F338609

General Info

Members Datasets Scaffolds Average Seq Length
226 169 452 161

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100015629|Ga0070708_1000156294
Length 190
Sequence MSSDPGYRLSSEGVVSAIGATHPNHWPRRIEMPAITPCLWFDGKAEEAAEFYASVFPDSRVDKVDRSAAETPSGPKGMVLTVELTLSGQPFVGLNGGPDFQFNEAISFMVDCADQAEVDHYWEALTAGGGQPGPCGWLKDRFGVSWQVIPRRLNELVGGPDAAAAERAMKAMLEMSKIDVAELERAYAGG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
166 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 2643221664 Massilia sp. Root418 Isolate Unclassified
169 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 3.98
Rhizosphere 89.38
Stem 0
Stem Tuber 0
Unclassified 2.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100015629 3300005445 Bacteria 6273
2 Ga0065704_10077103 3300005289 Unclassified 4853
3 Ga0070676_10116265 3300005328 Bacteria 1673
4 Ga0070670_100042547 3300005331 Bacteria 3905
5 Ga0070677_10088540 3300005333 Bacteria 1341
6 Ga0068869_100062516 3300005334 Bacteria 2733
7 Ga0068869_100371244 3300005334 Bacteria 1171
8 Ga0068869_100776609 3300005334 Bacteria 822
9 Ga0068868_100190801 3300005338 Bacteria 1704
10 Ga0070660_100575294 3300005339 Bacteria 941
11 Ga0070668_100084493 3300005347 Bacteria 2493
12 Ga0070668_100428858 3300005347 Bacteria 1133
13 Ga0070669_100902804 3300005353 Bacteria 755
14 Ga0070675_100159890 3300005354 Bacteria 1936
15 Ga0070671_100011665 3300005355 Bacteria 7067
16 Ga0070674_100089540 3300005356 Bacteria 2217
17 Ga0070673_100392634 3300005364 Bacteria 1239
18 Ga0070659_100826498 3300005366 Bacteria 807
19 Ga0070667_100218865 3300005367 Bacteria 1694
20 Ga0070703_10079242 3300005406 Bacteria 1115
21 Ga0070701_10930017 3300005438 Bacteria 602
22 Ga0070705_100351290 3300005440 Bacteria 1075
23 Ga0070700_100753240 3300005441 Bacteria 780
24 Ga0070700_101296872 3300005441 Bacteria 612
25 Ga0070708_100014989 3300005445 Bacteria 6391
26 Ga0070708_100152973 3300005445 Bacteria 2146
27 Ga0070663_100025661 3300005455 Bacteria 3981
28 Ga0070678_100339763 3300005456 Bacteria 1288
29 Ga0070662_100892334 3300005457 Bacteria 758
30 Ga0070662_101036413 3300005457 Bacteria 703
31 Ga0070681_10216533 3300005458 Bacteria 1831
32 Ga0068867_100296303 3300005459 Bacteria 1332
33 Ga0070706_100065226 3300005467 Bacteria 3367
34 Ga0070706_100242092 3300005467 Bacteria 1684
35 Ga0070706_101040607 3300005467 Bacteria 754
36 Ga0070707_100214492 3300005468 Bacteria 1876
37 Ga0070707_100519793 3300005468 Bacteria 1152
38 Ga0070698_100075935 3300005471 Bacteria 3364
39 Ga0070698_100116467 3300005471 Bacteria 2635
40 Ga0070698_100408425 3300005471 Bacteria 1292
41 Ga0070698_101158204 3300005471 Bacteria 722
42 Ga0070699_100211043 3300005518 Bacteria 1728
43 Ga0070699_100245816 3300005518 Bacteria 1598
44 Ga0070699_100701153 3300005518 Bacteria 925
45 Ga0070699_100798634 3300005518 Bacteria 864
46 Ga0070697_100502163 3300005536 Bacteria 1060
47 Ga0070697_100794978 3300005536 Bacteria 837
48 Ga0070672_100010627 3300005543 Bacteria 6391
