F341106

General Info

Members Datasets Scaffolds Average Seq Length
228 165 221 202

Family's Representative Sequence

Representative Sequence 3300031507|Ga0307509_10044847|Ga0307509_100448474
Length 227
Sequence MAFILHAVKRVRCRNKFGMTYFFNIFMITTIIFDLGAVLIDWNPHYMYRTIFSDEEEMKNFLATITTSDWNEEQDAGRPLAEGTEILVKQFPEHEENIRAFYGRWDEMLGDALHDTVEIFKELKESGKYKIYALTNWSAETFPVALERFEFLHWFDGIVVSGAEKMRKPAPEFYQLLLNRHDVKAEEALFIDDNYRNILAAEKLGIQSIHFAGAEVLSEKLRELNVL

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
5 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
6 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
7 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
157 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
158 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
159 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
160 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
161 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
162 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
163 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 0.44
Isolates 3.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.4
Nodule 0
Rhizoplane 0.44
Rhizosphere 81.14
Stem 0
Stem Tuber 0
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008758 3300001979 Bacteria 4015
2 JGI24739J22299_10064362 3300001989 Bacteria 1153
3 JGI24739J22299_10068889 3300001989 Bacteria 1104
4 JGI24737J22298_10000666 3300001990 Bacteria 12137
5 JGI24735J21928_10000084 3300002067 Bacteria 35383
6 JGI25162J39368_1000008 3300002737 Bacteria 397212
7 JGI25162J39368_1000097 3300002737 Bacteria 96520
8 JGI25162J39368_1000673 3300002737 Bacteria 24042
9 JGI25157J39369_1007107 3300002741 Bacteria 1642
10 JGI25164J39214_1000844 3300002772 Bacteria 10567
11 JGI25165J46597_1001114 3300003214 Bacteria 16999
12 rootH1_10002722 3300003316 Bacteria 10718
13 rootL2_10028142 3300003322 Bacteria 3302
14 rootH1_10031165 3300003323 Bacteria 2478
15 rootH1_10033417 3300003323 Bacteria 27769
16 rootH1_10188498 3300003323 Bacteria 2860
17 Ga0058863_10184211 3300004799 Bacteria 716
18 Ga0065704_10129505 3300005289 Bacteria 1647
19 Ga0070658_10196991 3300005327 Bacteria 1699
20 Ga0070683_100030717 3300005329 Bacteria 4880
21 Ga0070670_100231534 3300005331 Unclassified 1608
22 Ga0068869_101127614 3300005334 Bacteria 687
23 Ga0070689_100014060 3300005340 Bacteria 5807
24 Ga0070668_100137353 3300005347 Bacteria 1967
25 Ga0070669_100019580 3300005353 Bacteria 4834
26 Ga0070675_100027435 3300005354 Bacteria 4574
27 Ga0070675_100604446 3300005354 Bacteria 995
28 Ga0070671_100111261 3300005355 Bacteria 2301
29 Ga0070673_100001930 3300005364 Bacteria 12471
30 Ga0070688_100371101 3300005365 Bacteria 1052
31 Ga0070714_100849333 3300005435 Bacteria 885
32 Ga0070701_10054197 3300005438 Bacteria 2090
33 Ga0070700_100170603 3300005441 Bacteria 1506
34 Ga0070663_100055353 3300005455 Bacteria 2839
35 Ga0070662_100087256 3300005457 Bacteria 2335
36 Ga0070681_10256622 3300005458 Bacteria 1660
37 Ga0068867_100337191 3300005459 Bacteria 1254
38 Ga0070679_100025582 3300005530 Bacteria 5794
39 Ga0070684_100100230 3300005535 Bacteria 2586
40 Ga0070672_100748413 3300005543 Bacteria 858
41 Ga0070704_100684664 3300005549 Bacteria 908
42 Ga0068855_100000033 3300005563 Bacteria 167299
43 Ga0068855_100000097 3300005563 Bacteria 106474
44 Ga0068855_100200326 3300005563 Bacteria 2248
45 Ga0068857_100068339 3300005577 Bacteria 3162
46 Ga0068857_100761457 3300005577 Bacteria 923
47 Ga0068854_100072660 3300005578 Bacteria 2519
48 Ga0068854_100153733 3300005578 Bacteria 1776
49 Ga0068856_100000189 3300005614 Bacteria 64684
50 Ga0068859_100535890 3300005617 Bacteria 1265
51 Ga0068866_10260711 3300005718 Bacteria 1065
52 Ga0068861_100010227 3300005719 Bacteria 6513
53 Ga0068858_100327725 3300005842 Bacteria 1464
54 Ga0068860_100482569 3300005843 Bacteria 1236
55 Ga0068862_100015787 3300005844 Bacteria 6275
56 Ga0075366_10000112 3300006195 Bacteria 33220
