F340723

General Info

Members Datasets Scaffolds Average Seq Length
228 135 228 92

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100097931|Ga0070708_1000979313
Length 93
Sequence MPRVTFEDQGRAAEFPEGKTLLKCALEMGVVISHVCGGDGACGTCRVEVPDGSWDHLTPPTPDETYKELERPHRLSCQAKLIGDVIVKVAKVD

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 95.61
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10311945 3300005293 Archaea 1019
2 Ga0070658_10112003 3300005327 Bacteria 2262
3 Ga0070676_10195807 3300005328 Bacteria 1322
4 Ga0070676_10411647 3300005328 Bacteria 943
5 Ga0070683_100000113 3300005329 Bacteria 53083
6 Ga0070690_100247018 3300005330 Bacteria 1261
7 Ga0070670_100000041 3300005331 Bacteria 147849
8 Ga0070670_100008464 3300005331 Bacteria 8776
9 Ga0070670_101633392 3300005331 Unclassified 593
10 Ga0068869_100001899 3300005334 Bacteria 12569
11 Ga0068869_100971898 3300005334 Bacteria 738
12 Ga0070680_100004153 3300005336 Bacteria 10847
13 Ga0070682_101755665 3300005337 Bacteria 540
14 Ga0068868_100000612 3300005338 Bacteria 23976
15 Ga0068868_100002260 3300005338 Bacteria 13319
16 Ga0070689_100005927 3300005340 Bacteria 8409
17 Ga0070689_100822464 3300005340 Bacteria 818
18 Ga0070687_100181647 3300005343 Bacteria 1260
19 Ga0070661_101007964 3300005344 Bacteria 691
20 Ga0070692_10134498 3300005345 Bacteria 1393
21 Ga0070692_10432937 3300005345 Bacteria 838
22 Ga0070675_100000009 3300005354 Bacteria 245759
23 Ga0070674_100273412 3300005356 Unclassified 1336
24 Ga0070674_100340371 3300005356 Bacteria 1208
25 Ga0070674_101033851 3300005356 Unclassified 722
26 Ga0070673_100049465 3300005364 Bacteria 3283
27 Ga0070673_100228027 3300005364 Bacteria 1615
28 Ga0070673_101092750 3300005364 Bacteria 745
29 Ga0070710_11067741 3300005437 Unclassified 591
30 Ga0070701_10024665 3300005438 Bacteria 2911
31 Ga0070708_100067949 3300005445 Bacteria 3202
32 Ga0070708_100097931 3300005445 Unclassified 2682
33 Ga0070678_100224102 3300005456 Bacteria 1564
34 Ga0070678_100428706 3300005456 Unclassified 1154
35 Ga0070706_100002247 3300005467 Bacteria 19604
36 Ga0070706_100046116 3300005467 Bacteria 4023
37 Ga0070706_100098418 3300005467 Bacteria 2718
38 Ga0070707_100052958 3300005468 Bacteria 3891
39 Ga0070707_100237547 3300005468 Bacteria 1774
40 Ga0070707_100583222 3300005468 Unclassified 1080
41 Ga0070698_100095839 3300005471 Bacteria 2944
42 Ga0070698_100186851 3300005471 Unclassified 2010
43 Ga0070699_100019275 3300005518 Bacteria 5871
44 Ga0070699_100020283 3300005518 Bacteria 5731
45 Ga0070699_100285570 3300005518 Bacteria 1478
46 Ga0070699_101691272 3300005518 Unclassified 579
47 Ga0070679_101798124 3300005530 Unclassified 561
48 Ga0070684_100001793 3300005535 Bacteria 15696
49 Ga0070684_100812589 3300005535 Bacteria 874
50 Ga0070684_101779598 3300005535 Bacteria 581
51 Ga0070697_100060031 3300005536 Bacteria 3098
52 Ga0070697_100121862 3300005536 Bacteria 2182
53 Ga0070697_101637461 3300005536 Unclassified 576
54 Ga0068853_100196868 3300005539 Bacteria 1833
55 Ga0068853_100365254 3300005539 Unclassified 1345
56 Ga0070672_100000899 3300005543 Bacteria 17875
57 Ga0070686_100399327 3300005544 Unclassified 1045
58 Ga0070686_101782322 3300005544 Bacteria 524
59 Ga0070696_101183788 3300005546 Bacteria 645
60 Ga0070696_101517583 3300005546 Bacteria 574