49 Ga0070686_100000094 3300005544 Bacteria 61903
50 Ga0070686_100697866 3300005544 Bacteria 809
51 Ga0070686_100857747 3300005544 Bacteria 736
52 Ga0070696_100000280 3300005546 Bacteria 30711
53 Ga0070696_100733573 3300005546 Bacteria 808
54 Ga0070665_100164960 3300005548 Bacteria 2218
55 Ga0070704_101099587 3300005549 Bacteria 722
56 Ga0070664_100562923 3300005564 Bacteria 1055
57 Ga0070664_100783981 3300005564 Bacteria 891
58 Ga0068857_100468206 3300005577 Bacteria 1180
59 Ga0068854_100578483 3300005578 Bacteria 956
60 Ga0068854_100826963 3300005578 Bacteria 809
61 Ga0068859_100682329 3300005617 Bacteria 1118
62 Ga0068864_100148996 3300005618 Bacteria 2118
63 Ga0068864_101302215 3300005618 Bacteria 727
64 Ga0068870_10088256 3300005840 Bacteria 1728
65 Ga0068863_100900788 3300005841 Bacteria 885
66 Ga0068858_100908845 3300005842 Bacteria 861
67 Ga0068858_100936063 3300005842 Bacteria 848
68 Ga0068860_100315974 3300005843 Bacteria 1532
69 Ga0068860_100446642 3300005843 Bacteria 1285
70 Ga0068860_101762370 3300005843 Bacteria 641
71 Ga0068862_100012268 3300005844 Bacteria 7086
72 Ga0068862_100214549 3300005844 Bacteria 1740
73 Ga0068862_100400453 3300005844 Bacteria 1284
74 Ga0081455_10787265 3300005937 Bacteria 598
75 Ga0081538_10037415 3300005981 Bacteria 3148
76 Ga0075430_101487406 3300006846 Bacteria 556
77 Ga0075433_10006674 3300006852 Bacteria 9138
78 Ga0075434_100131286 3300006871 Bacteria 2524
79 Ga0068865_100083689 3300006881 Bacteria 2297
80 Ga0068865_101048583 3300006881 Bacteria 716
81 Ga0097620_100682304 3300006931 Bacteria 1118
82 Ga0075435_100020334 3300007076 Bacteria 5084
83 Ga0111539_10359586 3300009094 Bacteria 1694
84 Ga0105245_10002661 3300009098 Bacteria 16077
85 Ga0114129_10043253 3300009147 Bacteria 6337
86 Ga0114129_10585141 3300009147 Unclassified 1448
87 Ga0105243_10464587 3300009148 Bacteria 1191
88 Ga0105242_10445451 3300009176 Bacteria 1219
89 Ga0105248_10290383 3300009177 Bacteria 1841
90 Ga0105249_10832556 3300009553 Bacteria 988
91 Ga0157373_10210463 3300013100 Bacteria 1371
92 Ga0157369_10001579 3300013105 Bacteria 27879
93 Ga0157378_10491187 3300013297 Bacteria 1225
94 Ga0157378_10984715 3300013297 Bacteria 877
95 Ga0157375_10044903 3300013308 Bacteria 4298
96 Ga0163163_10103774 3300014325 Bacteria 2867
97 Ga0163163_10218990 3300014325 Bacteria 1952
98 Ga0157380_10308801 3300014326 Bacteria 1461
99 Ga0182008_10047602 3300014497 Bacteria 2130
100 Ga0157377_10228035 3300014745 Bacteria 1196
101 Ga0157377_10338589 3300014745 Bacteria 1005
102 Ga0157379_10335983 3300014968 Bacteria 1381
103 Ga0157376_10208288 3300014969 Bacteria 1803
104 Ga0157376_11613729 3300014969 Bacteria 683
105 Ga0163161_10041654 3300017792 Bacteria 3300
106 Ga0163161_10754739 3300017792 Bacteria 814
107 Ga0213873_10013358 3300021358 Bacteria 1800
108 Ga0213874_10089161 3300021377 Bacteria 1011
109 Ga0213876_10013885 3300021384 Bacteria 4269
110 Ga0213876_10120124 3300021384 Unclassified 1395
111 Ga0213875_10000406 3300021388 Bacteria 37876
112 Ga0207653_10139446 3300025885 Bacteria 886