57 Ga0075366_10001484 3300006195 Bacteria 11706
58 Ga0075370_10193131 3300006353 Bacteria 1200
59 Ga0068871_100341740 3300006358 Bacteria 1322
60 Ga0068865_100194064 3300006881 Bacteria 1572
61 Ga0097620_100535859 3300006931 Bacteria 1265
62 Ga0105240_10080357 3300009093 Bacteria 4010
63 Ga0105240_10133336 3300009093 Bacteria 2977
64 Ga0105240_10396543 3300009093 Bacteria 1555
65 Ga0105240_10570530 3300009093 Bacteria 1249
66 Ga0111539_10005120 3300009094 Bacteria 17001
67 Ga0105243_10526455 3300009148 Bacteria 1125
68 Ga0105241_10019465 3300009174 Bacteria 5006
69 Ga0105237_10031272 3300009545 Bacteria 5398
70 Ga0105237_10037632 3300009545 Bacteria 4888
71 Ga0105237_10176667 3300009545 Bacteria 2135
72 Ga0105237_10879662 3300009545 Bacteria 903
73 Ga0105237_10899593 3300009545 Unclassified 892
74 Ga0105238_10180250 3300009551 Bacteria 2089
75 Ga0105249_10028096 3300009553 Bacteria 5078
76 Ga0105239_10000017 3300010375 Bacteria 290760
77 Ga0105239_10000821 3300010375 Bacteria 44186
78 Ga0105239_10022087 3300010375 Bacteria 7014
79 Ga0105239_10023177 3300010375 Bacteria 6842
80 Ga0105239_10024509 3300010375 Bacteria 6647
81 Ga0105239_10077449 3300010375 Bacteria 3659
82 Ga0157373_10000063 3300013100 Bacteria 95201
83 Ga0157373_10404546 3300013100 Bacteria 979
84 Ga0157371_10021566 3300013102 Bacteria 4728
85 Ga0157371_10404688 3300013102 Bacteria 999
86 Ga0157370_10030621 3300013104 Bacteria 5272
87 Ga0157370_10109621 3300013104 Bacteria 2581
88 Ga0157370_10677755 3300013104 Bacteria 942
89 Ga0157369_10000772 3300013105 Bacteria 41301
90 Ga0157369_10190741 3300013105 Bacteria 2154
91 Ga0157374_10581362 3300013296 Unclassified 1129
92 Ga0157378_10002802 3300013297 Bacteria 15549
93 Ga0163162_10005066 3300013306 Bacteria 12695
94 Ga0163162_10031333 3300013306 Bacteria 5275
95 Ga0163162_10287215 3300013306 Bacteria 1777
96 Ga0163162_10672586 3300013306 Bacteria 1158
97 Ga0157372_10000009 3300013307 Bacteria 302051
98 Ga0157372_10002115 3300013307 Bacteria 21598
99 Ga0157372_10032181 3300013307 Bacteria 5748
100 Ga0157375_10056921 3300013308 Bacteria 3863
101 Ga0157375_10064675 3300013308 Bacteria 3643
102 Ga0157377_10006497 3300014745 Bacteria 5581
103 Ga0207427_100066 3300025231 Bacteria 165770
104 Ga0209437_100010 3300025233 Bacteria 838447
105 Ga0209437_100030 3300025233 Bacteria 532466
106 Ga0209026_1000246 3300025250 Bacteria 69164
107 Ga0209233_1000017 3300025261 Bacteria 898076
108 Ga0209455_1001314 3300025272 Bacteria 11510
109 Ga0207647_10345263 3300025904 Bacteria 843
110 Ga0207705_10403988 3300025909 Unclassified 1057
111 Ga0207695_10032372 3300025913 Bacteria 5722
112 Ga0207695_10527559 3300025913 Bacteria 1062
113 Ga0207671_10011388 3300025914 Bacteria 7247
114 Ga0207671_10025348 3300025914 Bacteria 4455
115 Ga0207671_10052172 3300025914 Bacteria 3030
116 Ga0207671_10107263 3300025914 Bacteria 2121
117 Ga0207671_10755707 3300025914 Bacteria 772
118 Ga0207652_10044645 3300025921 Bacteria 3776
119 Ga0207650_10773297 3300025925 Bacteria 813
120 Ga0207659_10615897 3300025926 Bacteria 926
121 Ga0207664_10716729 3300025929 Bacteria 900
122 Ga0207644_10172247 3300025931 Bacteria 1691
123 Ga0207706_10089732 3300025933 Bacteria 2702
124 Ga0207670_10016354 3300025936 Bacteria 4456
125 Ga0207704_10129274 3300025938 Unclassified 1746
126 Ga0207689_10018345 3300025942 Bacteria 5904
127 Ga0207661_10021762 3300025944 Bacteria 4811
128 Ga0207667_10000046 3300025949 Bacteria 245420
129 Ga0207667_10000190 3300025949 Bacteria 90197
130 Ga0207667_10038939 3300025949 Bacteria 5070
131 Ga0207712_10256910 3300025961 Bacteria 1415
132 Ga0207668_10198433 3300025972 Bacteria 1596
133 Ga0207640_10027874 3300025981 Bacteria 3446
134 Ga0207640_10830529 3300025981 Unclassified 803
135 Ga0207678_10023705 3300026067 Bacteria 5367
136 Ga0207702_10000393 3300026078 Bacteria 49888
137 Ga0207702_10000689 3300026078 Bacteria 36498
138 Ga0207674_10008410 3300026116 Bacteria 11925
