F337810

General Info

Members Datasets Scaffolds Average Seq Length
225 122 450 241

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10000065|Ga0157376_1000006531
Length 281
Sequence MRQLPPTPVSFGHEIAQRLQDSARLRSLFAEFAYTCFMHFILVDTADARGCVALFRDAQLLDVVRHPAEEEFSSWLLPAVRDLLSEASLSHANLDAYAVCAGPGSFTGLRVGLTTVKAWAEIFPRPIVAVSRLEALALWKTPGVSQDTAYRASYLDARRNQVFAALFDRQGASVQPETVMNLGDFLAQVNEICASSPVLWRSPDPELLEQQPALGSPWAFRKSKSDTLETVPPPFAVPLGALAYRKFLAGRTTDAASLDANYVRRSDAELFWKDHASAVKA

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
67 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
68 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
72 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
120 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
121 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
122 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 3.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.33
Rhizosphere 97.78
Stem 0
Stem Tuber 0
Unclassified 29.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10000065 3300014969 Bacteria 86390
2 Ga0070703_10001067 3300005406 Bacteria 8540
3 Ga0070709_10081964 3300005434 Bacteria 2107
4 Ga0070709_10093192 3300005434 Bacteria 1991
5 Ga0070713_100165336 3300005436 Bacteria 1978
6 Ga0070713_100335327 3300005436 Bacteria 1400
7 Ga0070710_10074691 3300005437 Bacteria 1963
8 Ga0070710_10445572 3300005437 Unclassified 877
9 Ga0070711_100001159 3300005439 Bacteria 14188
10 Ga0070711_100025596 3300005439 Unclassified 3862
11 Ga0070711_100204005 3300005439 Bacteria 1527
12 Ga0070705_100004414 3300005440 Bacteria 6852
13 Ga0070694_100008720 3300005444 Bacteria 6210
14 Ga0070708_100005335 3300005445 Bacteria 10192
15 Ga0070708_100006712 3300005445 Bacteria 9164
16 Ga0070708_100047006 3300005445 Unclassified 3811
17 Ga0070706_100011102 3300005467 Bacteria 8365
18 Ga0070706_100218213 3300005467 Bacteria 1780
19 Ga0070707_100032529 3300005468 Bacteria 4971
20 Ga0070707_100262114 3300005468 Bacteria 1681
21 Ga0070707_100264897 3300005468 Unclassified 1671
22 Ga0070698_100000499 3300005471 Bacteria 41776
23 Ga0070698_100108372 3300005471 Bacteria 2744
24 Ga0070699_100048306 3300005518 Unclassified 3683
25 Ga0070679_100103925 3300005530 Bacteria 2827
26 Ga0070697_100000780 3300005536 Bacteria 23901
27 Ga0070697_100006161 3300005536 Bacteria 9280
28 Ga0070697_100102574 3300005536 Bacteria 2377
29 Ga0070695_100015162 3300005545 Unclassified 4652
30 Ga0070696_100001229 3300005546 Bacteria 16617
31 Ga0070693_100000056 3300005547 Bacteria 43765
32 Ga0070665_100000828 3300005548 Bacteria 40402
33 Ga0070704_100097240 3300005549 Bacteria 2209
34 Ga0070704_100375960 3300005549 Unclassified 1206
35 Ga0068856_100504219 3300005614 Unclassified 1231
36 Ga0068863_101050637 3300005841 Unclassified 818
37 Ga0068858_100027497 3300005842 Bacteria 5284
38 Ga0068860_100156236 3300005843 Unclassified 2198
39 Ga0081455_10218651 3300005937 Bacteria 1414
40 Ga0070717_10255316 3300006028 Bacteria 1550
41 Ga0070715_10060354 3300006163 Unclassified 1662
42 Ga0070716_100001156 3300006173 Bacteria 11636
43 Ga0070716_100047967 3300006173 Bacteria 2412
44 Ga0070716_100430840 3300006173 Unclassified 956