113 Ga0207682_10095310 3300025893 Bacteria 1296
114 Ga0207680_10262412 3300025903 Bacteria 1196
115 Ga0207645_10031704 3300025907 Bacteria 3399
116 Ga0207645_10112884 3300025907 Bacteria 1760
117 Ga0207645_10198709 3300025907 Bacteria 1319
118 Ga0207643_10002819 3300025908 Bacteria 9379
119 Ga0207684_10002345 3300025910 Bacteria 19179
120 Ga0207654_11159712 3300025911 Bacteria 563
121 Ga0207646_10940612 3300025922 Bacteria 765
122 Ga0207681_10109583 3300025923 Bacteria 2006
123 Ga0207650_11064635 3300025925 Bacteria 688
124 Ga0207659_10402539 3300025926 Bacteria 1145
125 Ga0207687_10353250 3300025927 Bacteria 1198
126 Ga0207644_10001026 3300025931 Bacteria 17873
127 Ga0207690_11003893 3300025932 Bacteria 694
128 Ga0207706_10338514 3300025933 Bacteria 1309
129 Ga0207706_10449864 3300025933 Bacteria 1114
130 Ga0207709_10304270 3300025935 Bacteria 1187
131 Ga0207669_10130582 3300025937 Bacteria 1725
132 Ga0207704_10189706 3300025938 Bacteria 1494
133 Ga0207691_10000680 3300025940 Bacteria 33596
134 Ga0207711_10985588 3300025941 Bacteria 782
135 Ga0207689_10056165 3300025942 Bacteria 3239
136 Ga0207689_10067829 3300025942 Bacteria 2931
137 Ga0207689_10231725 3300025942 Bacteria 1526
138 Ga0207679_10212277 3300025945 Bacteria 1624
139 Ga0207651_10075136 3300025960 Bacteria 2410
140 Ga0207651_10977894 3300025960 Bacteria 756
141 Ga0207712_11405943 3300025961 Bacteria 624
142 Ga0207668_10414442 3300025972 Bacteria 1142
143 Ga0207668_10967974 3300025972 Bacteria 759
144 Ga0207640_10583940 3300025981 Bacteria 943
145 Ga0207640_10781883 3300025981 Bacteria 825
146 Ga0207677_10425915 3300026023 Bacteria 1131
147 Ga0207678_10170433 3300026067 Bacteria 1858
148 Ga0207708_10846226 3300026075 Bacteria 789
149 Ga0207648_10112477 3300026089 Bacteria 2391
150 Ga0207674_10068731 3300026116 Bacteria 3564
151 Ga0207675_100929221 3300026118 Bacteria 887
152 Ga0268266_10698966 3300028379 Bacteria 977
153 Ga0268265_10147468 3300028380 Bacteria 1979
154 Ga0268265_10551135 3300028380 Bacteria 1095
155 Ga0268265_10622332 3300028380 Bacteria 1034
156 Ga0268264_10688880 3300028381 Bacteria 1014
157 Ga0268264_10833498 3300028381 Bacteria 923
158 Ga0265325_10022804 3300031241 Bacteria 3425
159 Ga0265340_10171217 3300031247 Bacteria 983
160 Ga0265339_10052208 3300031249 Bacteria 2228
161 Ga0307509_10025035 3300031507 Bacteria 6671
162 Ga0307509_10668884 3300031507 Bacteria 706
163 Ga0307405_10248962 3300031731 Unclassified 1321
164 Ga0307407_10345393 3300031903 Unclassified 1052
165 Ga0307412_10141309 3300031911 Bacteria 1764
166 Ga0307416_100309001 3300032002 Bacteria 1576
167 Ga0307411_10353581 3300032005 Bacteria 1199
168 Ga0307415_101052889 3300032126 Bacteria 759
169 Ga0373934_0277000 3300035086 Bacteria 695
170 Ga0373933_0389425 3300035724 Bacteria 908
171 Ga0373933_1095891 3300035724 Bacteria 525
172 Ga0373937_0103457 3300036401 Bacteria 2645
173 Ga0395900_1466375 3300037418 Bacteria 595
174 Ga0436364_0034450 3300037853 Bacteria 166663