139 Ga0207675_100000153 3300026118 Bacteria 60593
140 Ga0207428_10155274 3300027907 Bacteria 1741
141 Ga0268265_10185473 3300028380 Bacteria 1791
142 Ga0268264_11071348 3300028381 Bacteria 814
143 Ga0307515_10037220 3300028794 Bacteria 7833
144 Ga0307515_10040718 3300028794 Bacteria 7337
145 Ga0265338_10133539 3300028800 Bacteria 1955
146 Ga0307509_10044847 3300031507 Bacteria 4774
147 Ga0307408_100007606 3300031548 Bacteria 7166
148 Ga0307412_10027970 3300031911 Bacteria 3522
149 Ga0307416_100061249 3300032002 Bacteria 3070
150 Ga0307507_10000143 3300033179 Bacteria 124248
151 Ga0307510_10000149 3300033180 Bacteria 58176
152 Ga0395899_0001519 3300037312 Bacteria 19624
153 Ga0395900_0151387 3300037418 Bacteria 2370
154 Ga0451577_0563140 3300042876 Unclassified 1034
155 Ga0466969_0036320 3300044656 Bacteria 2489
156 Ga0466966_0015844 3300044684 Bacteria 4981
157 Ga0466961_0003281 3300044693 Bacteria 10080
158 Ga0495638_0150308 3300046460 Bacteria 1351
159 Ga0495651_0115237 3300046462 Bacteria 1982
160 Ga0495650_0000095 3300046471 Bacteria 218020
161 Ga0495585_0000057 3300046492 Bacteria 113069
162 Ga0495585_0000648 3300046492 Bacteria 31937
163 Ga0495583_0019401 3300046506 Bacteria 3551
164 Ga0495606_0005365 3300046507 Bacteria 12298
165 Ga0495606_0015623 3300046507 Bacteria 5835
166 Ga0495606_0192795 3300046507 Bacteria 1167
167 Ga0495610_0001481 3300046512 Bacteria 20679
168 Ga0495616_0004182 3300046513 Bacteria 9144
169 Ga0495616_0005107 3300046513 Bacteria 8155
170 Ga0495631_0151812 3300046518 Bacteria 994
171 Ga0495637_0014556 3300046520 Bacteria 3710
172 Ga0495637_0108145 3300046520 Bacteria 1080
173 Ga0495644_0062937 3300046523 Bacteria 1394
174 Ga0495648_0012007 3300046524 Bacteria 6490
175 Ga0495652_0073197 3300046529 Bacteria 2854
176 Ga0495654_0049937 3300046530 Bacteria 2046
177 Ga0495609_0004798 3300046538 Bacteria 7294
178 Ga0495609_0019321 3300046538 Bacteria 3155
179 Ga0495622_0110770 3300046557 Bacteria 1257
180 Ga0495633_0000275 3300046558 Bacteria 60032
181 Ga0495633_0005239 3300046558 Bacteria 7997
182 Ga0495668_0000017 3300046616 Bacteria 434025
183 Ga0495668_0058054 3300046616 Bacteria 2136
184 Ga0495668_0282862 3300046616 Bacteria 909
185 Ga0495625_0000007 3300046660 Bacteria 565749
186 Ga0495625_0000901 3300046660 Bacteria 39985
187 Ga0495625_0001789 3300046660 Bacteria 24694
188 Ga0495625_0006988 3300046660 Bacteria 9948
189 Ga0495625_0365365 3300046660 Bacteria 909
190 Ga0495661_0004589 3300046665 Bacteria 9940
191 Ga0495661_0018148 3300046665 Unclassified 4633
192 Ga0495661_0084375 3300046665 Bacteria 1823
193 Ga0495661_0166866 3300046665 Bacteria 1177
194 Ga0495670_0209745 3300046691 Bacteria 1033
195 Ga0495671_0031528 3300046692 Bacteria 2710
196 Ga0495649_0000007 3300046694 Bacteria 518037
197 Ga0495600_0054257 3300046809 Bacteria 2618
198 Ga0495660_0004990 3300046810 Bacteria 7985
199 Ga0495687_025743 3300047443 Bacteria 2775
200 Ga0495687_083714 3300047443 Bacteria 1241
201 Ga0495679_059093 3300047446 Bacteria 1129
202 Ga0495686_0000490 3300047472 Bacteria 58423
203 Ga0495593_0075396 3300047673 Bacteria 1749
204 Ga0495614_0013009 3300048089 Bacteria 3648
205 Ga0496126_0316960 3300048929 Bacteria 1283
206 Ga0495678_013051 3300049459 Bacteria 3915
207 Ga0495682_0045904 3300049460 Bacteria 1596
208 nmdc:mga0k408_5981_c1 3300050493 Bacteria 6496
209 nmdc:mga0k408_63_c1 3300050493 Bacteria 52809
210 nmdc:mga07m45_135745_c1 3300050496 Bacteria 1424
211 nmdc:mga08y16_39005_c1 3300050511 Bacteria 4985
212 Ga0500635_0007387 3300053080 Bacteria 2979
213 Ga0500647_0282775 3300053091 Bacteria 716
214 Ga0500650_0133864 3300053098 Bacteria 1151
215 Ga0500608_008426 3300053122 Bacteria 4332
216 Ga0500618_000021 3300053125 Bacteria 160813
217 Ga0500642_0017631 3300053130 Bacteria 2742
218 Ga0500652_173105 3300053131 Bacteria 888
219 Ga0500564_017776 3300053138 Bacteria 3235
220 Ga0500616_0081824 3300053153 Bacteria 1621
221 Ga0500624_000688 3300053157 Bacteria 8589

