F340062

General Info

Members Datasets Scaffolds Average Seq Length
227 181 454 390

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10024280|Ga0307517_100242806
Length 412
Sequence VTGIRTLSSGLRELRPAAFGADPSGERLARIRRSPHFKDGVFQNPGGNTNVRPSGGTMREMGKSYLDKEQRALRAPNGVLPVHATTLADLAKPAATGLRLTWMGHSSVLAEIDGHRVLFDPVWGERCSPFPFAGPKRLHPVPLPIAALGPVDVVVISHDHYDHLDMPTIKALADTDTLFAVPLGVGAHLEHWGVSADRLRELDWHEETKVGGLTLTATPARHFCGRGLRNTQHTLWASWVVAGDEHRIYHSGDTGYFEGFKDIGAAHGPFDATMIQIGAYSEFWPKNHTDYTPLPGAWPDIHMSPAQGVQAHLDLQGGGPAGVLLPIHWGTFNLSLHAWAEPGEWTKYEAEEAGQAVAFPRPGEPFEPAGRLSAEAWWRAVSGPIAHPWRRPRSTEGVVEPSKKDLDLAGER

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
9 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
10 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
11 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
13 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
14 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
15 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
16 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
17 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
18 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
19 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
20 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
21 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
22 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
23 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
24 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
25 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
26 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
27 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
28 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
29 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
30 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
31 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
32 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
33 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
34 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
35 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
36 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
37 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
38 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
39 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
40 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
41 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
42 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
43 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
44 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
45 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
46 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
47 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
48 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
49 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
50 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
51 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
52 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
53 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
54 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
55 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
56 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
57 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
58 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
59 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
60 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
61 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
62 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
63 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
64 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
65 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
68 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
69 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
70 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
71 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
72 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
73 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
76 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
77 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
78 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
79 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
80 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
81 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
82 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
83 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
84 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
85 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
86 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