175 Ga0436365_0025441 3300039437 Bacteria 561
176 Ga0436365_1766645 3300039437 Bacteria 7452
177 Ga0436365_1856850 3300039437 Bacteria 10144
178 Ga0436363_0359688 3300039450 Bacteria 1788
179 Ga0436362_0578587 3300039453 Bacteria 1652
180 Ga0450922_034057 3300042124 Bacteria 562
181 Ga0451577_0778669 3300042876 Bacteria 865
182 Ga0466960_0326293 3300044901 Bacteria 870
183 Ga0466967_0125386 3300045976 Bacteria 2378
184 Ga0495603_0060658 3300046455 Bacteria 2235
185 Ga0495594_0537768 3300046499 Bacteria 663
186 Ga0495606_0036399 3300046507 Bacteria 3352
187 Ga0495654_0099652 3300046530 Bacteria 1339
188 Ga0495597_0019997 3300046542 Bacteria 3124
189 Ga0495625_0031080 3300046660 Bacteria 3975
190 Ga0495659_0000065 3300046664 Bacteria 47327
191 Ga0495661_0102478 3300046665 Bacteria 1609
192 Ga0495671_0005729 3300046692 Bacteria 7240
193 Ga0495660_0039888 3300046810 Bacteria 2605
194 Ga0495672_0000627 3300047320 Bacteria 39464
195 Ga0496102_1061388 3300048905 Bacteria 730
196 Ga0496102_1362363 3300048905 Bacteria 628
197 Ga0496105_0179577 3300048908 Bacteria 1733
198 Ga0496106_0568301 3300048909 Bacteria 909
199 Ga0496108_0576506 3300048911 Bacteria 981
200 Ga0496110_0869715 3300048913 Bacteria 807
201 Ga0496111_0022926 3300048914 Bacteria 4377
202 Ga0496112_0000010 3300048915 Bacteria 245046
203 Ga0496112_0838585 3300048915 Bacteria 843
204 Ga0501039_0092220 3300049575 Bacteria 2361
205 Ga0501040_0361680 3300049576 Bacteria 1040
206 Ga0501042_0130813 3300049578 Bacteria 1809
207 Ga0501067_0087240 3300049583 Bacteria 1731
208 Ga0501072_0006598 3300049588 Bacteria 8837
209 Ga0501259_000351 3300049688 Bacteria 7202
210 Ga0501079_0336914 3300049741 Bacteria 1181
211 nmdc:mga05p37_45834_c1 3300050507 Bacteria 5377
212 nmdc:mga0qj67_1165197_c1 3300050509 Bacteria 600
213 nmdc:mga08y16_136892_c1 3300050511 Bacteria 2545
214 nmdc:mga0n895_664878_c1 3300050512 Bacteria 1039
215 nmdc:mga0n895_8157_c1 3300050512 Bacteria 9050
216 nmdc:mga0n895_92913_c1 3300050512 Bacteria 3020
217 nmdc:mga0rr50_298813_c1 3300050513 Bacteria 1346
218 nmdc:mga0rr50_752990_c1 3300050513 Bacteria 831
219 nmdc:mga08x19_205584_c1 3300050514 Bacteria 1350
220 nmdc:mga0a205_101086_c1 3300050515 Bacteria 2782
221 Ga0500593_187096 3300053117 Bacteria 762
222 Ga0500642_0094630 3300053130 Bacteria 1384
223 Ga0530510_0120220 3300061734 Bacteria 1928
224 Ga0530510_1445448 3300061734 Bacteria 528
225 2644358004 2643221664 Bacteria 7272945
226 2870791017 2870782633 Bacteria 9624083
227 Ga0070708_100015629
228 Ga0065704_10077103
229 Ga0070676_10116265
230 Ga0070670_100042547
231 Ga0070677_10088540
232 Ga0068869_100062516
233 Ga0068869_100371244
234 Ga0068869_100776609
235 Ga0068868_100190801
236 Ga0070660_100575294
237 Ga0070668_100084493
238 Ga0070668_100428858
239 Ga0070669_100902804
240 Ga0070675_100159890
241 Ga0070671_100011665
242 Ga0070674_100089540
243 Ga0070673_100392634
244 Ga0070659_100826498
245 Ga0070667_100218865
246 Ga0070703_10079242
247 Ga0070701_10930017
248 Ga0070705_100351290
249 Ga0070700_100753240