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100030717 Ga0070683_1000307173 196
2 3300005331 Ga0070670_100231534 Ga0070670_1002315342 196
3 3300005355 Ga0070671_100111261 Ga0070671_1001112612 196
4 3300005535 Ga0070684_100100230 Ga0070684_1001002302 196
5 3300025931 Ga0207644_10172247 Ga0207644_101722472 196
6 3300025944 Ga0207661_10021762 Ga0207661_100217623 196
7 iso_pu_bacteria 2599185184 2599481164 197
8 iso_pu_bacteria 2852623160 2852626378 197
9 iso_pu_bacteria 2884933994 2884934830 197
10 iso_pu_bacteria 2928078545 2928081758 197
11 iso_pu_bacteria 2928147474 2928151785 197
12 iso_pu_bacteria 2932082852 2932087096 197
13 3300002741 JGI25157J39369_1007107 JGI25157J39369_10071072 199
14 3300025250 Ga0209026_1000246 Ga0209026_10002468 199
15 3300003323 rootH1_10031165 rootH1_100311654 200
16 3300009545 Ga0105237_10031272 Ga0105237_100312723 200
17 3300010375 Ga0105239_10024509 Ga0105239_100245095 200
18 3300013100 Ga0157373_10000063 Ga0157373_1000006324 200
19 3300013307 Ga0157372_10002115 Ga0157372_100021159 200
20 3300001989 JGI24739J22299_10064362 JGI24739J22299_100643622 201
21 3300001989 JGI24739J22299_10068889 JGI24739J22299_100688892 201
22 3300001990 JGI24737J22298_10000666 JGI24737J22298_100006667 201
23 3300002067 JGI24735J21928_10000084 JGI24735J21928_1000008431 201
24 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008405 201
25 3300002737 JGI25162J39368_1000097 JGI25162J39368_100009760 201
26 3300002737 JGI25162J39368_1000673 JGI25162J39368_100067325 201
27 3300002772 JGI25164J39214_1000844 JGI25164J39214_10008443 201
28 3300003214 JGI25165J46597_1001114 JGI25165J46597_10011145 201
29 3300003316 rootH1_10002722 rootH1_100027226 201
30 3300003322 rootL2_10028142 rootL2_100281423 201
31 3300003323 rootH1_10033417 rootH1_100334176 201
32 3300003323 rootH1_10188498 rootH1_101884981 201
33 3300004799 Ga0058863_10184211 Ga0058863_101842111 201
34 3300005334 Ga0068869_101127614 Ga0068869_1011276141 201
35 3300005340 Ga0070689_100014060 Ga0070689_1000140602 201
36 3300005347 Ga0070668_100137353 Ga0070668_1001373532 201
37 3300005353 Ga0070669_100019580 Ga0070669_1000195802 201
38 3300005354 Ga0070675_100027435 Ga0070675_1000274352 201
39 3300005364 Ga0070673_100001930 Ga0070673_10000193015 201
40 3300005365 Ga0070688_100371101 Ga0070688_1003711012 201
41 3300005435 Ga0070714_100849333 Ga0070714_1008493332 201
42 3300005438 Ga0070701_10054197 Ga0070701_100541972 201
43 3300005441 Ga0070700_100170603 Ga0070700_1001706032 201
44 3300005457 Ga0070662_100087256 Ga0070662_1000872562 201
45 3300005458 Ga0070681_10256622 Ga0070681_102566222 201
46 3300005459 Ga0068867_100337191 Ga0068867_1003371911 201
47 3300005530 Ga0070679_100025582 Ga0070679_1000255828 201
48 3300005549 Ga0070704_100684664 Ga0070704_1006846641 201
49 3300005563 Ga0068855_100000033 Ga0068855_10000003315 201
50 3300005563 Ga0068855_100000097 Ga0068855_10000009787 201
51 3300005563 Ga0068855_100200326 Ga0068855_1002003263 201
52 3300005577 Ga0068857_100761457 Ga0068857_1007614571 201
53 3300005578 Ga0068854_100072660 Ga0068854_1000726603 201
54 3300005578 Ga0068854_100153733 Ga0068854_1001537332 201
55 3300005617 Ga0068859_100535890 Ga0068859_1005358902 201
56 3300005718 Ga0068866_10260711 Ga0068866_102607112 201
57 3300005719 Ga0068861_100010227 Ga0068861_1000102273 201
58 3300005842 Ga0068858_100327725 Ga0068858_1003277252 201
59 3300005843 Ga0068860_100482569 Ga0068860_1004825692 201