61 Ga0068857_100025018 3300005577 Bacteria 5259
62 Ga0068854_100019615 3300005578 Bacteria 4559
63 Ga0068854_100912176 3300005578 Unclassified 773
64 Ga0070702_100496505 3300005615 Unclassified 895
65 Ga0070702_100540572 3300005615 Bacteria 863
66 Ga0070702_100554094 3300005615 Unclassified 854
67 Ga0068852_100995099 3300005616 Bacteria 857
68 Ga0068864_100000040 3300005618 Bacteria 171863
69 Ga0068864_102185434 3300005618 Unclassified 560
70 Ga0068870_10084259 3300005840 Unclassified 1764
71 Ga0068863_100871342 3300005841 Bacteria 900
72 Ga0068858_100686937 3300005842 Unclassified 996
73 Ga0070717_10000073 3300006028 Bacteria 84057
74 Ga0070717_10530786 3300006028 Bacteria 1065
75 Ga0070717_10662290 3300006028 Bacteria 948
76 Ga0070716_100115959 3300006173 Bacteria 1668
77 Ga0097621_101688963 3300006237 Unclassified 603
78 Ga0068871_100398115 3300006358 Unclassified 1226
79 Ga0075428_100941109 3300006844 Bacteria 916
80 Ga0075431_100022923 3300006847 Bacteria 6382
81 Ga0075433_10601942 3300006852 Bacteria 965
82 Ga0075434_100437610 3300006871 Bacteria 1329
83 Ga0068865_100017514 3300006881 Bacteria 4608
84 Ga0068865_102127675 3300006881 Unclassified 510
85 Ga0075436_100017349 3300006914 Bacteria 4928
86 Ga0075436_100694999 3300006914 Unclassified 753
87 Ga0075435_100000060 3300007076 Bacteria 55995
88 Ga0075435_100022079 3300007076 Bacteria 4907
89 Ga0105244_10133116 3300009036 Bacteria 1199
90 Ga0105240_10103556 3300009093 Bacteria 3458
91 Ga0111539_10000054 3300009094 Bacteria 115242
92 Ga0105245_10000066 3300009098 Bacteria 109321
93 Ga0105245_10000927 3300009098 Bacteria 26636
94 Ga0105245_10005771 3300009098 Bacteria 10862
95 Ga0105245_10325386 3300009098 Unclassified 1516
96 Ga0105245_10751686 3300009098 Bacteria 1011
97 Ga0114129_10531803 3300009147 Bacteria 1531
98 Ga0105243_11804375 3300009148 Bacteria 643
99 Ga0105241_12524202 3300009174 Unclassified 515
100 Ga0105242_10024874 3300009176 Bacteria 4732
101 Ga0105238_10000001 3300009551 Bacteria 2036163
102 Ga0105239_10048010 3300010375 Bacteria 4680
103 Ga0105246_12196870 3300011119 Unclassified 537
104 Ga0157369_10002844 3300013105 Bacteria 20665
105 Ga0157374_10000021 3300013296 Bacteria 272840
106 Ga0157378_10000572 3300013297 Bacteria 34793
107 Ga0157378_10002268 3300013297 Bacteria 17079
108 Ga0157378_10097853 3300013297 Bacteria 2675
109 Ga0163162_10011697 3300013306 Bacteria 8557
110 Ga0163162_11756090 3300013306 Bacteria 709
111 Ga0157375_10000004 3300013308 Bacteria 474935
112 Ga0157375_10000035 3300013308 Bacteria 179166
113 Ga0157375_10001181 3300013308 Bacteria 22565
114 Ga0157375_11673355 3300013308 Bacteria 753
115 Ga0157375_13779160 3300013308 Unclassified 503
116 Ga0157380_10002136 3300014326 Bacteria 13261
117 Ga0157380_12023192 3300014326 Bacteria 638
118 Ga0157377_10000009 3300014745 Bacteria 385287
119 Ga0157377_10000227 3300014745 Bacteria 29511
120 Ga0157377_10240166 3300014745 Archaea 1169
121 Ga0157376_10000020 3300014969 Bacteria 246318
122 Ga0213873_10010945 3300021358 Bacteria 1927
123 Ga0213876_10000012 3300021384 Bacteria 396530
124 Ga0213876_10011520 3300021384 Bacteria 4719
125 Ga0213876_10021085 3300021384 Bacteria 3445
126 Ga0207655_1103072 3300025728 Unclassified 978
127 Ga0207692_10422300 3300025898 Bacteria 835
128 Ga0207692_10742596 3300025898 Unclassified 639