45 Ga0070712_100023316 3300006175 Bacteria 4087
46 Ga0070712_100047052 3300006175 Bacteria 2984
47 Ga0070712_100061804 3300006175 Bacteria 2647
48 Ga0070712_100172989 3300006175 Bacteria 1677
49 Ga0070712_100215995 3300006175 Bacteria 1515
50 Ga0070712_100547679 3300006175 Unclassified 974
51 Ga0097621_100008927 3300006237 Bacteria 7246
52 Ga0075434_100307787 3300006871 Bacteria 1605
53 Ga0075436_100071391 3300006914 Bacteria 2400
54 Ga0075435_100027324 3300007076 Unclassified 4462
55 Ga0075435_100111836 3300007076 Bacteria 2272
56 Ga0075435_100481373 3300007076 Bacteria 1072
57 Ga0099794_10009325 3300007265 Unclassified 4121
58 Ga0099794_10028337 3300007265 Bacteria 2604
59 Ga0099794_10032833 3300007265 Unclassified 2438
60 Ga0099794_10061259 3300007265 Unclassified 1828
61 Ga0099794_10071429 3300007265 Unclassified 1701
62 Ga0099794_10081799 3300007265 Bacteria 1594
63 Ga0105240_10075923 3300009093 Bacteria 4144
64 Ga0105240_10078348 3300009093 Bacteria 4070
65 Ga0105245_10102654 3300009098 Unclassified 2648
66 Ga0105247_10039716 3300009101 Bacteria 2875
67 Ga0157369_10232086 3300013105 Bacteria 1929
68 Ga0157374_10801410 3300013296 Unclassified 958
69 Ga0157378_10007169 3300013297 Bacteria 9736
70 Ga0157378_10017584 3300013297 Bacteria 6278
71 Ga0157378_10567570 3300013297 Unclassified 1142
72 Ga0157379_10145870 3300014968 Bacteria 2134
73 Ga0157376_10002628 3300014969 Bacteria 12219
74 Ga0157376_10366975 3300014969 Bacteria 1382
75 Ga0157376_10868481 3300014969 Unclassified 918
76 Ga0213876_10054043 3300021384 Bacteria 2121
77 Ga0207653_10002895 3300025885 Bacteria 5450
78 Ga0207685_10044928 3300025905 Bacteria 1673
79 Ga0207699_10070941 3300025906 Bacteria 2129
80 Ga0207699_10076392 3300025906 Bacteria 2063
81 Ga0207684_10037394 3300025910 Bacteria 4119
82 Ga0207684_10037427 3300025910 Bacteria 4117
83 Ga0207695_10028829 3300025913 Bacteria 6145
84 Ga0207693_10007765 3300025915 Bacteria 8801
85 Ga0207693_10087869 3300025915 Unclassified 2436
86 Ga0207693_10207919 3300025915 Unclassified 1539
87 Ga0207693_10412910 3300025915 Unclassified 1055
88 Ga0207663_10006024 3300025916 Bacteria 6164
89 Ga0207663_10028176 3300025916 Unclassified 3285
90 Ga0207652_10177409 3300025921 Bacteria 1914
91 Ga0207646_10002323 3300025922 Bacteria 22527
92 Ga0207646_10204054 3300025922 Unclassified 1786
93 Ga0207646_10414415 3300025922 Bacteria 1216
94 Ga0207700_10141237 3300025928 Bacteria 1979
95 Ga0207704_10195919 3300025938 Unclassified 1474
96 Ga0207665_10000807 3300025939 Bacteria 21194
97 Ga0207665_10009276 3300025939 Bacteria 6460
98 Ga0207703_10101453 3300026035 Bacteria 2440
99 Ga0207641_10008001 3300026088 Bacteria 8763
100 Ga0207641_11119972 3300026088 Unclassified 786
101 Ga0209588_1017306 3300027671 Unclassified 2234
102 Ga0265354_1003440 3300028016 Bacteria 1773
103 Ga0265354_1003441 3300028016 Bacteria 1773
104 Ga0268266_10001200 3300028379 Bacteria 31990
105 Ga0268264_10247322 3300028381 Unclassified 1655
106 Ga0265770_1003424 3300030878 Bacteria 2156
107 Ga0265770_1005861 3300030878 Bacteria 1697
108 Ga0265760_10000038 3300031090 Bacteria 42230
109 Ga0265760_10024244 3300031090 Bacteria 1767
