F337781

General Info

Members Datasets Scaffolds Average Seq Length
225 153 450 124

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10855160|Ga0157369_108551602
Length 131
Sequence MRPRKATLTDQELEIMKIVWTLNEATVRDVYEKLLERRKIAYTTVMTLMKILENKGHLEKAGSDTRAFLYRPTHPQNQVIGGMVREFVNRVFNGSAEPLLVHLVKDEGLSDKELADIVRLARGVKEGRKQS

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
122 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.11
Rhizosphere 96
Stem 0
Stem Tuber 0
Unclassified 33.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10855160 3300013105 Bacteria 934
2 Ga0070658_10011778 3300005327 Bacteria 7020
3 Ga0070658_10222955 3300005327 Unclassified 1595
4 Ga0070658_11493273 3300005327 Bacteria 586
5 Ga0070683_100401901 3300005329 Unclassified 1306
6 Ga0070666_10633555 3300005335 Bacteria 781
7 Ga0070680_100002391 3300005336 Bacteria 13889
8 Ga0070661_101032991 3300005344 Unclassified 683
9 Ga0070668_101470310 3300005347 Unclassified 622
10 Ga0070669_100430612 3300005353 Bacteria 1084
11 Ga0070675_100040361 3300005354 Bacteria 3809
12 Ga0070709_10005699 3300005434 Bacteria 6753
13 Ga0070709_10962274 3300005434 Unclassified 678
14 Ga0070713_100599011 3300005436 Bacteria 1047
15 Ga0070711_100083673 3300005439 Bacteria 2281
16 Ga0070705_100001177 3300005440 Bacteria 14310
17 Ga0070694_100029766 3300005444 Bacteria 3566
18 Ga0070708_100131707 3300005445 Bacteria 2315
19 Ga0070678_101003987 3300005456 Unclassified 767
20 Ga0070681_10027708 3300005458 Bacteria 5696
21 Ga0070706_100002240 3300005467 Bacteria 19626
22 Ga0070706_100649950 3300005467 Bacteria 979
23 Ga0070699_100019503 3300005518 Bacteria 5841
24 Ga0070699_100110957 3300005518 Unclassified 2408
25 Ga0070679_100204117 3300005530 Bacteria 1941
26 Ga0070679_100512315 3300005530 Unclassified 1144
27 Ga0070679_100915976 3300005530 Bacteria 820
28 Ga0070684_100067814 3300005535 Unclassified 3135
29 Ga0070697_100006137 3300005536 Bacteria 9295
30 Ga0070697_100776201 3300005536 Unclassified 847
31 Ga0068853_102287178 3300005539 Bacteria 524
32 Ga0070672_100547000 3300005543 Bacteria 1005
33 Ga0070686_100972441 3300005544 Bacteria 695
34 Ga0070695_100011089 3300005545 Bacteria 5387
35 Ga0070695_100743443 3300005545 Unclassified 782
36 Ga0070696_100010794 3300005546 Bacteria 6119
37 Ga0070693_100000887 3300005547 Bacteria 13305
38 Ga0070665_100163823 3300005548 Bacteria 2226
39 Ga0070704_100010062 3300005549 Bacteria 5745
40 Ga0068855_100030096 3300005563 Bacteria 6493
41 Ga0068855_100284901 3300005563 Bacteria 1833
42 Ga0068855_101352833 3300005563 Unclassified 735
43 Ga0068855_101421002 3300005563 Unclassified 714
44 Ga0070664_100034566 3300005564 Bacteria 4240
45 Ga0068857_100869823 3300005577 Bacteria 863
46 Ga0068856_100154951 3300005614 Bacteria 2301
47 Ga0068856_102090636 3300005614 Bacteria 576
48 Ga0068852_102707669 3300005616 Unclassified 515
49 Ga0068859_100085328 3300005617 Bacteria 3203
50 Ga0068866_10441485 3300005718 Unclassified 849
51 Ga0068860_100930041 3300005843 Bacteria 886