60 3300005844 Ga0068862_100015787 Ga0068862_1000157872 201
61 3300006195 Ga0075366_10000112 Ga0075366_1000011231 201
62 3300006195 Ga0075366_10001484 Ga0075366_100014843 201
63 3300006353 Ga0075370_10193131 Ga0075370_101931312 201
64 3300006881 Ga0068865_100194064 Ga0068865_1001940642 201
65 3300006931 Ga0097620_100535859 Ga0097620_1005358592 201
66 3300009093 Ga0105240_10080357 Ga0105240_100803572 201
67 3300009093 Ga0105240_10133336 Ga0105240_101333362 201
68 3300009093 Ga0105240_10396543 Ga0105240_103965432 201
69 3300009093 Ga0105240_10570530 Ga0105240_105705302 201
70 3300009094 Ga0111539_10005120 Ga0111539_1000512010 201
71 3300009148 Ga0105243_10526455 Ga0105243_105264552 201
72 3300009174 Ga0105241_10019465 Ga0105241_100194653 201
73 3300009545 Ga0105237_10037632 Ga0105237_100376324 201
74 3300009545 Ga0105237_10176667 Ga0105237_101766672 201
75 3300009545 Ga0105237_10879662 Ga0105237_108796622 201
76 3300009545 Ga0105237_10899593 Ga0105237_108995932 201
77 3300009551 Ga0105238_10180250 Ga0105238_101802502 201
78 3300009553 Ga0105249_10028096 Ga0105249_100280962 201
79 3300010375 Ga0105239_10000017 Ga0105239_10000017170 201
80 3300010375 Ga0105239_10000821 Ga0105239_1000082129 201
81 3300010375 Ga0105239_10022087 Ga0105239_100220873 201
82 3300010375 Ga0105239_10077449 Ga0105239_100774495 201
83 3300013100 Ga0157373_10404546 Ga0157373_104045461 201
84 3300013102 Ga0157371_10404688 Ga0157371_104046881 201
85 3300013104 Ga0157370_10109621 Ga0157370_101096213 201
86 3300013104 Ga0157370_10677755 Ga0157370_106777552 201
87 3300013105 Ga0157369_10190741 Ga0157369_101907413 201
88 3300013297 Ga0157378_10002802 Ga0157378_100028027 201
89 3300013306 Ga0163162_10005066 Ga0163162_100050669 201
90 3300013306 Ga0163162_10287215 Ga0163162_102872154 201
91 3300013306 Ga0163162_10672586 Ga0163162_106725861 201
92 3300013307 Ga0157372_10032181 Ga0157372_100321817 201
93 3300013308 Ga0157375_10056921 Ga0157375_100569213 201
94 3300013308 Ga0157375_10064675 Ga0157375_100646753 201
95 3300014745 Ga0157377_10006497 Ga0157377_100064977 201
96 3300025231 Ga0207427_100066 Ga0207427_10006682 201
97 3300025233 Ga0209437_100010 Ga0209437_100010197 201
98 3300025233 Ga0209437_100030 Ga0209437_10003044 201
99 3300025261 Ga0209233_1000017 Ga0209233_1000017210 201
100 3300025272 Ga0209455_1001314 Ga0209455_10013147 201
101 3300025904 Ga0207647_10345263 Ga0207647_103452632 201
102 3300025913 Ga0207695_10032372 Ga0207695_100323724 201
103 3300025913 Ga0207695_10527559 Ga0207695_105275592 201
104 3300025914 Ga0207671_10011388 Ga0207671_100113884 201
105 3300025914 Ga0207671_10025348 Ga0207671_100253483 201
106 3300025914 Ga0207671_10052172 Ga0207671_100521724 201
107 3300025914 Ga0207671_10107263 Ga0207671_101072633 201
108 3300025914 Ga0207671_10755707 Ga0207671_107557071 201
109 3300025921 Ga0207652_10044645 Ga0207652_100446454 201
110 3300025925 Ga0207650_10773297 Ga0207650_107732971 201
111 3300025926 Ga0207659_10615897 Ga0207659_106158971 201
112 3300025929 Ga0207664_10716729 Ga0207664_107167292 201
113 3300025933 Ga0207706_10089732 Ga0207706_100897322 201
114 3300025936 Ga0207670_10016354 Ga0207670_100163541 201
115 3300025938 Ga0207704_10129274 Ga0207704_101292742 201
116 3300025942 Ga0207689_10018345 Ga0207689_100183454 201
117 3300025949 Ga0207667_10000046 Ga0207667_1000004694 201
118 3300025949 Ga0207667_10000190 Ga0207667_1000019086 201
119 3300025949 Ga0207667_10038939 Ga0207667_100389394 201