129 Ga0207699_10938784 3300025906 Unclassified 639
130 Ga0207645_10258599 3300025907 Bacteria 1153
131 Ga0207645_10918869 3300025907 Unclassified 594
132 Ga0207643_10020905 3300025908 Bacteria 3592
133 Ga0207705_10075892 3300025909 Bacteria 2442
134 Ga0207684_10042915 3300025910 Bacteria 3834
135 Ga0207684_10154391 3300025910 Bacteria 1975
136 Ga0207684_10721380 3300025910 Bacteria 846
137 Ga0207695_10083651 3300025913 Bacteria 3223
138 Ga0207660_10066627 3300025917 Bacteria 2606
139 Ga0207662_10153661 3300025918 Bacteria 1466
140 Ga0207662_10915519 3300025918 Bacteria 621
141 Ga0207646_10020981 3300025922 Bacteria 6042
142 Ga0207646_10065175 3300025922 Bacteria 3252
143 Ga0207646_10078318 3300025922 Bacteria 2955
144 Ga0207646_10190025 3300025922 Bacteria 1855
145 Ga0207646_10817919 3300025922 Bacteria 829
146 Ga0207694_10000001 3300025924 Bacteria 4078485
147 Ga0207650_10000088 3300025925 Bacteria 123236
148 Ga0207650_10042872 3300025925 Bacteria 3319
149 Ga0207659_10000007 3300025926 Bacteria 322984
150 Ga0207687_10000003 3300025927 Bacteria 875159
151 Ga0207687_10000157 3300025927 Bacteria 45617
152 Ga0207687_10004934 3300025927 Bacteria 8857
153 Ga0207687_10134220 3300025927 Bacteria 1870
154 Ga0207700_10210181 3300025928 Bacteria 1645
155 Ga0207700_10720503 3300025928 Unclassified 891
156 Ga0207664_10308953 3300025929 Bacteria 1393
157 Ga0207644_10141212 3300025931 Bacteria 1855
158 Ga0207686_10046476 3300025934 Bacteria 2678
159 Ga0207709_11059649 3300025935 Bacteria 664
160 Ga0207670_10002887 3300025936 Bacteria 9070
161 Ga0207670_10278038 3300025936 Bacteria 1304
162 Ga0207669_10058773 3300025937 Bacteria 2348
163 Ga0207669_10922305 3300025937 Bacteria 731
164 Ga0207704_10162358 3300025938 Bacteria 1591
165 Ga0207704_10946388 3300025938 Unclassified 726
166 Ga0207665_10130395 3300025939 Bacteria 1784
167 Ga0207665_10549984 3300025939 Unclassified 897
168 Ga0207691_10001146 3300025940 Bacteria 26298
169 Ga0207689_10003419 3300025942 Bacteria 14492
170 Ga0207689_10107036 3300025942 Bacteria 2298
171 Ga0207689_11296795 3300025942 Unclassified 612
172 Ga0207689_11361260 3300025942 Bacteria 595
173 Ga0207661_10000001 3300025944 Bacteria 937688
174 Ga0207661_10558270 3300025944 Bacteria 1049
175 Ga0207661_11405972 3300025944 Unclassified 640
176 Ga0207651_10290606 3300025960 Bacteria 1355
177 Ga0207651_10598177 3300025960 Bacteria 964
178 Ga0207640_10006779 3300025981 Bacteria 6303
179 Ga0207640_10013881 3300025981 Bacteria 4625
180 Ga0207640_10098382 3300025981 Bacteria 2045
181 Ga0207677_10000009 3300026023 Bacteria 252751
182 Ga0207677_10000786 3300026023 Bacteria 18194
183 Ga0207703_10000182 3300026035 Bacteria 73233
184 Ga0207639_10000003 3300026041 Bacteria 806887
185 Ga0207639_10283447 3300026041 Unclassified 1458
186 Ga0207708_10000001 3300026075 Bacteria 467100
187 Ga0207641_10699630 3300026088 Archaea 998
188 Ga0207676_10000013 3300026095 Bacteria 343067
189 Ga0207674_10013030 3300026116 Bacteria 9262
190 Ga0207675_100349213 3300026118 Bacteria 1449
191 Ga0207683_10113429 3300026121 Bacteria 2427
192 Ga0207683_10527970 3300026121 Unclassified 1091
193 Ga0207683_11945556 3300026121 Bacteria 537
194 Ga0207428_10000581 3300027907 Bacteria 43128
195 Ga0307511_10008320 3300030521 Bacteria 10384
196 Ga0307416_102564703 3300032002 Unclassified 608