52 Ga0068860_100981551 3300005843 Bacteria 862
53 Ga0068862_100448993 3300005844 Bacteria 1215
54 Ga0070717_10120597 3300006028 Unclassified 2246
55 Ga0070716_100606169 3300006173 Unclassified 824
56 Ga0068865_101415304 3300006881 Unclassified 621
57 Ga0097620_100085326 3300006931 Bacteria 3203
58 Ga0105240_10009340 3300009093 Bacteria 13899
59 Ga0105240_10089442 3300009093 Bacteria 3766
60 Ga0105240_10197674 3300009093 Bacteria 2359
61 Ga0105245_10540925 3300009098 Bacteria 1186
62 Ga0105245_10928677 3300009098 Bacteria 912
63 Ga0105245_10947344 3300009098 Bacteria 904
64 Ga0105245_11148375 3300009098 Unclassified 824
65 Ga0114129_10085705 3300009147 Bacteria 4370
66 Ga0114129_11920558 3300009147 Unclassified 717
67 Ga0105241_11687227 3300009174 Unclassified 615
68 Ga0105242_10527896 3300009176 Unclassified 1127
69 Ga0105242_11767770 3300009176 Bacteria 656
70 Ga0105248_10106402 3300009177 Bacteria 3163
71 Ga0105248_10672651 3300009177 Unclassified 1168
72 Ga0105248_13256620 3300009177 Unclassified 516
73 Ga0105237_10040989 3300009545 Bacteria 4671
74 Ga0105237_10142540 3300009545 Bacteria 2390
75 Ga0105237_10537793 3300009545 Bacteria 1175
76 Ga0105237_11691351 3300009545 Unclassified 640
77 Ga0105238_10061129 3300009551 Unclassified 3770
78 Ga0105238_10082399 3300009551 Bacteria 3207
79 Ga0105249_10559032 3300009553 Unclassified 1196
80 Ga0105239_10018484 3300010375 Bacteria 7699
81 Ga0105239_10188882 3300010375 Unclassified 2306
82 Ga0105239_10222970 3300010375 Bacteria 2115
83 Ga0157373_10667663 3300013100 Bacteria 760
84 Ga0157370_10004934 3300013104 Bacteria 15099
85 Ga0157370_10988654 3300013104 Bacteria 762
86 Ga0157369_10016430 3300013105 Bacteria 8323
87 Ga0157369_10151324 3300013105 Bacteria 2452
88 Ga0157369_10298625 3300013105 Bacteria 1676
89 Ga0157369_11320221 3300013105 Bacteria 735
90 Ga0157374_10647100 3300013296 Bacteria 1069
91 Ga0157374_11274393 3300013296 Bacteria 757
92 Ga0157378_10000079 3300013297 Bacteria 88966
93 Ga0157378_10301478 3300013297 Bacteria 1551
94 Ga0157378_10521535 3300013297 Bacteria 1190
95 Ga0157378_13295227 3300013297 Unclassified 501
96 Ga0163162_10115483 3300013306 Bacteria 2784
97 Ga0163162_13059219 3300013306 Unclassified 537
98 Ga0157372_10065837 3300013307 Bacteria 4070
99 Ga0157372_10496895 3300013307 Bacteria 1422
100 Ga0157372_10795735 3300013307 Bacteria 1099
101 Ga0157372_12420605 3300013307 Unclassified 603
102 Ga0157375_10216805 3300013308 Bacteria 2072
103 Ga0157375_12485334 3300013308 Unclassified 618
104 Ga0163163_10238304 3300014325 Bacteria 1869
105 Ga0163163_10245751 3300014325 Bacteria 1840
106 Ga0157380_10003103 3300014326 Bacteria 11334
107 Ga0157380_11057250 3300014326 Unclassified 848
108 Ga0157377_11557420 3300014745 Unclassified 528
109 Ga0157379_10096532 3300014968 Bacteria 2653
110 Ga0207642_10790795 3300025899 Unclassified 603
111 Ga0207680_10589757 3300025903 Bacteria 795
112 Ga0207699_10018856 3300025906 Bacteria 3665
113 Ga0207699_10506372 3300025906 Bacteria 872