120 3300025961 Ga0207712_10256910 Ga0207712_102569102 201
121 3300025972 Ga0207668_10198433 Ga0207668_101984332 201
122 3300025981 Ga0207640_10027874 Ga0207640_100278743 201
123 3300026078 Ga0207702_10000689 Ga0207702_100006892 201
124 3300026116 Ga0207674_10008410 Ga0207674_1000841013 201
125 3300026118 Ga0207675_100000153 Ga0207675_10000015312 201
126 3300027907 Ga0207428_10155274 Ga0207428_101552742 201
127 3300028380 Ga0268265_10185473 Ga0268265_101854732 201
128 3300028381 Ga0268264_11071348 Ga0268264_110713482 201
129 3300028794 Ga0307515_10037220 Ga0307515_100372205 201
130 3300028794 Ga0307515_10040718 Ga0307515_100407185 201
131 3300028800 Ga0265338_10133539 Ga0265338_101335393 201
132 3300031507 Ga0307509_10044847 Ga0307509_100448474 201
133 3300031548 Ga0307408_100007606 Ga0307408_1000076064 201
134 3300033179 Ga0307507_10000143 Ga0307507_1000014384 201
135 3300037418 Ga0395900_0151387 Ga0395900_0151387_1302_1916 201
136 3300042876 Ga0451577_0563140 Ga0451577_0563140_223_834 201
137 3300046460 Ga0495638_0150308 Ga0495638_0150308_557_1162 201
138 3300046462 Ga0495651_0115237 Ga0495651_0115237_418_1023 201
139 3300046471 Ga0495650_0000095 Ga0495650_0000095_109283_109888 201
140 3300046492 Ga0495585_0000057 Ga0495585_0000057_106016_106621 201
141 3300046492 Ga0495585_0000648 Ga0495585_0000648_189_794 201
142 3300046506 Ga0495583_0019401 Ga0495583_0019401_738_1343 201
143 3300046507 Ga0495606_0015623 Ga0495606_0015623_1461_2066 201
144 3300046507 Ga0495606_0192795 Ga0495606_0192795_145_750 201
145 3300046512 Ga0495610_0001481 Ga0495610_0001481_14143_14748 201
146 3300046513 Ga0495616_0004182 Ga0495616_0004182_6777_7382 201
147 3300046513 Ga0495616_0005107 Ga0495616_0005107_5832_6437 201
148 3300046518 Ga0495631_0151812 Ga0495631_0151812_287_892 201
149 3300046520 Ga0495637_0014556 Ga0495637_0014556_487_1092 201
150 3300046520 Ga0495637_0108145 Ga0495637_0108145_416_1021 201
151 3300046523 Ga0495644_0062937 Ga0495644_0062937_493_1098 201
152 3300046524 Ga0495648_0012007 Ga0495648_0012007_5006_5611 201
153 3300046529 Ga0495652_0073197 Ga0495652_0073197_1530_2135 201
154 3300046530 Ga0495654_0049937 Ga0495654_0049937_1163_1768 201
155 3300046538 Ga0495609_0004798 Ga0495609_0004798_5643_6248 201
156 3300046538 Ga0495609_0019321 Ga0495609_0019321_948_1553 201
157 3300046557 Ga0495622_0110770 Ga0495622_0110770_180_785 201
158 3300046558 Ga0495633_0000275 Ga0495633_0000275_4172_4777 201
159 3300046558 Ga0495633_0005239 Ga0495633_0005239_2655_3260 201
160 3300046616 Ga0495668_0000017 Ga0495668_0000017_206829_207434 201
161 3300046616 Ga0495668_0058054 Ga0495668_0058054_664_1269 201
162 3300046616 Ga0495668_0282862 Ga0495668_0282862_252_857 201
163 3300046660 Ga0495625_0000007 Ga0495625_0000007_192002_192607 201
164 3300046660 Ga0495625_0000901 Ga0495625_0000901_28063_28668 201
165 3300046660 Ga0495625_0001789 Ga0495625_0001789_10762_11367 201
166 3300046660 Ga0495625_0006988 Ga0495625_0006988_7567_8172 201
167 3300046660 Ga0495625_0365365 Ga0495625_0365365_213_818 201
168 3300046665 Ga0495661_0004589 Ga0495661_0004589_1868_2473 201
169 3300046665 Ga0495661_0018148 Ga0495661_0018148_3168_3773 201
170 3300046665 Ga0495661_0084375 Ga0495661_0084375_89_694 201
171 3300046665 Ga0495661_0166866 Ga0495661_0166866_417_1022 201
172 3300046691 Ga0495670_0209745 Ga0495670_0209745_230_835 201
173 3300046692 Ga0495671_0031528 Ga0495671_0031528_482_1087 201
174 3300046694 Ga0495649_0000007 Ga0495649_0000007_242555_243160 201