110 Ga0265760_10034395 3300031090 Unclassified 1499
111 Ga0265760_10037261 3300031090 Unclassified 1443
112 Ga0265760_10047474 3300031090 Unclassified 1289
113 Ga0265760_10065947 3300031090 Unclassified 1105
114 Ga0265325_10015806 3300031241 Bacteria 4234
115 Ga0265325_10117198 3300031241 Bacteria 1288
116 Ga0265331_10013984 3300031250 Bacteria 4293
117 Ga0265316_10071737 3300031344 Bacteria 2669
118 Ga0373926_0004832 3300035083 Bacteria 4432
119 Ga0373934_0005615 3300035086 Bacteria 4645
120 Ga0373923_0013198 3300035111 Bacteria 3073
121 Ga0373923_0122606 3300035111 Unclassified 1163
122 Ga0373953_0114509 3300035117 Unclassified 1142
123 Ga0373954_0000239 3300035118 Bacteria 20065
124 Ga0373954_0010445 3300035118 Bacteria 4099
125 Ga0373954_0031006 3300035118 Unclassified 2466
126 Ga0373956_0021999 3300035119 Bacteria 2724
127 Ga0373957_0026294 3300035120 Bacteria 2104
128 Ga0373955_0179281 3300035172 Unclassified 1256
129 Ga0373935_0010407 3300035692 Bacteria 5576
130 Ga0373927_0009247 3300035695 Bacteria 6610
131 Ga0373933_0004522 3300035724 Bacteria 7625
132 Ga0373937_0000694 3300036401 Bacteria 29354
133 Ga0373937_0062130 3300036401 Bacteria 3434
134 Ga0373925_0110467 3300037068 Unclassified 2123
135 Ga0436365_0227211 3300039437 Bacteria 4106
136 Ga0436362_0690147 3300039453 Unclassified 1494
137 Ga0495592_0022289 3300046454 Unclassified 4819
138 Ga0495651_0000149 3300046462 Bacteria 51195
139 Ga0495651_0006899 3300046462 Bacteria 8680
140 Ga0495651_0117788 3300046462 Bacteria 1954
141 Ga0495653_0007083 3300046463 Bacteria 9196
142 Ga0495580_0005030 3300046472 Bacteria 11022
143 Ga0495580_0058365 3300046472 Bacteria 2714
144 Ga0495580_0082486 3300046472 Bacteria 2241
145 Ga0495580_0136828 3300046472 Unclassified 1699
146 Ga0495580_0158163 3300046472 Unclassified 1569
147 Ga0495580_0504759 3300046472 Unclassified 807
148 Ga0495582_0000069 3300046473 Bacteria 52545
149 Ga0495582_0020062 3300046473 Bacteria 3657
150 Ga0495582_0085450 3300046473 Unclassified 1755
151 Ga0495639_0016156 3300046475 Bacteria 3239
152 Ga0495664_0081744 3300046477 Bacteria 1937
153 Ga0495594_0211249 3300046499 Unclassified 1106
154 Ga0495608_0015836 3300046511 Bacteria 5218
155 Ga0495608_0121805 3300046511 Bacteria 1672
156 Ga0495630_0021521 3300046517 Bacteria 4761
157 Ga0495630_0279456 3300046517 Unclassified 1275
158 Ga0495666_0017331 3300046526 Bacteria 3588
159 Ga0495652_0009051 3300046529 Bacteria 9059
160 Ga0495652_0011015 3300046529 Bacteria 8194
161 Ga0495665_0011313 3300046531 Bacteria 4828
162 Ga0495640_0056592 3300046533 Bacteria 2679
163 Ga0495640_0189433 3300046533 Unclassified 1308
164 Ga0495586_0018422 3300046535 Bacteria 3717
165 Ga0495586_0139678 3300046535 Unclassified 1359
166 Ga0495586_0383919 3300046535 Unclassified 808
167 Ga0495587_0001079 3300046536 Bacteria 17903
168 Ga0495587_0008502 3300046536 Bacteria 6598
169 Ga0495645_0010438 3300046543 Bacteria 6510
170 Ga0495645_0153228 3300046543 Bacteria 1599
171 Ga0495667_0001402 3300046559 Bacteria 15879
172 Ga0495667_0003042 3300046559 Bacteria 11251
173 Ga0495667_0104834 3300046559 Unclassified 1828
174 Ga0495657_0059260 3300046675 Bacteria 2539