197 Ga0307416_103634028 3300032002 Bacteria 516
198 Ga0307411_10772290 3300032005 Bacteria 844
199 Ga0307415_100621082 3300032126 Unclassified 965
200 Ga0373932_0001131 3300035112 Bacteria 7686
201 Ga0373943_0531193 3300035170 Bacteria 689
202 Ga0436365_0120716 3300039437 Bacteria 90169
203 Ga0436365_0362725 3300039437 Bacteria 2840
204 Ga0436365_1172437 3300039437 Bacteria 5782
205 Ga0436363_1236089 3300039450 Bacteria 908
206 Ga0436362_0931096 3300039453 Bacteria 4074
207 Ga0451839_0677481 3300041496 Bacteria 4417
208 Ga0451853_3306193 3300041512 Unclassified 550
209 Ga0453683_1133427 3300044673 Bacteria 522
210 Ga0451576_1120730 3300045051 Bacteria 823
211 Ga0495598_0117913 3300046537 Bacteria 897
212 Ga0495679_007835 3300047446 Bacteria 4405
213 Ga0501074_0637981 3300049590 Bacteria 753
214 nmdc:mga05p37_150832_c1 3300050507 Bacteria 2843
215 nmdc:mga05p37_534377_c1 3300050507 Bacteria 1338
216 nmdc:mga06r32_9428_c1 3300050510 Bacteria 8807
217 nmdc:mga08y16_28_c1 3300050511 Bacteria 201429
218 nmdc:mga0n895_1607368_c1 3300050512 Bacteria 614
219 nmdc:mga0n895_2148106_c1 3300050512 Bacteria 514
220 nmdc:mga0n895_928555_c1 3300050512 Bacteria 854
221 nmdc:mga0rr50_1184479_c1 3300050513 Bacteria 649
222 nmdc:mga0rr50_125_c1 3300050513 Bacteria 42801
223 nmdc:mga0rr50_20352_c1 3300050513 Bacteria 4504
224 nmdc:mga08x19_642809_c1 3300050514 Unclassified 752
225 nmdc:mga08x19_646443_c1 3300050514 Bacteria 750
226 nmdc:mga08x19_776_c1 3300050514 Bacteria 20338
227 nmdc:mga0a205_588943_c1 3300050515 Bacteria 966
228 Ga0495655_0000194 3300053083 Bacteria 11396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005293 Ga0065715_10311945 Ga0065715_103119452 89
2 3300005327 Ga0070658_10112003 Ga0070658_101120032 89
3 3300005328 Ga0070676_10195807 Ga0070676_101958072 89
4 3300005328 Ga0070676_10411647 Ga0070676_104116472 89
5 3300005329 Ga0070683_100000113 Ga0070683_10000011312 89
6 3300005330 Ga0070690_100247018 Ga0070690_1002470181 89
7 3300005331 Ga0070670_100000041 Ga0070670_10000004132 89
8 3300005331 Ga0070670_100008464 Ga0070670_10000846412 89
9 3300005331 Ga0070670_101633392 Ga0070670_1016333921 89
10 3300005334 Ga0068869_100001899 Ga0068869_1000018998 89
11 3300005334 Ga0068869_100971898 Ga0068869_1009718982 89
12 3300005336 Ga0070680_100004153 Ga0070680_10000415315 89
13 3300005337 Ga0070682_101755665 Ga0070682_1017556651 89
14 3300005338 Ga0068868_100000612 Ga0068868_10000061223 89
15 3300005338 Ga0068868_100002260 Ga0068868_1000022608 89
16 3300005340 Ga0070689_100005927 Ga0070689_10000592710 89
17 3300005340 Ga0070689_100822464 Ga0070689_1008224642 89
18 3300005343 Ga0070687_100181647 Ga0070687_1001816472 89
19 3300005344 Ga0070661_101007964 Ga0070661_1010079642 89
20 3300005345 Ga0070692_10134498 Ga0070692_101344982 89
21 3300005345 Ga0070692_10432937 Ga0070692_104329372 89
22 3300005354 Ga0070675_100000009 Ga0070675_100000009162 89
23 3300005356 Ga0070674_100273412 Ga0070674_1002734123 89
24 3300005356 Ga0070674_100340371 Ga0070674_1003403712 89
25 3300005356 Ga0070674_101033851 Ga0070674_1010338512 89
26 3300005364 Ga0070673_100049465 Ga0070673_1000494652 89
27 3300005364 Ga0070673_100228027 Ga0070673_1002280271 89
28 3300005364 Ga0070673_101092750 Ga0070673_1010927502 89
29 3300005437 Ga0070710_11067741 Ga0070710_110677411 89
30 3300005438 Ga0070701_10024665 Ga0070701_100246654 89