175 3300046809 Ga0495600_0054257 Ga0495600_0054257_706_1311 201
176 3300046810 Ga0495660_0004990 Ga0495660_0004990_1522_2127 201
177 3300047443 Ga0495687_025743 Ga0495687_025743_1466_2071 201
178 3300047443 Ga0495687_083714 Ga0495687_083714_105_710 201
179 3300047446 Ga0495679_059093 Ga0495679_059093_356_961 201
180 3300047472 Ga0495686_0000490 Ga0495686_0000490_35175_35780 201
181 3300047673 Ga0495593_0075396 Ga0495593_0075396_816_1421 201
182 3300048089 Ga0495614_0013009 Ga0495614_0013009_1218_1823 201
183 3300048929 Ga0496126_0316960 Ga0496126_0316960_597_1202 201
184 3300049459 Ga0495678_013051 Ga0495678_013051_1385_1990 201
185 3300049460 Ga0495682_0045904 Ga0495682_0045904_406_1011 201
186 3300050493 nmdc:mga0k408_5981_c1 nmdc:mga0k408_5981_c1_4679_5284 201
187 3300050493 nmdc:mga0k408_63_c1 nmdc:mga0k408_63_c1_23380_23985 201
188 3300050496 nmdc:mga07m45_135745_c1 nmdc:mga07m45_135745_c1_452_1057 201
189 3300050511 nmdc:mga08y16_39005_c1 nmdc:mga08y16_39005_c1_3388_4002 201
190 3300053080 Ga0500635_0007387 Ga0500635_0007387_371_976 201
191 3300053091 Ga0500647_0282775 Ga0500647_0282775_35_640 201
192 3300053122 Ga0500608_008426 Ga0500608_008426_3654_4259 201
193 3300053125 Ga0500618_000021 Ga0500618_000021_110189_110794 201
194 3300053130 Ga0500642_0017631 Ga0500642_0017631_656_1261 201
195 3300053131 Ga0500652_173105 Ga0500652_173105_151_756 201
196 3300053138 Ga0500564_017776 Ga0500564_017776_2132_2737 201
197 3300053153 Ga0500616_0081824 Ga0500616_0081824_505_1110 201
198 3300053157 Ga0500624_000688 Ga0500624_000688_6322_6927 201
199 iso_pu_bacteria 2977232053 2977235322 201
200 3300001979 JGI24740J21852_10008758 JGI24740J21852_100087583 202
201 3300005289 Ga0065704_10129505 Ga0065704_101295052 202
202 3300005327 Ga0070658_10196991 Ga0070658_101969913 202
203 3300005354 Ga0070675_100604446 Ga0070675_1006044462 202
204 3300005455 Ga0070663_100055353 Ga0070663_1000553532 202
205 3300005543 Ga0070672_100748413 Ga0070672_1007484132 202
206 3300005577 Ga0068857_100068339 Ga0068857_1000683393 202
207 3300005614 Ga0068856_100000189 Ga0068856_10000018938 202
208 3300006358 Ga0068871_100341740 Ga0068871_1003417401 202
209 3300010375 Ga0105239_10023177 Ga0105239_100231776 202
210 3300013102 Ga0157371_10021566 Ga0157371_100215662 202
211 3300013104 Ga0157370_10030621 Ga0157370_100306212 202
212 3300013105 Ga0157369_10000772 Ga0157369_1000077213 202
213 3300013296 Ga0157374_10581362 Ga0157374_105813622 202
214 3300013306 Ga0163162_10031333 Ga0163162_100313332 202
215 3300013307 Ga0157372_10000009 Ga0157372_10000009130 202
216 3300025909 Ga0207705_10403988 Ga0207705_104039882 202
217 3300025981 Ga0207640_10830529 Ga0207640_108305291 202
218 3300026067 Ga0207678_10023705 Ga0207678_100237052 202
219 3300026078 Ga0207702_10000393 Ga0207702_1000039322 202
220 3300031911 Ga0307412_10027970 Ga0307412_100279702 202
221 3300032002 Ga0307416_100061249 Ga0307416_1000612492 202
222 3300033180 Ga0307510_10000149 Ga0307510_100001499 202
223 3300037312 Ga0395899_0001519 Ga0395899_0001519_10302_10910 202
224 3300044656 Ga0466969_0036320 Ga0466969_0036320_1495_2103 202
225 3300044684 Ga0466966_0015844 Ga0466966_0015844_1965_2573 202
226 3300044693 Ga0466961_0003281 Ga0466961_0003281_7004_7612 202
227 3300046507 Ga0495606_0005365 Ga0495606_0005365_11565_12173 202
228 3300053098 Ga0500650_0133864 Ga0500650_0133864_488_1096 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