87 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
88 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
89 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
90 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
91 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
94 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
95 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
96 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
97 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
101 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
119 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
120 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
121 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
122 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
123 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
124 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
125 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
126 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
127 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
128 2643221548 Streptomyces sp. Root55 Isolate Unclassified
129 2643221578 Streptomyces sp. Root63 Isolate Unclassified
130 2643221647 Streptomyces sp. Root369 Isolate Unclassified
131 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
132 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
133 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
134 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
135 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
136 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
137 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
138 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
139 2808606448 Streptomyces sp. 193411 Isolate Unclassified
140 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
141 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
142 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
143 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
144 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
145 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
146 2867428634 Streptomyces sp. RP5T Isolate Unclassified
147 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
148 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
149 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
150 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
151 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
152 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
153 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
154 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
155 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
156 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
157 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
158 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
159 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
160 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
161 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
162 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
163 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
164 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
165 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
166 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
167 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
168 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
169 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
170 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
171 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
172 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
173 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
174 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
175 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
176 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
177 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
178 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
179 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
180 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
181 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.01
Metatranscriptomes 0
Isolates 25.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.96
Nodule 0.44
Rhizoplane 0.88
Rhizosphere 76.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10024280 3300028786 Bacteria 7483
2 rootH1_10024678 3300003316 Bacteria 6403
3 rootH2_10164654 3300003320 Bacteria 3454
4 rootL2_10048489 3300003322 Bacteria 1615
5 rootH1_10119192 3300003323 Bacteria 4796
6 JGI25160J50197_1016986 3300003354 Bacteria 2324
7 Ga0075367_10000867 3300006178 Bacteria 12111
8 Ga0182008_10000983 3300014497 Bacteria 19790
9 Ga0182007_10000655 3300015262 Bacteria 19878
10 Ga0207426_1000751 3300025302 Bacteria 36444