31 3300005445 Ga0070708_100067949 Ga0070708_1000679494 89
32 3300005445 Ga0070708_100097931 Ga0070708_1000979313 89
33 3300005456 Ga0070678_100224102 Ga0070678_1002241022 89
34 3300005456 Ga0070678_100428706 Ga0070678_1004287063 89
35 3300005467 Ga0070706_100002247 Ga0070706_1000022474 89
36 3300005467 Ga0070706_100046116 Ga0070706_1000461164 89
37 3300005467 Ga0070706_100098418 Ga0070706_1000984185 89
38 3300005468 Ga0070707_100052958 Ga0070707_1000529584 89
39 3300005468 Ga0070707_100237547 Ga0070707_1002375472 89
40 3300005468 Ga0070707_100583222 Ga0070707_1005832221 89
41 3300005471 Ga0070698_100095839 Ga0070698_1000958394 89
42 3300005471 Ga0070698_100186851 Ga0070698_1001868512 89
43 3300005518 Ga0070699_100019275 Ga0070699_1000192756 89
44 3300005518 Ga0070699_100020283 Ga0070699_1000202835 89
45 3300005518 Ga0070699_100285570 Ga0070699_1002855702 89
46 3300005518 Ga0070699_101691272 Ga0070699_1016912722 89
47 3300005530 Ga0070679_101798124 Ga0070679_1017981242 89
48 3300005535 Ga0070684_100001793 Ga0070684_10000179312 89
49 3300005535 Ga0070684_100812589 Ga0070684_1008125891 89
50 3300005535 Ga0070684_101779598 Ga0070684_1017795982 89
51 3300005536 Ga0070697_100060031 Ga0070697_1000600314 89
52 3300005536 Ga0070697_100121862 Ga0070697_1001218623 89
53 3300005536 Ga0070697_101637461 Ga0070697_1016374612 89
54 3300005539 Ga0068853_100196868 Ga0068853_1001968683 89
55 3300005539 Ga0068853_100365254 Ga0068853_1003652542 89
56 3300005543 Ga0070672_100000899 Ga0070672_10000089911 89
57 3300005544 Ga0070686_100399327 Ga0070686_1003993271 89
58 3300005544 Ga0070686_101782322 Ga0070686_1017823221 89
59 3300005546 Ga0070696_101183788 Ga0070696_1011837881 89
60 3300005546 Ga0070696_101517583 Ga0070696_1015175831 89
61 3300005577 Ga0068857_100025018 Ga0068857_1000250182 89
62 3300005578 Ga0068854_100019615 Ga0068854_1000196154 89
63 3300005578 Ga0068854_100912176 Ga0068854_1009121762 89
64 3300005615 Ga0070702_100496505 Ga0070702_1004965052 89
65 3300005615 Ga0070702_100540572 Ga0070702_1005405722 89
66 3300005615 Ga0070702_100554094 Ga0070702_1005540942 89
67 3300005616 Ga0068852_100995099 Ga0068852_1009950992 89
68 3300005618 Ga0068864_100000040 Ga0068864_10000004033 89
69 3300005618 Ga0068864_102185434 Ga0068864_1021854342 89
70 3300005840 Ga0068870_10084259 Ga0068870_100842592 89
71 3300005841 Ga0068863_100871342 Ga0068863_1008713422 89
72 3300005842 Ga0068858_100686937 Ga0068858_1006869372 89
73 3300006028 Ga0070717_10000073 Ga0070717_1000007368 89
74 3300006028 Ga0070717_10530786 Ga0070717_105307861 89
75 3300006028 Ga0070717_10662290 Ga0070717_106622903 89
76 3300006173 Ga0070716_100115959 Ga0070716_1001159592 89
77 3300006237 Ga0097621_101688963 Ga0097621_1016889631 89
78 3300006358 Ga0068871_100398115 Ga0068871_1003981151 89
79 3300006844 Ga0075428_100941109 Ga0075428_1009411092 89
80 3300006847 Ga0075431_100022923 Ga0075431_1000229233 89
81 3300006852 Ga0075433_10601942 Ga0075433_106019422 89
82 3300006871 Ga0075434_100437610 Ga0075434_1004376103 89
83 3300006881 Ga0068865_100017514 Ga0068865_1000175142 89
84 3300006881 Ga0068865_102127675 Ga0068865_1021276752 89
85 3300006914 Ga0075436_100017349 Ga0075436_1000173494 89
86 3300006914 Ga0075436_100694999 Ga0075436_1006949992 89
87 3300007076 Ga0075435_100000060 Ga0075435_10000006022 89