250 Ga0070700_101296872
251 Ga0070708_100014989
252 Ga0070708_100152973
253 Ga0070663_100025661
254 Ga0070678_100339763
255 Ga0070662_100892334
256 Ga0070662_101036413
257 Ga0070681_10216533
258 Ga0068867_100296303
259 Ga0070706_100065226
260 Ga0070706_100242092
261 Ga0070706_101040607
262 Ga0070707_100214492
263 Ga0070707_100519793
264 Ga0070698_100075935
265 Ga0070698_100116467
266 Ga0070698_100408425
267 Ga0070698_101158204
268 Ga0070699_100211043
269 Ga0070699_100245816
270 Ga0070699_100701153
271 Ga0070699_100798634
272 Ga0070697_100502163
273 Ga0070697_100794978
274 Ga0070672_100010627
275 Ga0070686_100000094
276 Ga0070686_100697866
277 Ga0070686_100857747
278 Ga0070696_100000280
279 Ga0070696_100733573
280 Ga0070665_100164960
281 Ga0070704_101099587
282 Ga0070664_100562923
283 Ga0070664_100783981
284 Ga0068857_100468206
285 Ga0068854_100578483
286 Ga0068854_100826963
287 Ga0068859_100682329
288 Ga0068864_100148996
289 Ga0068864_101302215
290 Ga0068870_10088256
291 Ga0068863_100900788
292 Ga0068858_100908845
293 Ga0068858_100936063
294 Ga0068860_100315974
295 Ga0068860_100446642
296 Ga0068860_101762370
297 Ga0068862_100012268
298 Ga0068862_100214549
299 Ga0068862_100400453
300 Ga0081455_10787265
301 Ga0081538_10037415
302 Ga0075430_101487406
303 Ga0075433_10006674
304 Ga0075434_100131286
305 Ga0068865_100083689
306 Ga0068865_101048583
307 Ga0097620_100682304
308 Ga0075435_100020334
309 Ga0111539_10359586
310 Ga0105245_10002661
311 Ga0114129_10043253
312 Ga0114129_10585141
313 Ga0105243_10464587
314 Ga0105242_10445451
315 Ga0105248_10290383
316 Ga0105249_10832556
317 Ga0157373_10210463
318 Ga0157369_10001579
319 Ga0157378_10491187
320 Ga0157378_10984715
321 Ga0157375_10044903
322 Ga0163163_10103774
323 Ga0163163_10218990
324 Ga0157380_10308801
325 Ga0182008_10047602
326 Ga0157377_10228035
327 Ga0157377_10338589
328 Ga0157379_10335983
329 Ga0157376_10208288
330 Ga0157376_11613729
331 Ga0163161_10041654
332 Ga0163161_10754739
333 Ga0213873_10013358
334 Ga0213874_10089161
335 Ga0213876_10013885
336 Ga0213876_10120124
337 Ga0213875_10000406
338 Ga0207653_10139446
339 Ga0207682_10095310
340 Ga0207680_10262412
341 Ga0207645_10031704
342 Ga0207645_10112884
343 Ga0207645_10198709
344 Ga0207643_10002819
345 Ga0207684_10002345
346 Ga0207654_11159712
347 Ga0207646_10940612
348 Ga0207681_10109583
349 Ga0207650_11064635
350 Ga0207659_10402539
351 Ga0207687_10353250
352 Ga0207644_10001026
353 Ga0207690_11003893
354 Ga0207706_10338514
355 Ga0207706_10449864
356 Ga0207709_10304270
357 Ga0207669_10130582
358 Ga0207704_10189706
359 Ga0207691_10000680
360 Ga0207711_10985588
361 Ga0207689_10056165
362 Ga0207689_10067829
363 Ga0207689_10231725
364 Ga0207679_10212277
365 Ga0207651_10075136
366 Ga0207651_10977894
367 Ga0207712_11405943
368 Ga0207668_10414442
369 Ga0207668_10967974
370 Ga0207640_10583940
371 Ga0207640_10781883
372 Ga0207677_10425915
373 Ga0207678_10170433
374 Ga0207708_10846226
375 Ga0207648_10112477
376 Ga0207674_10068731
377 Ga0207675_100929221