114 Ga0207699_10822588 3300025906 Unclassified 683
115 Ga0207705_10017581 3300025909 Bacteria 5119
116 Ga0207684_10453469 3300025910 Bacteria 1101
117 Ga0207684_10663614 3300025910 Bacteria 888
118 Ga0207707_10254049 3300025912 Unclassified 1526
119 Ga0207707_10610062 3300025912 Unclassified 923
120 Ga0207707_11194960 3300025912 Bacteria 616
121 Ga0207695_10051840 3300025913 Bacteria 4305
122 Ga0207695_10269332 3300025913 Unclassified 1599
123 Ga0207671_10063594 3300025914 Bacteria 2742
124 Ga0207671_10502206 3300025914 Bacteria 967
125 Ga0207693_10750424 3300025915 Unclassified 754
126 Ga0207660_10021535 3300025917 Bacteria 4336
127 Ga0207657_10158279 3300025919 Bacteria 1841
128 Ga0207657_10894477 3300025919 Unclassified 684
129 Ga0207649_11017910 3300025920 Unclassified 652
130 Ga0207652_10206809 3300025921 Bacteria 1767
131 Ga0207652_10637815 3300025921 Bacteria 953
132 Ga0207694_10126867 3300025924 Bacteria 2042
133 Ga0207687_10596521 3300025927 Bacteria 930
134 Ga0207687_10759808 3300025927 Unclassified 825
135 Ga0207687_11122108 3300025927 Unclassified 675
136 Ga0207700_10489563 3300025928 Bacteria 1087
137 Ga0207700_10779306 3300025928 Unclassified 855
138 Ga0207690_11355772 3300025932 Unclassified 595
139 Ga0207706_10382771 3300025933 Bacteria 1221
140 Ga0207691_10495206 3300025940 Unclassified 1038
141 Ga0207661_10093438 3300025944 Unclassified 2510
142 Ga0207679_10171500 3300025945 Bacteria 1787
143 Ga0207667_10012021 3300025949 Bacteria 10018
144 Ga0207667_10285666 3300025949 Bacteria 1686
145 Ga0207667_11201944 3300025949 Unclassified 738
146 Ga0207667_11692913 3300025949 Bacteria 599
147 Ga0207712_10624685 3300025961 Unclassified 934
148 Ga0207703_11047842 3300026035 Bacteria 783
149 Ga0207702_10314716 3300026078 Unclassified 1489
150 Ga0207702_11634435 3300026078 Bacteria 637
151 Ga0207648_10154894 3300026089 Unclassified 2023
152 Ga0207648_11443258 3300026089 Unclassified 647
153 Ga0207683_10456284 3300026121 Unclassified 1179
154 Ga0207698_10264101 3300026142 Bacteria 1583
155 Ga0268266_10116849 3300028379 Unclassified 2370
156 Ga0268265_10228635 3300028380 Bacteria 1633
157 Ga0268264_10194353 3300028381 Bacteria 1852
158 Ga0265338_10339886 3300028800 Bacteria 1082
159 Ga0265313_10235417 3300031595 Unclassified 751
160 Ga0307410_10015812 3300031852 Bacteria 4484
161 Ga0307407_10492263 3300031903 Bacteria 897
162 Ga0307409_100005825 3300031995 Bacteria 7150
163 Ga0307416_101200109 3300032002 Bacteria 864
164 Ga0373926_0215698 3300035083 Bacteria 740
165 Ga0373934_0018888 3300035086 Bacteria 2641
166 Ga0373934_0434806 3300035086 Bacteria 550
167 Ga0373923_0131236 3300035111 Unclassified 1126
168 Ga0373953_0053805 3300035117 Bacteria 1632
169 Ga0373954_0007968 3300035118 Bacteria 4641
170 Ga0373956_0201936 3300035119 Unclassified 942
171 Ga0373957_0010232 3300035120 Bacteria 3094
172 Ga0373943_0160889 3300035170 Unclassified 1222
173 Ga0373946_0005641 3300035171 Bacteria 4522
174 Ga0373935_0112323 3300035692 Bacteria 1810