11 Ga0207426_1001145 3300025302 Bacteria 23890
12 Ga0207713_1036500 3300025735 Bacteria 2107
13 Ga0307515_10000163 3300028794 Bacteria 163159
14 Ga0307511_10001720 3300030521 Bacteria 23047
15 Ga0307512_10003551 3300030522 Bacteria 17971
16 Ga0307512_10043676 3300030522 Bacteria 3694
17 Ga0307509_10004445 3300031507 Bacteria 20209
18 Ga0307508_10020702 3300031616 Bacteria 5975
19 Ga0307508_10120871 3300031616 Bacteria 2222
20 Ga0307514_10089575 3300031649 Bacteria 2247
21 Ga0307516_10067115 3300031730 Bacteria 3457
22 Ga0307518_10032479 3300031838 Bacteria 3784
23 Ga0307518_10039771 3300031838 Bacteria 3419
24 Ga0307507_10012098 3300033179 Bacteria 10730
25 Ga0307507_10051783 3300033179 Bacteria 3945
26 Ga0307510_10029491 3300033180 Bacteria 6243
27 Ga0395898_0104228 3300037466 Bacteria 2720
28 Ga0439439_0006663 3300041406 Bacteria 2675
29 Ga0451853_3293907 3300041512 Bacteria 2734
30 Ga0439448_0009016 3300042005 Bacteria 2933
31 Ga0439449_0000174 3300042007 Bacteria 22298
32 Ga0439449_0022102 3300042007 Bacteria 2381
33 Ga0439457_000007 3300042014 Bacteria 43988
34 Ga0439457_003424 3300042014 Bacteria 4313
35 Ga0450894_000991 3300042131 Bacteria 4411
36 Ga0450896_007137 3300042133 Bacteria 1540
37 Ga0450898_004558 3300042134 Bacteria 2054
38 Ga0450906_001410 3300042145 Bacteria 5237
39 Ga0439458_0009543 3300042157 Bacteria 2161
40 Ga0450908_016845 3300042184 Bacteria 1301
41 Ga0466969_0016489 3300044656 Bacteria 3866
42 Ga0466969_0020420 3300044656 Bacteria 3431
43 Ga0466972_0000755 3300044658 Bacteria 15419
44 Ga0466972_0004689 3300044658 Bacteria 6848
45 Ga0466972_0020484 3300044658 Bacteria 3305
46 Ga0466965_0001219 3300044683 Bacteria 10173
47 Ga0466965_0030275 3300044683 Bacteria 2637
48 Ga0466966_0001767 3300044684 Bacteria 14017
49 Ga0466961_0000864 3300044693 Bacteria 18903
50 Ga0466961_0011968 3300044693 Bacteria 5545
51 Ga0466963_0012819 3300044694 Bacteria 5136
52 Ga0466964_0022817 3300044706 Bacteria 2430
53 Ga0466971_0038952 3300044719 Bacteria 2133
54 Ga0466971_0105544 3300044719 Bacteria 1297
55 Ga0466968_0062219 3300044735 Bacteria 1611
56 Ga0466970_0001136 3300044765 Bacteria 12888
57 Ga0466970_0014330 3300044765 Bacteria 4069
58 Ga0466957_0002691 3300044842 Bacteria 9605
59 Ga0466960_0001343 3300044901 Bacteria 8942
60 Ga0466959_0019107 3300045049 Bacteria 5036
61 Ga0466958_0011074 3300045836 Bacteria 5071
62 Ga0466967_0003973 3300045976 Bacteria 9845
63 Ga0495592_0032295 3300046454 Bacteria 3951
64 Ga0495592_0056029 3300046454 Bacteria 2914
65 Ga0495603_0005707 3300046455 Bacteria 7439
66 Ga0495603_0007123 3300046455 Bacteria 6712
67 Ga0495603_0041052 3300046455 Bacteria 2767
68 Ga0495629_0000463 3300046459 Bacteria 33951
69 Ga0495629_0002330 3300046459 Bacteria 14636
70 Ga0495629_0006572 3300046459 Bacteria 8614
71 Ga0495629_0034327 3300046459 Bacteria 3586
72 Ga0495638_0071650 3300046460 Bacteria 2120
73 Ga0495641_0101490 3300046461 Bacteria 1284
74 Ga0495651_0002627 3300046462 Bacteria 13913
75 Ga0495653_0208311 3300046463 Bacteria 1322
76 Ga0495605_0013718 3300046474 Bacteria 4453
77 Ga0495639_0097309 3300046475 Bacteria 1386
78 Ga0495664_0001321 3300046477 Bacteria 13025
79 Ga0495664_0135884 3300046477 Bacteria 1489
80 Ga0495585_0118860 3300046492 Bacteria 1399
81 Ga0495594_0034225 3300046499 Bacteria 2763
82 Ga0495583_0045535 3300046506 Bacteria 2028
83 Ga0495610_0026718 3300046512 Bacteria 3078
84 Ga0495616_0014565 3300046513 Bacteria 4397
85 Ga0495618_0008921 3300046514 Bacteria 6051
86 Ga0495628_0038098 3300046516 Bacteria 3850
87 Ga0495630_0083055 3300046517 Bacteria 2418
88 Ga0495631_0006326 3300046518 Bacteria 6126
89 Ga0495666_0019156 3300046526 Bacteria 3399
90 Ga0495666_0118038 3300046526 Bacteria 1243
91 Ga0495640_0160571 3300046533 Bacteria 1441
92 Ga0495587_0000889 3300046536 Bacteria 19778
93 Ga0495597_0008746 3300046542 Bacteria 5059
94 Ga0495622_0018745 3300046557 Bacteria 3222
95 Ga0495667_0072249 3300046559 Bacteria 2249
96 Ga0495634_0006458 3300046642 Bacteria 8909
97 Ga0495611_0016422 3300046648 Bacteria 3164
98 Ga0495625_0066511 3300046660 Bacteria 2538
99 Ga0495635_0000258 3300046663 Bacteria 33989
100 Ga0495661_0105261 3300046665 Bacteria 1580
101 Ga0495588_0002097 3300046674 Bacteria 8555
102 Ga0495588_0003202 3300046674 Bacteria 7090
103 Ga0495588_0069571 3300046674 Bacteria 1829
104 Ga0495657_0003765 3300046675 Bacteria 12279
105 Ga0495623_0080443 3300046679 Bacteria 2017
106 Ga0495613_0000904 3300046689 Bacteria 22821
107 Ga0495624_0126323 3300046690 Bacteria 1569
108 Ga0495671_0012369 3300046692 Bacteria 4665
109 Ga0495589_0076292 3300046794 Bacteria 1634
110 Ga0495589_0091969 3300046794 Bacteria 1473
111 Ga0495600_0021300 3300046809 Bacteria 4149
112 Ga0495581_0075563 3300047315 Bacteria 1949
113 Ga0495604_0000243 3300047317 Bacteria 48550
114 Ga0495636_0013353 3300047318 Bacteria 3259