88 3300007076 Ga0075435_100022079 Ga0075435_1000220793 89
89 3300009036 Ga0105244_10133116 Ga0105244_101331162 89
90 3300009093 Ga0105240_10103556 Ga0105240_101035564 89
91 3300009094 Ga0111539_10000054 Ga0111539_1000005453 89
92 3300009098 Ga0105245_10000066 Ga0105245_1000006623 89
93 3300009098 Ga0105245_10000927 Ga0105245_1000092716 89
94 3300009098 Ga0105245_10005771 Ga0105245_100057714 89
95 3300009098 Ga0105245_10325386 Ga0105245_103253864 89
96 3300009098 Ga0105245_10751686 Ga0105245_107516862 89
97 3300009147 Ga0114129_10531803 Ga0114129_105318033 89
98 3300009148 Ga0105243_11804375 Ga0105243_118043752 89
99 3300009174 Ga0105241_12524202 Ga0105241_125242021 89
100 3300009176 Ga0105242_10024874 Ga0105242_100248745 89
101 3300009551 Ga0105238_10000001 Ga0105238_100000011162 89
102 3300010375 Ga0105239_10048010 Ga0105239_100480102 89
103 3300011119 Ga0105246_12196870 Ga0105246_121968702 89
104 3300013105 Ga0157369_10002844 Ga0157369_1000284422 89
105 3300013296 Ga0157374_10000021 Ga0157374_10000021231 89
106 3300013297 Ga0157378_10000572 Ga0157378_1000057217 89
107 3300013297 Ga0157378_10002268 Ga0157378_100022688 89
108 3300013297 Ga0157378_10097853 Ga0157378_100978532 89
109 3300013306 Ga0163162_10011697 Ga0163162_100116973 89
110 3300013306 Ga0163162_11756090 Ga0163162_117560902 89
111 3300013308 Ga0157375_10000004 Ga0157375_1000000458 89
112 3300013308 Ga0157375_10000035 Ga0157375_100000359 89
113 3300013308 Ga0157375_10001181 Ga0157375_1000118110 89
114 3300013308 Ga0157375_11673355 Ga0157375_116733552 89
115 3300013308 Ga0157375_13779160 Ga0157375_137791602 89
116 3300014326 Ga0157380_10002136 Ga0157380_1000213613 89
117 3300014326 Ga0157380_12023192 Ga0157380_120231921 89
118 3300014745 Ga0157377_10000009 Ga0157377_10000009280 89
119 3300014745 Ga0157377_10000227 Ga0157377_100002278 89
120 3300014745 Ga0157377_10240166 Ga0157377_102401662 89
121 3300014969 Ga0157376_10000020 Ga0157376_10000020196 89
122 3300021358 Ga0213873_10010945 Ga0213873_100109454 89
123 3300021384 Ga0213876_10000012 Ga0213876_1000001287 89
124 3300021384 Ga0213876_10011520 Ga0213876_100115204 89
125 3300021384 Ga0213876_10021085 Ga0213876_100210853 89
126 3300025728 Ga0207655_1103072 Ga0207655_11030722 89
127 3300025898 Ga0207692_10422300 Ga0207692_104223002 89
128 3300025898 Ga0207692_10742596 Ga0207692_107425962 89
129 3300025906 Ga0207699_10938784 Ga0207699_109387842 89
130 3300025907 Ga0207645_10258599 Ga0207645_102585992 89
131 3300025907 Ga0207645_10918869 Ga0207645_109188692 89
132 3300025908 Ga0207643_10020905 Ga0207643_100209053 89
133 3300025909 Ga0207705_10075892 Ga0207705_100758924 89
134 3300025910 Ga0207684_10042915 Ga0207684_100429154 89
135 3300025910 Ga0207684_10154391 Ga0207684_101543914 89
136 3300025910 Ga0207684_10721380 Ga0207684_107213801 89
137 3300025913 Ga0207695_10083651 Ga0207695_100836513 89
138 3300025917 Ga0207660_10066627 Ga0207660_100666272 89
139 3300025918 Ga0207662_10153661 Ga0207662_101536612 89
140 3300025918 Ga0207662_10915519 Ga0207662_109155191 89
141 3300025922 Ga0207646_10020981 Ga0207646_100209816 89
142 3300025922 Ga0207646_10065175 Ga0207646_100651754 89
143 3300025922 Ga0207646_10078318 Ga0207646_100783183 89
144 3300025922 Ga0207646_10190025 Ga0207646_101900253 89
145 3300025922 Ga0207646_10817919 Ga0207646_108179191 89