175 Ga0373927_0000353 3300035695 Bacteria 35884
176 Ga0373933_0010375 3300035724 Bacteria 5107
177 Ga0373947_0002622 3300035725 Bacteria 10793
178 Ga0373947_0786771 3300035725 Bacteria 649
179 Ga0373937_0002388 3300036401 Bacteria 15631
180 Ga0373937_0286860 3300036401 Bacteria 1555
181 Ga0373925_0005710 3300037068 Bacteria 9250
182 Ga0373925_0007760 3300037068 Bacteria 7810
183 Ga0373925_1335435 3300037068 Unclassified 588
184 Ga0395898_0498930 3300037466 Bacteria 1158
185 Ga0436365_1182193 3300039437 Unclassified 3466
186 Ga0436360_0510042 3300039438 Unclassified 631
187 Ga0436360_1047867 3300039438 Unclassified 580
188 Ga0436362_1029527 3300039453 Unclassified 523
189 Ga0451841_1319149 3300041498 Bacteria 801
190 Ga0439448_0218098 3300042005 Bacteria 671
191 Ga0439435_0045872 3300042436 Bacteria 1237
192 Ga0450893_0047834 3300042532 Bacteria 796
193 Ga0451577_0054785 3300042876 Unclassified 3560
194 Ga0466967_0146922 3300045976 Archaea 2200
195 Ga0466967_0608980 3300045976 Bacteria 1078
196 Ga0495651_0045073 3300046462 Bacteria 3417
197 Ga0495651_0345099 3300046462 Unclassified 985
198 Ga0495580_0127942 3300046472 Bacteria 1763
199 Ga0495580_0575785 3300046472 Bacteria 746
200 Ga0495608_0047051 3300046511 Bacteria 2869
201 Ga0495630_0057414 3300046517 Bacteria 2917
202 Ga0495665_0096770 3300046531 Unclassified 1550
203 Ga0495645_0569783 3300046543 Bacteria 700
204 Ga0495613_0795274 3300046689 Bacteria 618
205 Ga0495624_0117731 3300046690 Bacteria 1632
206 Ga0495604_0726597 3300047317 Bacteria 629
207 Ga0495676_0292226 3300047321 Bacteria 1101
208 Ga0495680_0200711 3300047322 Bacteria 1431
209 Ga0495675_0116235 3300047444 Unclassified 1668
210 Ga0495684_0164657 3300047471 Unclassified 1652
211 Ga0496101_0155098 3300048904 Bacteria 1754
212 Ga0496102_0007031 3300048905 Bacteria 9608
213 Ga0496104_0804246 3300048907 Bacteria 846
214 Ga0496105_1357617 3300048908 Unclassified 516
215 Ga0496106_0222534 3300048909 Unclassified 1505
216 Ga0496107_0160096 3300048910 Bacteria 1668
217 Ga0496109_1334324 3300048912 Bacteria 653
218 Ga0501047_0266085 3300049581 Unclassified 1561
219 nmdc:mga05p37_83473_c1 3300050507 Bacteria 3936
220 nmdc:mga08y16_4639_c1 3300050511 Bacteria 14317
221 nmdc:mga0rr50_214491_c1 3300050513 Unclassified 1587
222 nmdc:mga08x19_185_c1 3300050514 Bacteria 49962
223 nmdc:mga0a205_1213398_c1 3300050515 Unclassified 602
224 nmdc:mga0a205_1259794_c1 3300050515 Unclassified 587
225 Ga0495619_0588395 3300053085 Unclassified 762
226 Ga0157369_10855160
227 Ga0070658_10011778
228 Ga0070658_10222955
229 Ga0070658_11493273
230 Ga0070683_100401901
231 Ga0070666_10633555
232 Ga0070680_100002391
233 Ga0070661_101032991
234 Ga0070668_101470310
235 Ga0070669_100430612
236 Ga0070675_100040361
237 Ga0070709_10005699
238 Ga0070709_10962274
239 Ga0070713_100599011
240 Ga0070711_100083673
241 Ga0070705_100001177
242 Ga0070694_100029766
243 Ga0070708_100131707
244 Ga0070678_101003987
245 Ga0070681_10027708
246 Ga0070706_100002240
247 Ga0070706_100649950
248 Ga0070699_100019503