175 Ga0495599_0002147 3300046678 Bacteria 11464
176 Ga0495599_0054372 3300046678 Unclassified 2508
177 Ga0495599_0218764 3300046678 Unclassified 1166
178 Ga0495599_0331600 3300046678 Unclassified 914
179 Ga0495623_0007314 3300046679 Bacteria 7165
180 Ga0495623_0103976 3300046679 Unclassified 1727
181 Ga0495623_0152635 3300046679 Unclassified 1364
182 Ga0495623_0171984 3300046679 Bacteria 1265
183 Ga0495646_0003308 3300046680 Bacteria 10025
184 Ga0495658_0011179 3300046683 Bacteria 4507
185 Ga0495658_0021504 3300046683 Bacteria 3401
186 Ga0495613_0055560 3300046689 Unclassified 2909
187 Ga0495624_0055114 3300046690 Bacteria 2505
188 Ga0495600_0026439 3300046809 Bacteria 3745
189 Ga0495600_0178395 3300046809 Unclassified 1369
190 Ga0495581_0051063 3300047315 Unclassified 2388
191 Ga0495604_0000240 3300047317 Bacteria 49111
192 Ga0495604_0022385 3300047317 Bacteria 5046
193 Ga0495604_0118232 3300047317 Unclassified 1921
194 Ga0495674_0019211 3300047319 Bacteria 6347
195 Ga0495674_0027475 3300047319 Bacteria 5201
196 Ga0495674_0028892 3300047319 Bacteria 5051
197 Ga0495674_0406302 3300047319 Unclassified 1099
198 Ga0495680_0000912 3300047322 Bacteria 32793
199 Ga0495680_0011542 3300047322 Bacteria 7816
200 Ga0495680_0116893 3300047322 Bacteria 1972
201 Ga0495680_0346952 3300047322 Unclassified 1034
202 Ga0495675_0001129 3300047444 Bacteria 16229
203 Ga0495675_0004677 3300047444 Bacteria 8313
204 Ga0495675_0217834 3300047444 Unclassified 1156
205 Ga0495684_0002915 3300047471 Bacteria 13470
206 Ga0495684_0005011 3300047471 Bacteria 10331
207 Ga0495684_0010457 3300047471 Bacteria 7176
208 Ga0495684_0037682 3300047471 Bacteria 3709
209 Ga0495593_0008270 3300047673 Bacteria 6055
210 Ga0495602_0019717 3300048088 Bacteria 6684
211 Ga0495602_0022285 3300048088 Bacteria 6206
212 Ga0495602_0030826 3300048088 Bacteria 5080
213 Ga0495614_0006287 3300048089 Bacteria 5337
214 Ga0496105_0116719 3300048908 Bacteria 2202
215 Ga0496114_0026234 3300048917 Bacteria 4769
216 Ga0496114_0056315 3300048917 Bacteria 3281
217 nmdc:mga0n895_304740_c1 3300050512 Bacteria 1615
218 nmdc:mga0rr50_177801_c1 3300050513 Unclassified 1738
219 nmdc:mga0rr50_188656_c1 3300050513 Bacteria 1688
220 nmdc:mga0rr50_586787_c1 3300050513 Unclassified 950
221 nmdc:mga0rr50_80298_c1 3300050513 Bacteria 2514
222 nmdc:mga08x19_102396_c1 3300050514 Bacteria 1901
223 nmdc:mga08x19_66551_c1 3300050514 Bacteria 2342
224 nmdc:mga0a205_109001_c1 3300050515 Bacteria 2667
225 Ga0495612_0002200 3300053078 Bacteria 8019
226 Ga0157376_10000065
227 Ga0070703_10001067
228 Ga0070709_10081964
229 Ga0070709_10093192
230 Ga0070713_100165336
231 Ga0070713_100335327
232 Ga0070710_10074691
233 Ga0070710_10445572
234 Ga0070711_100001159
235 Ga0070711_100025596
236 Ga0070711_100204005
237 Ga0070705_100004414
238 Ga0070694_100008720
239 Ga0070708_100005335
240 Ga0070708_100006712
241 Ga0070708_100047006
242 Ga0070706_100011102
243 Ga0070706_100218213
244 Ga0070707_100032529
245 Ga0070707_100262114
246 Ga0070707_100264897
247 Ga0070698_100000499
248 Ga0070698_100108372
249 Ga0070699_100048306
250 Ga0070679_100103925
251 Ga0070697_100000780