378 Ga0268266_10698966
379 Ga0268265_10147468
380 Ga0268265_10551135
381 Ga0268265_10622332
382 Ga0268264_10688880
383 Ga0268264_10833498
384 Ga0265325_10022804
385 Ga0265340_10171217
386 Ga0265339_10052208
387 Ga0307509_10025035
388 Ga0307509_10668884
389 Ga0307405_10248962
390 Ga0307407_10345393
391 Ga0307412_10141309
392 Ga0307416_100309001
393 Ga0307411_10353581
394 Ga0307415_101052889
395 Ga0373934_0277000
396 Ga0373933_0389425
397 Ga0373933_1095891
398 Ga0373937_0103457
399 Ga0395900_1466375
400 Ga0436364_0034450
401 Ga0436365_0025441
402 Ga0436365_1766645
403 Ga0436365_1856850
404 Ga0436363_0359688
405 Ga0436362_0578587
406 Ga0450922_034057
407 Ga0451577_0778669
408 Ga0466960_0326293
409 Ga0466967_0125386
410 Ga0495603_0060658
411 Ga0495594_0537768
412 Ga0495606_0036399
413 Ga0495654_0099652
414 Ga0495597_0019997
415 Ga0495625_0031080
416 Ga0495659_0000065
417 Ga0495661_0102478
418 Ga0495671_0005729
419 Ga0495660_0039888
420 Ga0495672_0000627
421 Ga0496102_1061388
422 Ga0496102_1362363
423 Ga0496105_0179577
424 Ga0496106_0568301
425 Ga0496108_0576506
426 Ga0496110_0869715
427 Ga0496111_0022926
428 Ga0496112_0000010
429 Ga0496112_0838585
430 Ga0501039_0092220
431 Ga0501040_0361680
432 Ga0501042_0130813
433 Ga0501067_0087240
434 Ga0501072_0006598
435 Ga0501259_000351
436 Ga0501079_0336914
437 nmdc:mga05p37_45834_c1
438 nmdc:mga0qj67_1165197_c1
439 nmdc:mga08y16_136892_c1
440 nmdc:mga0n895_664878_c1
441 nmdc:mga0n895_8157_c1
442 nmdc:mga0n895_92913_c1
443 nmdc:mga0rr50_298813_c1
444 nmdc:mga0rr50_752990_c1
445 nmdc:mga08x19_205584_c1
446 nmdc:mga0a205_101086_c1
447 Ga0500593_187096
448 Ga0500642_0094630
449 Ga0530510_0120220
450 Ga0530510_1445448
451 2644358004
452 2870791017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

33

149

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9307 5 161
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9247 5 161
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9229 5 161
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9079 5 161
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9007 5 161
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9179 5 161 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8935 5 161 3.10.180.10
af_A0A1D8PQM9_7_118_1.10.8.1290 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Glutaminyl-tRNA synthetase, non-specific RNA binding region part 1, domain 1 0.873 135 162 1.10.8.1290
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8614 77 124 3.30.720.110
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8405 8 68 3.30.720.100
ID Description Score Start End GO Terms
AF-A0A7V2H353-F1-model_v4 VOC family protein 0.9869 5 163
AF-A0A2V7RPT2-F1-model_v4 PhnB-like domain-containing protein 0.9858 85 163
AF-A0A539DNI0-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9839 73 163 GO:0008168
GO:0032259
AF-A0A6P2T3A2-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.983 3 163 GO:0008168
GO:0032259
AF-A0A8A8FF36-F1-model_v4 deleted 0.9816 1 163

Map