165

223

0.94

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

28

205

0.78

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

31

211

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b0c-assembly1.cif.gz_A-2 the crystal structure of the putative phosphatase from escherichia coli 0.8017 1 197
2b0c-assembly1.cif.gz_A-2 the crystal structure of the putative phosphatase from escherichia coli 0.7909 1 197
1x42-assembly1.cif.gz_A crystal structure of a haloacid dehalogenase family protein (ph0459) from pyrococcus horikoshii ot3 0.7813 1 198
2om6-assembly1.cif.gz_B hypothetical protein (probable phosphoserine phosph (ph0253) from pyrococcus horikoshii ot3 0.7768 2 186
3cnh-assembly2.cif.gz_B crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (np_295428.1) from deinococcus radiodurans at 1.66 a resolution 0.7761 1 201
ID Description Score Start End Superfamily
3cnhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9199 1 201 3.40.50.1000
3cnhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9128 1 201 3.40.50.1000
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8993 86 182 3.40.50.1000
af_Q9W4J7_113_224_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8955 88 185 3.40.50.1000
af_Q7T012_106_236_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8905 92 186 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2D6Y935-F1-model_v4 HAD family hydrolase 0.9776 1 202 GO:0016787
AF-A0A3R7TE67-F1-model_v4 HAD family phosphatase 0.9772 2 202
AF-A0A7V4YYL6-F1-model_v4 HAD family phosphatase 0.9762 2 187
AF-A0A5N1JJW0-F1-model_v4 HAD family phosphatase 0.9758 1 202
AF-A0A7Y1Z9G6-F1-model_v4 HAD family phosphatase 0.9756 2 202

Feature Viewer

pLDDT pTM Quality
95.52 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map