252 Ga0070697_100006161
253 Ga0070697_100102574
254 Ga0070695_100015162
255 Ga0070696_100001229
256 Ga0070693_100000056
257 Ga0070665_100000828
258 Ga0070704_100097240
259 Ga0070704_100375960
260 Ga0068856_100504219
261 Ga0068863_101050637
262 Ga0068858_100027497
263 Ga0068860_100156236
264 Ga0081455_10218651
265 Ga0070717_10255316
266 Ga0070715_10060354
267 Ga0070716_100001156
268 Ga0070716_100047967
269 Ga0070716_100430840
270 Ga0070712_100023316
271 Ga0070712_100047052
272 Ga0070712_100061804
273 Ga0070712_100172989
274 Ga0070712_100215995
275 Ga0070712_100547679
276 Ga0097621_100008927
277 Ga0075434_100307787
278 Ga0075436_100071391
279 Ga0075435_100027324
280 Ga0075435_100111836
281 Ga0075435_100481373
282 Ga0099794_10009325
283 Ga0099794_10028337
284 Ga0099794_10032833
285 Ga0099794_10061259
286 Ga0099794_10071429
287 Ga0099794_10081799
288 Ga0105240_10075923
289 Ga0105240_10078348
290 Ga0105245_10102654
291 Ga0105247_10039716
292 Ga0157369_10232086
293 Ga0157374_10801410
294 Ga0157378_10007169
295 Ga0157378_10017584
296 Ga0157378_10567570
297 Ga0157379_10145870
298 Ga0157376_10002628
299 Ga0157376_10366975
300 Ga0157376_10868481
301 Ga0213876_10054043
302 Ga0207653_10002895
303 Ga0207685_10044928
304 Ga0207699_10070941
305 Ga0207699_10076392
306 Ga0207684_10037394
307 Ga0207684_10037427
308 Ga0207695_10028829
309 Ga0207693_10007765
310 Ga0207693_10087869
311 Ga0207693_10207919
312 Ga0207693_10412910
313 Ga0207663_10006024
314 Ga0207663_10028176
315 Ga0207652_10177409
316 Ga0207646_10002323
317 Ga0207646_10204054
318 Ga0207646_10414415
319 Ga0207700_10141237
320 Ga0207704_10195919
321 Ga0207665_10000807
322 Ga0207665_10009276
323 Ga0207703_10101453
324 Ga0207641_10008001
325 Ga0207641_11119972
326 Ga0209588_1017306
327 Ga0265354_1003440
328 Ga0265354_1003441
329 Ga0268266_10001200
330 Ga0268264_10247322
331 Ga0265770_1003424
332 Ga0265770_1005861
333 Ga0265760_10000038
334 Ga0265760_10024244
335 Ga0265760_10034395
336 Ga0265760_10037261
337 Ga0265760_10047474
338 Ga0265760_10065947
339 Ga0265325_10015806
340 Ga0265325_10117198
341 Ga0265331_10013984
342 Ga0265316_10071737
343 Ga0373926_0004832
344 Ga0373934_0005615
345 Ga0373923_0013198
346 Ga0373923_0122606
347 Ga0373953_0114509
348 Ga0373954_0000239
349 Ga0373954_0010445
350 Ga0373954_0031006
351 Ga0373956_0021999
352 Ga0373957_0026294
353 Ga0373955_0179281
354 Ga0373935_0010407
355 Ga0373927_0009247
356 Ga0373933_0004522
357 Ga0373937_0000694
358 Ga0373937_0062130
359 Ga0373925_0110467
360 Ga0436365_0227211
361 Ga0436362_0690147
362 Ga0495592_0022289
363 Ga0495651_0000149
364 Ga0495651_0006899
365 Ga0495651_0117788
366 Ga0495653_0007083
367 Ga0495580_0005030
368 Ga0495580_0058365
369 Ga0495580_0082486
370 Ga0495580_0136828
371 Ga0495580_0158163
372 Ga0495580_0504759
373 Ga0495582_0000069
374 Ga0495582_0020062
375 Ga0495582_0085450
376 Ga0495639_0016156
377 Ga0495664_0081744
378 Ga0495594_0211249
379 Ga0495608_0015836
380 Ga0495608_0121805
381 Ga0495630_0021521
382 Ga0495630_0279456
383 Ga0495666_0017331
384 Ga0495652_0009051
385 Ga0495652_0011015
386 Ga0495665_0011313
387 Ga0495640_0056592
388 Ga0495640_0189433
389 Ga0495586_0018422