146 3300025924 Ga0207694_10000001 Ga0207694_100000012200 89
147 3300025925 Ga0207650_10000088 Ga0207650_10000088105 89
148 3300025925 Ga0207650_10042872 Ga0207650_100428722 89
149 3300025926 Ga0207659_10000007 Ga0207659_10000007164 89
150 3300025927 Ga0207687_10000003 Ga0207687_10000003754 89
151 3300025927 Ga0207687_10000157 Ga0207687_1000015742 89
152 3300025927 Ga0207687_10004934 Ga0207687_1000493411 89
153 3300025927 Ga0207687_10134220 Ga0207687_101342203 89
154 3300025928 Ga0207700_10210181 Ga0207700_102101813 89
155 3300025928 Ga0207700_10720503 Ga0207700_107205032 89
156 3300025929 Ga0207664_10308953 Ga0207664_103089532 89
157 3300025931 Ga0207644_10141212 Ga0207644_101412122 89
158 3300025934 Ga0207686_10046476 Ga0207686_100464765 89
159 3300025935 Ga0207709_11059649 Ga0207709_110596492 89
160 3300025936 Ga0207670_10002887 Ga0207670_100028875 89
161 3300025936 Ga0207670_10278038 Ga0207670_102780383 89
162 3300025937 Ga0207669_10058773 Ga0207669_100587733 89
163 3300025937 Ga0207669_10922305 Ga0207669_109223052 89
164 3300025938 Ga0207704_10162358 Ga0207704_101623582 89
165 3300025938 Ga0207704_10946388 Ga0207704_109463882 89
166 3300025939 Ga0207665_10130395 Ga0207665_101303953 89
167 3300025939 Ga0207665_10549984 Ga0207665_105499842 89
168 3300025940 Ga0207691_10001146 Ga0207691_1000114618 89
169 3300025942 Ga0207689_10003419 Ga0207689_1000341910 89
170 3300025942 Ga0207689_10107036 Ga0207689_101070363 89
171 3300025942 Ga0207689_11296795 Ga0207689_112967951 89
172 3300025942 Ga0207689_11361260 Ga0207689_113612601 89
173 3300025944 Ga0207661_10000001 Ga0207661_1000000127 89
174 3300025944 Ga0207661_10558270 Ga0207661_105582702 89
175 3300025944 Ga0207661_11405972 Ga0207661_114059722 89
176 3300025960 Ga0207651_10290606 Ga0207651_102906062 89
177 3300025960 Ga0207651_10598177 Ga0207651_105981772 89
178 3300025981 Ga0207640_10006779 Ga0207640_1000677910 89
179 3300025981 Ga0207640_10013881 Ga0207640_100138812 89
180 3300025981 Ga0207640_10098382 Ga0207640_100983824 89
181 3300026023 Ga0207677_10000009 Ga0207677_1000000921 89
182 3300026023 Ga0207677_10000786 Ga0207677_1000078614 89
183 3300026035 Ga0207703_10000182 Ga0207703_1000018233 89
184 3300026041 Ga0207639_10000003 Ga0207639_1000000377 89
185 3300026041 Ga0207639_10283447 Ga0207639_102834472 89
186 3300026075 Ga0207708_10000001 Ga0207708_10000001436 89
187 3300026088 Ga0207641_10699630 Ga0207641_106996302 89
188 3300026095 Ga0207676_10000013 Ga0207676_1000001355 89
189 3300026116 Ga0207674_10013030 Ga0207674_100130303 89
190 3300026118 Ga0207675_100349213 Ga0207675_1003492133 89
191 3300026121 Ga0207683_10113429 Ga0207683_101134292 89
192 3300026121 Ga0207683_10527970 Ga0207683_105279703 89
193 3300026121 Ga0207683_11945556 Ga0207683_119455561 89
194 3300027907 Ga0207428_10000581 Ga0207428_1000058141 89
195 3300030521 Ga0307511_10008320 Ga0307511_100083207 89
196 3300032002 Ga0307416_102564703 Ga0307416_1025647032 89
197 3300032002 Ga0307416_103634028 Ga0307416_1036340281 89
198 3300032005 Ga0307411_10772290 Ga0307411_107722902 89
199 3300032126 Ga0307415_100621082 Ga0307415_1006210822 89
200 3300035112 Ga0373932_0001131 Ga0373932_0001131_5359_5637 89
201 3300035170 Ga0373943_0531193 Ga0373943_0531193_221_499 89
202 3300039437 Ga0436365_0120716 Ga0436365_0120716_87684_87962 89