249 Ga0070699_100110957
250 Ga0070679_100204117
251 Ga0070679_100512315
252 Ga0070679_100915976
253 Ga0070684_100067814
254 Ga0070697_100006137
255 Ga0070697_100776201
256 Ga0068853_102287178
257 Ga0070672_100547000
258 Ga0070686_100972441
259 Ga0070695_100011089
260 Ga0070695_100743443
261 Ga0070696_100010794
262 Ga0070693_100000887
263 Ga0070665_100163823
264 Ga0070704_100010062
265 Ga0068855_100030096
266 Ga0068855_100284901
267 Ga0068855_101352833
268 Ga0068855_101421002
269 Ga0070664_100034566
270 Ga0068857_100869823
271 Ga0068856_100154951
272 Ga0068856_102090636
273 Ga0068852_102707669
274 Ga0068859_100085328
275 Ga0068866_10441485
276 Ga0068860_100930041
277 Ga0068860_100981551
278 Ga0068862_100448993
279 Ga0070717_10120597
280 Ga0070716_100606169
281 Ga0068865_101415304
282 Ga0097620_100085326
283 Ga0105240_10009340
284 Ga0105240_10089442
285 Ga0105240_10197674
286 Ga0105245_10540925
287 Ga0105245_10928677
288 Ga0105245_10947344
289 Ga0105245_11148375
290 Ga0114129_10085705
291 Ga0114129_11920558
292 Ga0105241_11687227
293 Ga0105242_10527896
294 Ga0105242_11767770
295 Ga0105248_10106402
296 Ga0105248_10672651
297 Ga0105248_13256620
298 Ga0105237_10040989
299 Ga0105237_10142540
300 Ga0105237_10537793
301 Ga0105237_11691351
302 Ga0105238_10061129
303 Ga0105238_10082399
304 Ga0105249_10559032
305 Ga0105239_10018484
306 Ga0105239_10188882
307 Ga0105239_10222970
308 Ga0157373_10667663
309 Ga0157370_10004934
310 Ga0157370_10988654
311 Ga0157369_10016430
312 Ga0157369_10151324
313 Ga0157369_10298625
314 Ga0157369_11320221
315 Ga0157374_10647100
316 Ga0157374_11274393
317 Ga0157378_10000079
318 Ga0157378_10301478
319 Ga0157378_10521535
320 Ga0157378_13295227
321 Ga0163162_10115483
322 Ga0163162_13059219
323 Ga0157372_10065837
324 Ga0157372_10496895
325 Ga0157372_10795735
326 Ga0157372_12420605
327 Ga0157375_10216805
328 Ga0157375_12485334
329 Ga0163163_10238304
330 Ga0163163_10245751
331 Ga0157380_10003103
332 Ga0157380_11057250
333 Ga0157377_11557420
334 Ga0157379_10096532
335 Ga0207642_10790795
336 Ga0207680_10589757
337 Ga0207699_10018856
338 Ga0207699_10506372
339 Ga0207699_10822588
340 Ga0207705_10017581
341 Ga0207684_10453469
342 Ga0207684_10663614
343 Ga0207707_10254049
344 Ga0207707_10610062
345 Ga0207707_11194960
346 Ga0207695_10051840
347 Ga0207695_10269332
348 Ga0207671_10063594
349 Ga0207671_10502206
350 Ga0207693_10750424
351 Ga0207660_10021535
352 Ga0207657_10158279
353 Ga0207657_10894477
354 Ga0207649_11017910
355 Ga0207652_10206809
356 Ga0207652_10637815
357 Ga0207694_10126867
358 Ga0207687_10596521
359 Ga0207687_10759808
360 Ga0207687_11122108
361 Ga0207700_10489563
362 Ga0207700_10779306
363 Ga0207690_11355772
364 Ga0207706_10382771
365 Ga0207691_10495206
366 Ga0207661_10093438
367 Ga0207679_10171500
368 Ga0207667_10012021
369 Ga0207667_10285666
370 Ga0207667_11201944
371 Ga0207667_11692913
372 Ga0207712_10624685
373 Ga0207703_11047842
374 Ga0207702_10314716
375 Ga0207702_11634435
376 Ga0207648_10154894
377 Ga0207648_11443258