390 Ga0495586_0139678
391 Ga0495586_0383919
392 Ga0495587_0001079
393 Ga0495587_0008502
394 Ga0495645_0010438
395 Ga0495645_0153228
396 Ga0495667_0001402
397 Ga0495667_0003042
398 Ga0495667_0104834
399 Ga0495657_0059260
400 Ga0495599_0002147
401 Ga0495599_0054372
402 Ga0495599_0218764
403 Ga0495599_0331600
404 Ga0495623_0007314
405 Ga0495623_0103976
406 Ga0495623_0152635
407 Ga0495623_0171984
408 Ga0495646_0003308
409 Ga0495658_0011179
410 Ga0495658_0021504
411 Ga0495613_0055560
412 Ga0495624_0055114
413 Ga0495600_0026439
414 Ga0495600_0178395
415 Ga0495581_0051063
416 Ga0495604_0000240
417 Ga0495604_0022385
418 Ga0495604_0118232
419 Ga0495674_0019211
420 Ga0495674_0027475
421 Ga0495674_0028892
422 Ga0495674_0406302
423 Ga0495680_0000912
424 Ga0495680_0011542
425 Ga0495680_0116893
426 Ga0495680_0346952
427 Ga0495675_0001129
428 Ga0495675_0004677
429 Ga0495675_0217834
430 Ga0495684_0002915
431 Ga0495684_0005011
432 Ga0495684_0010457
433 Ga0495684_0037682
434 Ga0495593_0008270
435 Ga0495602_0019717
436 Ga0495602_0022285
437 Ga0495602_0030826
438 Ga0495614_0006287
439 Ga0496105_0116719
440 Ga0496114_0026234
441 Ga0496114_0056315
442 nmdc:mga0n895_304740_c1
443 nmdc:mga0rr50_177801_c1
444 nmdc:mga0rr50_188656_c1
445 nmdc:mga0rr50_586787_c1
446 nmdc:mga0rr50_80298_c1
447 nmdc:mga08x19_102396_c1
448 nmdc:mga08x19_66551_c1
449 nmdc:mga0a205_109001_c1
450 Ga0495612_0002200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00814

TsaD

tRNA N6-adenosine threonylcarbamoyltransferase

63

222

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a6a-assembly1.cif.gz_A crystal structure of glycoprotein endopeptidase (tm0874) from thermotoga maritima at 2.50 a resolution 0.8422 1 224
2a6a-assembly1.cif.gz_A crystal structure of glycoprotein endopeptidase (tm0874) from thermotoga maritima at 2.50 a resolution 0.8382 1 224
6nak-assembly1.cif.gz_C bacterial protein complex tm bde complex 0.8329 1 215
5br9-assembly3.cif.gz_E crystal structure of an uncharacterized protein with similarity to peptidase yeaz from pseudomonas aeruginosa 0.8127 2 215
2gel-assembly1.cif.gz_A 2.05a crystal structure of salmonella typhimurium yeaz, form b 0.8086 1 215
ID Description Score Start End Superfamily
af_Q2FWL0_1_92_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9495 1 91 3.30.420.40
5br9C01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9364 2 96 3.30.420.40
af_P76256_2_102_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9287 3 97 3.30.420.40
af_Q2FWL0_1_92_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9201 1 91 3.30.420.40
3zeuB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9023 1 99 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A7Y3ELP6-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9707 1 99 GO:0002949
GO:0005829
GO:0016740
AF-A0A4V5SEI4-F1-model_v4 deleted 0.9633 1 95
AF-A0A348Z2H5-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9596 1 88 GO:0002949
GO:0005829
GO:0016740
AF-A0A2V7F7Y5-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9588 1 88 GO:0002949
GO:0005829
GO:0016740
AF-A0A4Q6ER18-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9584 1 87 GO:0002949
GO:0016740

Map