115 Ga0495676_0000819 3300047321 Bacteria 26040
116 Ga0495676_0003606 3300047321 Bacteria 14052
117 Ga0495676_0013841 3300047321 Bacteria 7233
118 Ga0495676_0029047 3300047321 Bacteria 4711
119 Ga0495687_000743 3300047443 Bacteria 35403
120 Ga0495687_001601 3300047443 Bacteria 20428
121 Ga0495675_0052684 3300047444 Bacteria 2583
122 Ga0495685_012001 3300047447 Bacteria 2930
123 Ga0495681_0005712 3300047470 Bacteria 8280
124 Ga0495681_0052249 3300047470 Bacteria 1918
125 Ga0495593_0000283 3300047673 Bacteria 27649
126 Ga0495614_0000094 3300048089 Bacteria 29920
127 Ga0495614_0007655 3300048089 Bacteria 4802
128 Ga0495614_0012825 3300048089 Bacteria 3677
129 Ga0495626_0026787 3300048091 Bacteria 2806
130 Ga0496106_0058300 3300048909 Bacteria 2923
131 Ga0496108_0073114 3300048911 Bacteria 2895
132 Ga0495678_032655 3300049459 Bacteria 2155
133 Ga0495682_0083444 3300049460 Bacteria 1149
134 Ga0501031_0032428 3300049568 Bacteria 3406
135 Ga0501033_0003349 3300049570 Bacteria 13230
136 Ga0501033_0038650 3300049570 Bacteria 3566
137 Ga0501033_0059436 3300049570 Bacteria 2823
138 Ga0501033_0110734 3300049570 Bacteria 1998
139 Ga0501034_0002162 3300049571 Bacteria 24379
140 Ga0501034_0027958 3300049571 Bacteria 5735
141 Ga0501034_0213253 3300049571 Bacteria 1885
142 Ga0501036_0008872 3300049572 Bacteria 8256
143 Ga0501036_0054145 3300049572 Bacteria 3398
144 Ga0501037_0003594 3300049573 Bacteria 11247
145 Ga0501038_0081890 3300049574 Bacteria 2719
146 Ga0501038_0187430 3300049574 Bacteria 1666
147 Ga0501039_0000885 3300049575 Bacteria 21756
148 Ga0501042_0018016 3300049578 Bacteria 4885
149 Ga0501043_0002374 3300049579 Bacteria 15938
150 Ga0501043_0105875 3300049579 Bacteria 2209
151 Ga0501046_0002633 3300049580 Bacteria 16766
152 Ga0501047_0225049 3300049581 Bacteria 1731
153 Ga0501047_0249990 3300049581 Bacteria 1621
154 Ga0501048_0049597 3300049582 Bacteria 2991
155 Ga0501070_0002002 3300049586 Bacteria 17911
156 Ga0501074_0002670 3300049590 Bacteria 12485
157 Ga0501035_0076854 3300049822 Bacteria 2951
158 Ga0501035_0091967 3300049822 Bacteria 2669
159 Ga0501044_0010050 3300049823 Bacteria 10283
160 Ga0501044_0014741 3300049823 Bacteria 8425
161 Ga0501044_0056697 3300049823 Bacteria 4022
162 Ga0501044_0061448 3300049823 Bacteria 3843
163 Ga0501044_0094027 3300049823 Bacteria 3023
164 nmdc:mga06z11_2675_c1 3300050494 Bacteria 6824
165 Ga0500640_008281 3300053095 Bacteria 4104
166 Ga0500560_000330 3300053107 Bacteria 6125
167 Ga0500572_005336 3300053111 Bacteria 2908
168 Ga0500573_0022876 3300053140 Bacteria 3588
169 2547412281 2547132111 Bacteria 8013147
170 2554260862 2554235005 Bacteria 6457341
171 2585304091 2582581313 Bacteria 10042643
172 2616698947 2616644814 Bacteria 11555299
173 2616905657 2616644941 Bacteria 8510691
174 2643761319 2643221548 Bacteria 8053412
175 2643901682 2643221578 Bacteria 9213798
176 2644263854 2643221647 Bacteria 10741251
177 2644407828 2643221673 Bacteria 9196637
178 2644440962 2643221678 Bacteria 9540101
179 2644459279 2643221682 Bacteria 6743283
180 2785339767 2784746763 Bacteria 9783172
181 2785373178 2784746768 Bacteria 10036182
182 2786674862 2786546132 Bacteria 10419719
183 2808845315 2808606359 Bacteria 9866990
184 2808915014 2808606375 Bacteria 9466072
185 2809235555 2808606448 Bacteria 8656184
186 2811843200 2808606982 Bacteria 7791042
187 2819696197 2818991463 Bacteria 7948711
188 2852636016 2852635781 Bacteria 8251373
189 2862283053 2862281513 Bacteria 9621493
190 2862705405 2862705112 Bacteria 6563286
191 2867348329 2867346516 Bacteria 7608576
192 2867436823 2867428634 Bacteria 9590268
193 2875397925 2875391855 Bacteria 7600475
194 2877677723 2877676314 Bacteria 9512378
195 2912716013 2912715099 Bacteria 9460473
196 2912728970 2912723979 Bacteria 8557534
197 2912764112 2912757875 Bacteria 7940295
198 2919475182 2919468124 Bacteria 9133025
199 2935392959 2935390628 Bacteria 7043367
200 2946046568 2946045630 Bacteria 8527308
201 2946071310 2946064051 Bacteria 8957905
202 2946079145 2946072368 Bacteria 8999607
203 2947225435 2947224130 Bacteria 9938529
204 2954382505 2954380949 Bacteria 10050426
205 2954680540 2954673503 Bacteria 9685905
206 2954683613 2954682443 Bacteria 9862841
207 2954693306 2954691527 Bacteria 10720516
208 2954708399 2954701450 Bacteria 10834262
209 2954713013 2954711539 Bacteria 10867210
210 2954722972 2954721474 Bacteria 10456478
211 2954738857 2954731030 Bacteria 10243860
212 2954741882 2954740390 Bacteria 10229294
213 2954757715 2954749733 Bacteria 10366972
214 2954760859 2954759201 Bacteria 9358192
215 2966599544 2966598605 Bacteria 7676064
216 2990046796 2990044586 Bacteria 6603797
217 2997455251 2997451912 Bacteria 8492419
218 3006393508 3006393351 Bacteria 6615579
219 3006494627 3006493962 Bacteria 8825450
220 8008490899 8008485437 Bacteria 7198341
221 8008564252 8008558824 Bacteria 10610750