378 Ga0207683_10456284
379 Ga0207698_10264101
380 Ga0268266_10116849
381 Ga0268265_10228635
382 Ga0268264_10194353
383 Ga0265338_10339886
384 Ga0265313_10235417
385 Ga0307410_10015812
386 Ga0307407_10492263
387 Ga0307409_100005825
388 Ga0307416_101200109
389 Ga0373926_0215698
390 Ga0373934_0018888
391 Ga0373934_0434806
392 Ga0373923_0131236
393 Ga0373953_0053805
394 Ga0373954_0007968
395 Ga0373956_0201936
396 Ga0373957_0010232
397 Ga0373943_0160889
398 Ga0373946_0005641
399 Ga0373935_0112323
400 Ga0373927_0000353
401 Ga0373933_0010375
402 Ga0373947_0002622
403 Ga0373947_0786771
404 Ga0373937_0002388
405 Ga0373937_0286860
406 Ga0373925_0005710
407 Ga0373925_0007760
408 Ga0373925_1335435
409 Ga0395898_0498930
410 Ga0436365_1182193
411 Ga0436360_0510042
412 Ga0436360_1047867
413 Ga0436362_1029527
414 Ga0451841_1319149
415 Ga0439448_0218098
416 Ga0439435_0045872
417 Ga0450893_0047834
418 Ga0451577_0054785
419 Ga0466967_0146922
420 Ga0466967_0608980
421 Ga0495651_0045073
422 Ga0495651_0345099
423 Ga0495580_0127942
424 Ga0495580_0575785
425 Ga0495608_0047051
426 Ga0495630_0057414
427 Ga0495665_0096770
428 Ga0495645_0569783
429 Ga0495613_0795274
430 Ga0495624_0117731
431 Ga0495604_0726597
432 Ga0495676_0292226
433 Ga0495680_0200711
434 Ga0495675_0116235
435 Ga0495684_0164657
436 Ga0496101_0155098
437 Ga0496102_0007031
438 Ga0496104_0804246
439 Ga0496105_1357617
440 Ga0496106_0222534
441 Ga0496107_0160096
442 Ga0496109_1334324
443 Ga0501047_0266085
444 nmdc:mga05p37_83473_c1
445 nmdc:mga08y16_4639_c1
446 nmdc:mga0rr50_214491_c1
447 nmdc:mga08x19_185_c1
448 nmdc:mga0a205_1213398_c1
449 nmdc:mga0a205_1259794_c1
450 Ga0495619_0588395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

8

122

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a39-assembly2.cif.gz_BP1-2 crystal structure of paax from escherichia coli w 0.9446 30 56
3cuq-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.9291 2 57
4a6d-assembly1.cif.gz_A crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam 0.9173 9 56
2zme-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.9161 2 57
1mzb-assembly1.cif.gz_A ferric uptake regulator 0.9002 8 58
ID Description Score Start End Superfamily
1sd4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9531 2 56 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.932 1 56 1.10.10.10
af_P0C0A2_317_386_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9317 2 57 1.10.10.10
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9313 9 56 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9252 2 55 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5C8A1Q6-F1-model_v4 deleted 0.8295 1 78
AF-A0A2V7D600-F1-model_v4 CopY family transcriptional regulator 0.8165 1 110 GO:0003677
GO:0045892
AF-A0A3D4RA91-F1-model_v4 deleted 0.8124 1 107
AF-A0A855X1J9-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.8089 1 78 GO:0003677
GO:0045892
AF-A0A1F8SE82-F1-model_v4 CopY family transcriptional regulator 0.8064 4 104 GO:0003677
GO:0045892

Map