203 3300039437 Ga0436365_0362725 Ga0436365_0362725_1357_1635 89
204 3300039437 Ga0436365_1172437 Ga0436365_1172437_3688_3966 89
205 3300039450 Ga0436363_1236089 Ga0436363_1236089_349_627 89
206 3300039453 Ga0436362_0931096 Ga0436362_0931096_575_853 89
207 3300041496 Ga0451839_0677481 Ga0451839_0677481_2005_2283 89
208 3300041512 Ga0451853_3306193 Ga0451853_3306193_253_531 89
209 3300044673 Ga0453683_1133427 Ga0453683_1133427_111_389 89
210 3300045051 Ga0451576_1120730 Ga0451576_1120730_51_329 89
211 3300046537 Ga0495598_0117913 Ga0495598_0117913_528_806 89
212 3300047446 Ga0495679_007835 Ga0495679_007835_4095_4373 89
213 3300049590 Ga0501074_0637981 Ga0501074_0637981_465_743 89
214 3300050507 nmdc:mga05p37_150832_c1 nmdc:mga05p37_150832_c1_1958_2227 89
215 3300050507 nmdc:mga05p37_534377_c1 nmdc:mga05p37_534377_c1_606_884 89
216 3300050510 nmdc:mga06r32_9428_c1 nmdc:mga06r32_9428_c1_7637_7915 89
217 3300050511 nmdc:mga08y16_28_c1 nmdc:mga08y16_28_c1_123230_123508 89
218 3300050512 nmdc:mga0n895_1607368_c1 nmdc:mga0n895_1607368_c1_300_578 89
219 3300050512 nmdc:mga0n895_2148106_c1 nmdc:mga0n895_2148106_c1_224_502 89
220 3300050512 nmdc:mga0n895_928555_c1 nmdc:mga0n895_928555_c1_115_393 89
221 3300050513 nmdc:mga0rr50_1184479_c1 nmdc:mga0rr50_1184479_c1_150_431 89
222 3300050513 nmdc:mga0rr50_125_c1 nmdc:mga0rr50_125_c1_11078_11356 89
223 3300050513 nmdc:mga0rr50_20352_c1 nmdc:mga0rr50_20352_c1_2929_3207 89
224 3300050514 nmdc:mga08x19_642809_c1 nmdc:mga08x19_642809_c1_256_534 89
225 3300050514 nmdc:mga08x19_646443_c1 nmdc:mga08x19_646443_c1_423_701 89
226 3300050514 nmdc:mga08x19_776_c1 nmdc:mga08x19_776_c1_17607_17885 89
227 3300050515 nmdc:mga0a205_588943_c1 nmdc:mga0a205_588943_c1_164_442 89
228 3300053083 Ga0495655_0000194 Ga0495655_0000194_9147_9425 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

4

81

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i7h-assembly3.cif.gz_C crystal sturcuture of fdx 0.8031 11 86
3zyy-assembly1.cif.gz_X reductive activator for corrinoid,iron-sulfur protein 0.8 2 86
3ah7-assembly1.cif.gz_A-2 crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 0.7884 7 88
4itk-assembly1.cif.gz_A the structure of c.reinhardtii ferredoxin 2 0.7703 6 84
5ogx-assembly1.cif.gz_A crystal structure of amycolatopsis cytochrome p450 reductase gcob. 0.7568 7 86
ID Description Score Start End Superfamily
1i7hA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8178 7 86 3.10.20.30
3zyyX01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8 2 86 3.10.20.30
af_P75824_230_322_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7999 2 83 3.10.20.30
af_A0A0R0GLS0_46_147_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7968 6 87 3.10.20.30
af_A0A1D6EVV4_90_195_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7951 8 87 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A662IP23-F1-model_v4 Ferredoxin 0.8841 2 87 GO:0051536
AF-A0A550GPY6-F1-model_v4 DUF4445 domain-containing protein 0.8831 2 87 GO:0051536
AF-A0A133VL55-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.8826 2 86 GO:0051536
AF-A0A7C4G6J8-F1-model_v4 DUF4445 domain-containing protein 0.8804 2 85 GO:0051536
AF-A0A841KKU1-F1-model_v4 Ferredoxin 0.8796 2 85 GO:0051536

Feature Viewer

pLDDT pTM Quality
81.68 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map