222 8008575880 8008574985 Bacteria 7815457
223 8023625106 8023623736 Bacteria 8593882
224 8025527808 8025524527 Bacteria 7197316
225 8025535299 8025530807 Bacteria 8495698
226 8056447481 8056447290 Bacteria 7680491
227 8056836100 8056829672 Bacteria 9045328
228 Ga0307517_10024280
229 rootH1_10024678
230 rootH2_10164654
231 rootL2_10048489
232 rootH1_10119192
233 JGI25160J50197_1016986
234 Ga0075367_10000867
235 Ga0182008_10000983
236 Ga0182007_10000655
237 Ga0207426_1000751
238 Ga0207426_1001145
239 Ga0207713_1036500
240 Ga0307515_10000163
241 Ga0307511_10001720
242 Ga0307512_10003551
243 Ga0307512_10043676
244 Ga0307509_10004445
245 Ga0307508_10020702
246 Ga0307508_10120871
247 Ga0307514_10089575
248 Ga0307516_10067115
249 Ga0307518_10032479
250 Ga0307518_10039771
251 Ga0307507_10012098
252 Ga0307507_10051783
253 Ga0307510_10029491
254 Ga0395898_0104228
255 Ga0439439_0006663
256 Ga0451853_3293907
257 Ga0439448_0009016
258 Ga0439449_0000174
259 Ga0439449_0022102
260 Ga0439457_000007
261 Ga0439457_003424
262 Ga0450894_000991
263 Ga0450896_007137
264 Ga0450898_004558
265 Ga0450906_001410
266 Ga0439458_0009543
267 Ga0450908_016845
268 Ga0466969_0016489
269 Ga0466969_0020420
270 Ga0466972_0000755
271 Ga0466972_0004689
272 Ga0466972_0020484
273 Ga0466965_0001219
274 Ga0466965_0030275
275 Ga0466966_0001767
276 Ga0466961_0000864
277 Ga0466961_0011968
278 Ga0466963_0012819
279 Ga0466964_0022817
280 Ga0466971_0038952
281 Ga0466971_0105544
282 Ga0466968_0062219
283 Ga0466970_0001136
284 Ga0466970_0014330
285 Ga0466957_0002691
286 Ga0466960_0001343
287 Ga0466959_0019107
288 Ga0466958_0011074
289 Ga0466967_0003973
290 Ga0495592_0032295
291 Ga0495592_0056029
292 Ga0495603_0005707
293 Ga0495603_0007123
294 Ga0495603_0041052
295 Ga0495629_0000463
296 Ga0495629_0002330
297 Ga0495629_0006572
298 Ga0495629_0034327
299 Ga0495638_0071650
300 Ga0495641_0101490
301 Ga0495651_0002627
302 Ga0495653_0208311
303 Ga0495605_0013718
304 Ga0495639_0097309
305 Ga0495664_0001321
306 Ga0495664_0135884
307 Ga0495585_0118860
308 Ga0495594_0034225
309 Ga0495583_0045535
310 Ga0495610_0026718
311 Ga0495616_0014565
312 Ga0495618_0008921
313 Ga0495628_0038098
314 Ga0495630_0083055
315 Ga0495631_0006326
316 Ga0495666_0019156
317 Ga0495666_0118038
318 Ga0495640_0160571
319 Ga0495587_0000889
320 Ga0495597_0008746
321 Ga0495622_0018745
322 Ga0495667_0072249
323 Ga0495634_0006458
324 Ga0495611_0016422
325 Ga0495625_0066511
326 Ga0495635_0000258
327 Ga0495661_0105261
328 Ga0495588_0002097
329 Ga0495588_0003202
330 Ga0495588_0069571
331 Ga0495657_0003765
332 Ga0495623_0080443
333 Ga0495613_0000904
334 Ga0495624_0126323
335 Ga0495671_0012369
336 Ga0495589_0076292
337 Ga0495589_0091969
338 Ga0495600_0021300
339 Ga0495581_0075563
340 Ga0495604_0000243
341 Ga0495636_0013353
342 Ga0495676_0000819
343 Ga0495676_0003606
344 Ga0495676_0013841
345 Ga0495676_0029047
346 Ga0495687_000743
347 Ga0495687_001601
348 Ga0495675_0052684
349 Ga0495685_012001
350 Ga0495681_0005712
351 Ga0495681_0052249
352 Ga0495593_0000283
353 Ga0495614_0000094
354 Ga0495614_0007655
355 Ga0495614_0012825
356 Ga0495626_0026787
357 Ga0496106_0058300
358 Ga0496108_0073114
359 Ga0495678_032655
360 Ga0495682_0083444
361 Ga0501031_0032428
362 Ga0501033_0003349
363 Ga0501033_0038650
364 Ga0501033_0059436
365 Ga0501033_0110734
366 Ga0501034_0002162
367 Ga0501034_0027958
368 Ga0501034_0213253
369 Ga0501036_0008872
370 Ga0501036_0054145
371 Ga0501037_0003594
372 Ga0501038_0081890
373 Ga0501038_0187430
374 Ga0501039_0000885
375 Ga0501042_0018016
376 Ga0501043_0002374
377 Ga0501043_0105875
378 Ga0501046_0002633
379 Ga0501047_0225049
380 Ga0501047_0249990
381 Ga0501048_0049597
382 Ga0501070_0002002
383 Ga0501074_0002670
384 Ga0501035_0076854
385 Ga0501035_0091967
386 Ga0501044_0010050
387 Ga0501044_0014741
388 Ga0501044_0056697
389 Ga0501044_0061448
390 Ga0501044_0094027
391 nmdc:mga06z11_2675_c1
392 Ga0500640_008281
393 Ga0500560_000330
394 Ga0500572_005336
395 Ga0500573_0022876
396 2547412281
397 2554260862
398 2585304091
399 2616698947
400 2616905657
401 2643761319
402 2643901682
403 2644263854
404 2644407828
405 2644440962
406 2644459279
407 2785339767
408 2785373178
409 2786674862
410 2808845315
411 2808915014
412 2809235555
413 2811843200
414 2819696197
415 2852636016
416 2862283053
417 2862705405
418 2867348329
419 2867436823
420 2875397925
421 2877677723
422 2912716013
423 2912728970
424 2912764112
425 2919475182
426 2935392959
427 2946046568
428 2946071310
429 2946079145
430 2947225435
431 2954382505
432 2954680540
433 2954683613
434 2954693306
435 2954708399
436 2954713013
437 2954722972
438 2954738857
439 2954741882
440 2954757715
441 2954760859
442 2966599544
443 2990046796
444 2997455251
445 3006393508
446 3006494627
447 8008490899
448 8008564252
449 8008575880
450 8023625106
451 8025527808
452 8025535299
453 8056447481
454 8056836100

