 Ga0070695_100138477
264 Ga0070665_100048493
265 Ga0070665_100174545
266 Ga0070704_100053303
267 Ga0068855_100381287
268 Ga0068855_100442212
269 Ga0070664_100131412
270 Ga0070664_100154359
271 Ga0068854_100048457
272 Ga0068854_100175993
273 Ga0068852_100691847
274 Ga0068859_100260013
275 Ga0068859_100340213
276 Ga0068864_100020458
277 Ga0068864_100051839
278 Ga0068864_100288588
279 Ga0068861_100174289
280 Ga0068861_100675428
281 Ga0068863_100036717
282 Ga0068863_100206527
283 Ga0068858_100002405
284 Ga0068858_100021811
285 Ga0068860_100090299
286 Ga0068860_100566971
287 Ga0075431_100119844
288 Ga0075433_10006622
289 Ga0075433_10107991
290 Ga0075434_100000686
291 Ga0075434_100013328
292 Ga0075434_100095247
293 Ga0075434_100190705
294 Ga0075434_100215742
295 Ga0075434_100304641
296 Ga0068865_100043478
297 Ga0068865_100324072
298 Ga0075436_100000864
299 Ga0075436_100033403
300 Ga0075436_100039480
301 Ga0075436_100063978
302 Ga0075436_100104462
303 Ga0075436_100228888
304 Ga0075436_100346483
305 Ga0097620_100260013
306 Ga0097620_100340190
307 Ga0075435_100000745
308 Ga0075435_100000921
309 Ga0075435_100024116
310 Ga0075435_100031721
311 Ga0075435_100151912
312 Ga0075435_100418127
313 Ga0099794_10000025
314 Ga0099794_10058261
315 Ga0105245_10014005
316 Ga0105245_10086046
317 Ga0114129_10025748
318 Ga0105241_10088432
319 Ga0105242_10007695
320 Ga0105242_10041357
321 Ga0105242_10103595
322 Ga0105242_10132595
323 Ga0105248_10039848
324 Ga0105248_10098729
325 Ga0105249_10170678
326 Ga0099796_10122537
327 Ga0157378_10505229
328 Ga0163162_10212854
329 Ga0157375_10211680
330 Ga0157375_10348902
331 Ga0163163_10176416
332 Ga0163163_10834704
333 Ga0157380_10005158
334 Ga0157380_10180758
335 Ga0157377_10064088
336 Ga0157379_10046467
337 Ga0157379_10057821
338 Ga0157376_10028019
339 Ga0157376_10036881
340 Ga0157376_10566745
341 Ga0182007_10106139
342 Ga0213874_10004075
343 Ga0213876_10010225
344 Ga0213875_10012629
345 Ga0207710_10069987
346 Ga0207680_10052949
347 Ga0207680_10057435
348 Ga0207684_10000004
349 Ga0207654_10138100
350 Ga0207695_10121735
351 Ga0207662_10130957
352 Ga0207652_10060886
353 Ga0207646_10048603
354 Ga0207646_10108593
355 Ga0207681_10247451
356 Ga0207694_10357079
357 Ga0207659_10000270
358 Ga0207644_10014460
359 Ga0207686_10117331
360 Ga0207709_10028877
361 Ga0207669_10010036
362 Ga0207665_10031525
363 Ga0207711_10034767
364 Ga0207711_10037911
365 Ga0207711_10068217
366 Ga0207711_10401497
367 Ga0207661_10482081
368 Ga0207667_10207423
369 Ga0207640_10036391
370 Ga0207677_10016728
371 Ga0207703_10015455
372 Ga0207703_10370922
373 Ga0207641_10017767
374 Ga0207648_10081077
375 Ga0207648_10088025
376 Ga0207676_10030014
377 Ga0207676_10067856
378 Ga0207676_10109711
379 Ga0207676_10703705
380 Ga0207675_100035133
381 Ga0207675_100264751
382 Ga0207675_100525593
383 Ga0207698_10347478
384 Ga0209588_1000014
385 Ga0207428_10016133
386 Ga0268266_10006716
387 Ga0268266_10033785
388 Ga0268266_10123558
389 Ga0268265_10138109
390 Ga0268264_10225157
391 Ga0265338_10000134
392 Ga0265760_10064377
393 Ga0265325_10004924
394 Ga0265339_10006229
395 Ga0265316_10058190
396 Ga0265313_10002481
397 Ga0265314_10138125
398 Ga0307412_10506753
399 Ga0307416_100885198
400 Ga0373959_0001833
401 Ga0373938_0002905
402 Ga0373949_0001151
403 Ga0373952_0000604
404 Ga0373932_0002997
405 Ga0373927_0005639
406 Ga0373937_0083448
407 Ga0373937_0347713
408 Ga0436364_0609207
409 Ga0436365_0023379
410 Ga0436363_0658252
411 Ga0436362_0822691
412 Ga0451576_0029536
413 Ga0495580_0043989
414 Ga0495640_0084711
415 Ga0495587_0096717
416 Ga0495645_0027324
417 Ga0495634_0202595
418 Ga0495635_0287850
419 Ga0495658_0069749
420 Ga0495658_0121793
421 Ga0495674_0038400
422 Ga0495674_0457386
423 Ga0495672_0097781
424 Ga0495676_0256596
425 Ga0496101_0185347
426 Ga0496104_0011641
427 Ga0496105_0132294
428 Ga0496107_0179731
429 Ga0496107_0388364
430 Ga0496108_0035152
431 Ga0496109_0427990
432 Ga0496112_0013884
433 Ga0496113_0009454
434 Ga0496114_0021088
435 Ga0496114_0074575
436 Ga0496114_0288533
437 Ga0496115_0066427
438 Ga0501070_0551255
439 nmdc:mga05p37_12872_c1
440 nmdc:mga05p37_516436_c1
441 nmdc:mga06r32_352544_c1
442 nmdc:mga08y16_16243_c1
443 nmdc:mga0n895_145883_c1
444 nmdc:mga0n895_39617_c1
445 nmdc:mga0n895_487_c1
446 nmdc:mga0rr50_211_c1
447 nmdc:mga0rr50_334591_c1
448 nmdc:mga0rr50_5507_c1
449 nmdc:mga0rr50_8970_c1
450 nmdc:mga08x19_35415_c1
451 nmdc:mga08x19_4108_c1
452 nmdc:mga08x19_60101_c1
453 nmdc:mga08x19_702_c1
454 nmdc:mga08x19_8845_c1
455 nmdc:mga0a205_159488_c1
456 nmdc:mga0a205_544981_c1
457 nmdc:mga0a205_8278_c1
458 Ga0495619_0061953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

35

150

0.95

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

167

281

0.82

PF18029

Glyoxalase_6

Glyoxalase-like domain

170

282

0.74

PF18029

Glyoxalase_6

Glyoxalase-like domain

40

151

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9569 1 261
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9236 1 261
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7978 139 262
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7891 140 262
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.783 140 262
ID Description Score Start End Superfamily
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9687 1 137 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9352 140 263 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9278 140 263 3.10.180.10
af_I6XA34_134_256_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9243 140 259 3.10.180.10
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9068 1 137 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2V8FYY0-F1-model_v4 VOC family protein 0.989 1 201
AF-A0A2V8FYY0-F1-model_v4 VOC family protein 0.9841 1 201
AF-A0A2V9GKZ6-F1-model_v4 VOC domain-containing protein 0.984 1 163
AF-A0A2V8MI23-F1-model_v4 VOC family protein 0.9808 5 263
AF-A0A2V7U1G6-F1-model_v4 VOC family protein 0.9775 1 263

Map