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

115

329

0.95

PF13483

Lactamase_B_3

Beta-lactamase superfamily domain

99

291

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.8507 96 352
2wym-assembly1.cif.gz_C structure of a metallo-b-lactamase 0.8484 97 351
3x2y-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h8a from thermotoga maritima 0.8451 96 352
3x2x-assembly1.cif.gz_C crystal structure of metallo-beta-lactamase h48a from thermotoga maritima 0.8438 96 352
3x30-assembly1.cif.gz_A crystal structure of metallo-beta-lactamase from thermotoga maritima 0.8437 96 352
ID Description Score Start End Superfamily
af_P9WKP3_98_359_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.966 96 352 3.60.15.10
af_P9WKP3_98_359_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9407 96 352 3.60.15.10
af_Q8BH82_99_394_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9247 79 351 3.60.15.10
af_Q965X7_61_355_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9193 78 355 3.60.15.10
af_Q55BC7_55_359_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9124 80 351 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A6G2Q769-F1-model_v4 MBL fold metallo-hydrolase 0.9757 102 377 GO:0005737
GO:0008270
GO:0070290
AF-A0A4R4KLJ5-F1-model_v4 MBL fold metallo-hydrolase 0.9707 96 365 GO:0005737
GO:0008270
GO:0070290
AF-A0A6G3SDZ6-F1-model_v4 MBL fold metallo-hydrolase 0.9664 3 354 GO:0005737
GO:0008270
GO:0070290
AF-A0A352EGL9-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9647 144 365 GO:0005737
AF-A0A2P8IIF8-F1-model_v4 L-ascorbate metabolism protein UlaG (Beta-lactamase superfamily) 0.9644 55 369 GO:0005737

Map